Beruflich Dokumente
Kultur Dokumente
Duplicate bridge is a different game. It’s true that you can get by if you
play exactly the same way as you would in a home social game or a team
match. To be successful at duplicate pairs, you must adjust your bidding.
This is a book that every novice bridge player needs to read before that
first pairs game at their local club.
In the 1970s, two of the best bridge writers of all time collaborated on a series of eight small
books on aspects of card play at bridge. These books have long been out of print, and are
being republished now in two combined volumes, edited and updated by BRIDGE magazine
editor Mark Horton.
BRIDGE
MAGAZINE
be a great year for Bridge.
Bridge Magazine Online is about to launch
a scheme that will not only ensure the lon-
gevity of the magazine, but also provide a
potential revenue stream for every bridge
playing country in the world, enabling their
Federations to enhance the services they already supply to
their members.
On the playing front the proliferation of top class events will
include magnificent invitation tournaments in Copenhagen,
Moscow & Singapore, what promises to be a record breaking
European Open Championships in Tromsø and a breathtaking
44 BAKER STREET
LONDON W1U 7RT World Championships in Chennai.
Tel: 020-7486 8222
Fax: 020-7486 3355 We mustn’t forget the NEC in Yokohama, the Chairman’s Cup
email: info@bridgeshop.com in Sweden, the EBU’s Summer Festival and the EBL Champi-
http://www.bridgeshop.com ons Cup, which will be staged in England for the first time in
Editor: November.
Mark Horton
Assistant Editors: If you keen to visit America, this year the Nationals are in New
Sandra Landy Orleans, Chicago and Denver.
Neil Rosen
Christina Lund Madsen Add to this list the many festivals that take place all over the world
Advertising: throughout the year - for instance in Surfer’s Paradise, Juan les
Matthew Read
Photographer: Pins, Deauville, Rhodes, Madeira etc you see what a magnificent
Ron Tacchi global sport bridge has become.
Proofreaders:
Danny Roth Bridge Magazine Online will bring you all the news from these
Monica Kummel fantastic events.
Typesetter:
Ron Tacchi Meanwhile, the SportAccord World Mind Games 2015 is look-
BRIDGE Magazine is published
monthly.
ing for a venue. Why not London (following on directly from
Online Subscriptions: the London Chess Classic)?
1 year: £19.95
Individual Issue: Bridgmanite
£2.00
Distributors
CHESS & BRIDGE LTD.
Scientists recently identified a mineral that makes up 38% of the
44 Baker Street
London W1U 7RT U.K.
earth, and they have named it Bridgmanite. Reports suggest that
Views expressed in this publication are not
the most abundant substance on the planet has been named in
necessarily those of the Editor. Editorial
contributions will be published at the
honor of the physicist, Percy Bridgman, who won the Nobel Prize
Editor’s discretion and may be shortened
if space is limited.
in Physics, in 1946, for his high-pressure research.
No parts of this publication may be
reproduced without the prior express
permission of the publishers. All rights
So far there is no evidence to support the theory that exposure
reserved. ©2014 to it will improve your declarer play.
We stand Corrected
Richard Fleet points out that the European Championships predate the Camrose (December
2014 Editorial) Patrick Jourdian observes that the Camrose is the most played international series
as it started slightly later than the Europeans but was held 1937, 1938, 1939 (uncompleted) not
1940-45, but then every year whilst the Europeans is only alternate years.
Meic Goodyear, expressing the wish that we keep up the good work and have a great Yule,
reports that the England-Scotland football match in 1872 is not the earliest international
fixture. That honour belongs to a cricket match in 1844 between Canada and the USA.
Honest!
The Canadian cricket team was the first international team to travel to another coun-
try and the match between the two national sides that year, billed as United States of
America versus the British Empire’s Canadian Province, was the first official international
cricket match. The match took place between 24 and 26 September 1844 at the St George’s
Cricket Club, Bloomingdale Park in New York. Canada won by 23 runs. The game was
watched by between 10,000 and 20,000 spectators and around $120,000 worth of bets
were placed.
See http://en.wikipedia.org/wiki/Canadian_cricket_team_in_the_United_States_in_1844.
Problem Corner
Please note that you should now send your answers to the Prize Problems to Ron Tacchi at:
BMProb@vaupillon.com. You can also send your answers by snail-mail to the Chess & Bridge,
44 Baker Street and they will be forwarded to Ron.
Top Gun
The EBU is running a competition to determine the Player of the Year (who will collect £1000.)
The winner will be the player who accumulates the most points in the period 1 October 2014 -
30 September 2015 from a number of prestigious events, which are:
The Gold Cup, the Spring Fours, the Premier League (first division) Crockfords, Brighton Four
Stars, National Teams Point-a-Board, Brighton Swiss Pairs, National Pairs, Guardian Trophy &
Two Star Pairs.
With three events completed (Two Stars, Premier League and Gold Cup) there is a five way tie
between Alexander Allfrey (he received full credit for winning the Gold Cup, although he did not
play in the final) David Bakhshi, Tony Forrester, David Gold & Andrew Robson.
I’m not sure I would have included the Premier League in this list.
In This Issue
I 6 Problem Corner— Ron Tacchi & Patrick Jourdain. GI 82 Have Some Madeira M’Dear— Ron Tacchi on
GI 7 World Bridge Championships Sanya— The the 2014 Madeira International Bridge Festival
editor reports on the Mixed Teams. I 103 Robot Play has a Human Side — Alvin Levy
I 49 Solution to Non-Prize Problem on the World Computer Championships.
GI 105 This Month’s Video Page
GI 50 After The Flood— The story of the ACBL
Headquarters flood GI 108 An American in Opatija — Christine Lund
I 53 SEKs Appeal— Paul Lamford reports on his Madsen interviews Roy Welland.
team’s victory in the Chairman’s Cup. I 110 Test Your Defence — Julian Pottage
I 72 The Abbot’s Heavenly Vision — David Bird I 112 Partnership Profile — Mark Horton
GI 80 Round and About — Our roving reporter I 118 Solution to Test Your Defence
Maureen Dennison phones home. I 119 Marks & Comments — Alan Mould
Problem ♠ AK 9
♥ K964
♦ QJ7 W
N
E
♠ QJ874
♥ 75
♦ A4
Corner ♣ KJ5
West North
S
East
♣ Q 10 6 2
South
sponsored by – Pass Pass 1♥
THE ORION PUBLISHING GROUP 1NT Pass 2♥* 3♥
Master Bridge Series 3♠ Pass 4♠ All Pass
North leads the three of hearts taken with the ace by
South, who continues with the ten. Plan your play
Prize Problem 299 After last month’s difficult problem an easy one, it is
Count, Count, Count transparent that North’s lead is a singleton, South should
not bid this way without at least six hearts. So how not
♠ K 10 9 8 6 3 2 N ♠ AQ 7 4
♥ Q83 ♥ A9 7 5 4 2 to get the king of hearts ruffed? Easy - don’t play it, in
♦ 6 W E ♦ K2 other words duck and if South continues duck again
♣ A2 S ♣9 and ruff in dummy. Now you still have the king of
hearts for a discard of your losing diamond. You have
West North East South exchanged your diamond loser (the finesse is bound to
– – 1♥ 2NT* fail and it will always fail in a problem) for an additional
3♠ 4♣ 4NT* 5♣ heart loser. Draw trumps ending in hand and now you
5♠* Pass 6♠ All Pass can cash that king of hearts discarding a diamond from
2NT Minors dummy. Now force out the club ace and hey presto you
North leads the jack of clubs. Plan your play. have ten tricks and your contract.
As from this month we are asking you to send your
answers to the Prize Problem direct to Ron Tacchi at
BMProb@vaupillon.com, of course you can still mail
Email your answers to BMProb@vaupillon.com or send it if you prefer as per the address on the left and it will
on a postcard to The Editor, Bridge Magazine, 44 Baker be forwarded to me in due course. Each month I shall
Street, London, W1U 7RT. Entries must be received before examine the entries for correctness and use one of Mrs
31st January. The first correct solution out of the hat will Tacchi’s various hats to extract the winning entry but I
receive £15 of BRIDGE Magazine book vouchers. also hope to keep a record, not only of correct entries
but also of the style and and wit of the responses. I hope
to be fortunate enough to find a sponsor for a small prize
for the entrant who has pleased me most over the year.
Non-Prize Problem See Page 49 This will be a purely personal appraisal of the results.
♠ A 10 3 N ♠ 64 Furthermore if you have any comments on the puzzles
♥ J 10 2 ♥ AK 6 4 please do not hesitate to use the same email address to
♦ A K J 10 W E ♦ 753 correspond with me, you can even send me a problem
♣ A8 3 S ♣ K 10 7 5 for publication if you have one.
In a pairs event West opens a strong no-trump, East
uses Stayman, South overcalls Two Spades, and West’s
2NT is raised to 3NT. Congratulations
North leads the seven of spades. You obviously duck
South’s jack, but, when he follows with the king, Prize Problem 297.
decide to win, North following with the 2. When A tough problem which attracted some excellent
you lead the jack of hearts it is covered by the queen; answers. The winner was Colin Brown.
when you finesse the diamond jack it holds and South’s
queen falls on the next round. On two more dia-
monds, South throws spades. But when you cash two
more hearts, it is North that throws a club. Look for Patrick Jourdain’s Problem Corner,
How do you continue? available from Chess & Bridge.
T he World Bridge Series is both the most spectacular and the most demanding in the cycle of
World Championships. With so many World titles to be decided the tournament imposes
a significant strain on everyone who takes part, both players and officials.
This year the World Bridge Federation had the support of a major sponsor, the Red Bull organ-
isation. Created in 1987 the Austrian company produces the highest selling energy drink in the
world (5,387 billion cans sold in 2013).
They also received a tremendous amount of assistance from the Chinese Bridge Federation,
who (amongst other things) delivered a seemingly limitless supply of young helpers from the
local University.
One of them deserves a special mention – during the Mixed Teams he was tidying up one of
the playing rooms when he found an envelope with a considerable amount of money in it. With
a little investigation it was possible to return it to its owner, a relieved Roy Welland.
Here is how the tournament unfolded from my point of view:
Day 1
The Bulletin Room is located on the first floor of the MGM Hotel, alongside all the other offices.
For the first time I can recall there is to be no VuGraph theatre, which means that Barry Rigal and
David Stern are upgraded (if that is the right word) to being full time members of the Daily Bul-
letin team, joining journalists Jean-Paul Meyer, Brent Manley & Micke Melander, with Monika
Kummel in charge of layout and Francesca Canali providing the photographs.
With play taking place in both the MGM and the adjacent Sheraton everyone should get plenty
of exercise.
Online coverage is being provided by Our Game, another of the tournament’s sponsors, and
BBO, but it quickly becomes apparent that there are some technical issues to be solved with regard
to continued connection to the Internet.
The first event is one of the most popular, the Mixed Teams. In my first article I take the consid-
erable risk of making some predictions. You can judge for yourselves how successful they proved
to be.
With South making use of the world’s most used Bols Bridge Tip (don’t be afraid to respond) N/S
stole the pot, although given that it is not easy for West to get into the bidding (Barry Rigal
observed that a natural 2♣ would be one way) and even then E/W would be doing very well to
reach 4♥, it is not clear how significant an advantage this conferred. 2♠ drifted one down, -50.
Closed Room
West North East South
Welland Long Auken Gong
– 1♣ All Pass
Facing a partner who would have bid at the drop of a hat (and was possibly short in clubs) West
was content to let matters rest. There are ten tricks available in clubs – unluckily for the declarer
it was the defenders who amassed them, down five, -250 and 5 IMPs to Salvo.
Considerable technical problems meant that I was unable to give more than a passing glance to
the remaining deals of the match, although I did notice that in the Open Room South was able
to start with a Multi 2♦ on both ♠1065 ♥A9432 ♦9 ♣J763 and ♠A109873 ♥864 ♦- ♣7632. I
guess if anyone asked South how strong her weak two might be she could reply ‘It all depends
on Mah Mood’.
(the next day I receive a short note from from Eric Kokish:
“It all depends on Mah Mood” should be enshrined in the IBPA Hall of Fame.)
South cashed the king of diamonds and switched to the six of spades. North took the ace and
returned a heart, South winning with the ace and returning a heart for North to ruff, three down,
-500 and 15 IMPs to Pertamina Blue.
The demanding playing schedule means that we finish working late in the day and then face
a long walk to the local restaurants (it was only a few days later that we discovered an excellent
place close to our hotel).
When selecting something from the excellent menu I remember just in time – all mushrooms
are edible; but some only once.
Day 2
I notice that one of the teams that qualified for semifinal A of the Mixed Teams was Jilinsheng-
qiaopaixiehui – could that be the Chinese for supercalifragilisticexpialidocious?
As the competition moves inexorably towards the knock-out stage the breaking news is the
confirmation that the German Doctors have lost their appeal against their conviction of having
used illegal signals.
Jeff Meckstroth is diagnosed with a herniated disc, which makes sitting down uncomfortable.
Not the best thing to happen to a bridge player, but Jeff took it in his stride. By coincidence he
featured in the match I chose to follow.
Blitz Brigade
Blitz Brigade is an online multiplayer game based on WWII. There are two teams, the Allies (the
good guys) and the Axis of Evil (the baddies).
At the end of the first round of semifinal A team Ganzer may have concluded that they had
been up against the Axis of Evil when they faced Rivers.
When East selected the four of clubs declarer had no choice but to finesse and West won with
the king and returned the four of spades, East’s major suit aces producing a rapid one down, -50
and 10 IMPs.
On paper North’s jump to 4♥ is disastrous as on a club lead it will cost 800, but if you can find
a reason to double rather than bid 4♠ with the East hand then I salute you.
North led the three of hearts and declarer won with the ace and played a spade for the nine,
ten and ace. South’s essential diamond return went to the jack and queen and North exited with
the queen of spades, in due course collecting a diamond and a club for one down, -200.
Closed Room
West North East South
Meckstroth Bakkeren Rogers Arnolds
– – – 2♦*
2♠ Double* 3♠ All Pass
2♦ Multi
Double Penalties if your suit is spades
After North’s pass or correct double East/West also need to know the meaning of Pass, Redouble,
2NT and 3♥ (to name but a few).
North led the three of hearts and declarer won with the ace and played a spade to the king and
ace. South again found the essential diamond switch and North took the jack with the queen,
cashed the queen of spades and exited with the nine of hearts. Declarer won with the king and
played a club. When North withheld the ace a defensive trick had vanished and +140 gave Riv-
ers another 8 IMPs on the way to a 33-0, 19.15-0.85 VP win.
You can replay all the deals from this match at: http://tinyurl.com/pvjo797
When Micke Melander tells me he has a big swing to report we join forces to produce an arti-
cle that needs Francesca (photos) & Monika (layout) to produce something special.
In this room Wang-Ma got into big problems when Upmark made a simple overcall of Two Clubs.
Ma could have saved their day by bidding 2NT over Two Diamonds instead of passively passing
it out.
Upmark led his nine of hearts and that went to the jack, queen and ace. Declarer then finessed
in clubs and played a diamond to the seven, eight and king whereupon the defense crossruffed
hearts and clubs to produce one down. If Katrine Bertheau could have imagined that her partner
also held the ace of trumps two down was possible.
Meanwhile China’s He-Wen got into even bigger trouble when Wen thought partner had a two
suiter and not clubs after the same overcall. Weinger had no problems in doubling any contract
the Chinese tried to play.
Weinger started with the king and queen of spades and a third round followed to her partner’s
ace. Delmonte now played a diamond which declarer won in hand and played a club to the king
and ace. East returned the jack of hearts that went to the queen and ace. Declarer was already
three down and nothing could prevent the defense from getting at least two more trump tricks,
so that was five down and -1400, Platinum Cem scoring 16 IMPs with the great score from the
other room.
Board 13. Dealer North. Both Vul.
♠ J 10 3 2
♥ Q3
♦ K854
♣ A32
♠ K875 N ♠ AQ 6 4
♥— ♥ K976
♦ A Q 10 9 7 6 W E ♦ J32
♣ KJ6 S ♣ 87
♠9
♥ A J 10 8 5 4 2
♦—
♣ Q 10 9 5 4
Open Room
West North East South
Hague Voldoire Malinowski Avon
– Pass Pass 4♥
Double Pass 4♠ All Pass
South attempted to cash the ace of hearts, but declarer ruffed in dummy, cashed the king of spades,
played a spade to the ace and ran the jack of diamonds to North’s king. Winning the spade return
with the queen, declarer played on diamonds, pitching a heart when North ruffed in with the ten
of spades. Taking the heart exit with the king declarer played a club to the jack for +620.
Closed Room
West North East South
Romanowski Gunev Rossard Popova
– Pass Pass 4♥
Double All Pass
Day 3
With the knock-out phase of the Mixed Teams under way the players from the eliminated teams
start on the long road that will hopefully lead them into the final of the Mixed Pairs Championship.
Perfect Numbers
In number theory, a perfect number is a positive integer that is equal to the sum of its proper
positive divisors, that is, the sum of its positive divisors excluding the number itself (also known
as its aliquot sum). Equivalently, a perfect number is a number that is half the sum of all of its
positive divisors (including itself ) i.e.∑1(n) = 2n.
For 28, the divisors are 1, 2 4, 7, and 14.
Given that the matches of the round of 32 in the 14th Red Bull World Bridge Series Mixed
Teams were of 28 boards all the players would be looking for some perfect numbers.
I elected to watch the match between Hauge (seeded 19) and McAllister (14).
Board 4. Dealer West. All Vul.
♠ Q9
♥ J432
♦ J 10 6
♣ 10 7 5 4
♠ AK J 8 7 6 N ♠ 10 3 2
♥K ♥ A Q 10
♦ Q543 W E ♦ AK 2
♣ AJ S ♣ Q943
♠ 54
♥ 98765
♦ 987
♣ K82
Open Room
West North East South
Hauge McAllister Malinowski Zur Campanile
1♠ Pass 2♣* Pass
2♦ Pass 3♠ Pass
4♣* Pass 4♦* Pass
4♥* Pass 4♠ All Pass
2♣ Game-forcing
4♣ Cue-bid
4♦ Cue-bid
4♥ Cue-bid
East led the two of hearts and when West put in the seven declarer won with the ten and played
a diamond to the king and ace. West continued with the ace of hearts and a heart and declarer
won and cleared the diamonds. That was eight tricks, +120.
To defeat 2NT East must lead a spade – not exactly obvious.
With an awkward lead North tried the seven of spades and declarer was not hard pressed to take
ten tricks (eleven are possible and there is no lead to defeat Four Spades) +170.
Closed Room
West North East South
Bilde Gunev Lund Madsen Popova
– – Pass Pass
1♠ Pass 1NT* Pass
2♣* Pass 2♠ Pass
3NT All Pass
To defeat 3NT South must lead a club honour, not at all easy given the auction. She went for the
ten of hearts for the jack and king and North returned the two to declarer’s ace. Three rounds of
spades put South on lead and after a club to the king and a club declarer could win with the ace
and claim nine tricks, +600 and 10 IMPs, 37-6 for McAllister.
East led the seven of clubs and declarer won with the ace and ran the jack of hearts to West’s king.
A diamond to the king and ace saw East play a second club and declarer won with dummy’s king,
ruffed a club, crossed to dummy with a heart, drew the outstanding trump, played a diamond to
the queen, cashed two trumps and played a spade to the ace. That was nine tricks, but the defend-
ers took the last two, +50
Closed Room
West North East South
Bilde Gunev Lund Madsen Popova
– – – 1NT
Pass 2♦ 2♠ Pass
Pass 4♥ All Pass
East led the four of spades and when declarer played low from dummy West won with the king
and switched to the four of diamonds for the queen and ace. When East failed to continue with
the jack of diamonds, preferring a second spade, declarer could win with dummy’s jack, come to
hand with a club and run the jack of hearts. In due course the ace of spades took care of the los-
ing diamond, +420 and 10 IMPs back to Hauge, who trailed 37-18 at half time.
Classical Themes
The quarter-finals of the 14th Red Bull World Bridge Series Mixed Teams Championships contained
more than one deal that replicated themes that have been frequently discussed in the text books.
Board 6. Dealer East. E/W Vul.
♠ 9643
♥ K5
♦ QJ5
♣ 10 9 4 2
♠ QJ82 N ♠ A7 5
♥ 9862 ♥ AQ 3
♦ K98 W E ♦ A 10 6 3 2
♣ A8 S ♣ J7
♠ K 10
♥ J 10 7 4
♦ 74
♣ KQ653
Open Room
West North East South
Kowalski Welland Miszewska Auken
– – 1NT Pass
2♣* Pass 2♦* Pass
3NT All Pass
2♣ Stayman
2♦ No major
What to lead from the South hand?
Suppose you decide your best chance is to start with a club – which one do you go for?
I think I am right in saying that in one of his books Hugh Kelsey advocated that with an out-
side entry you should start with an honour, while with no entry a low card is best, catering for
partner, or possibly declarer or dummy, holding Ax.
Meanwhile I am pretty sure that messers Bird and Anthias will confirm that a club honour is best.
Whatever the merits of this argument it is clear that on this layout leading a low club will be
catastrophic.
The alternative to a club is a heart – here I suspect the universal choice would be a low card.
If you lead a heart here and declarer takes partner’s king with the ace and ducks a diamond to
North then a club switch will be essential. Pairs playing Smith Peters should be in a position to
get that right.
Here South led a club. It was the three.
That gave declarer a second club trick and with the heart finesse onside and the diamonds break-
ing declarer had nine tricks, +600.
North led the queen of diamonds and declarer could not avoid the loss of a trump and two clubs,
one down, -100 and 12 IMPs to Vitas.
North led the five of spades and declarer won with the queen and played a heart to the three, eight
and jack. South returned the ten of diamonds and North allowed that to run to dummy’s queen
(difficult for North to win and switch to a club). Declarer cashed four rounds of spades followed
by two rounds of hearts, but when the suit failed to divide he was one down, -50.
Closed Room
West North East South
Zorlu Vainikonis Sinclair Gulevich
1NT Pass 3♣* Double
3♠ Pass 4♠ All Pass
North led the ace of diamonds and when South followed with the jack he accurately switched to
the four of clubs. Declarer took South’s jack with the king, cashed the queen and jack of spades,
played a spade to the king and a low club. When South nervously went up with the ace declarer
had been handed a life-line. North won the diamond return, but dummy’s queen of clubs could
take care of declarer’s losing heart, +420 and 10 IMPs to Salvo.
Board 13. Dealer North. All Vul.
♠ 10 7 3
♥ K543
♦ KJ63
♣ K8
♠ KQ5 N ♠ 96
♥ A Q 10 8 2 ♥ J976
♦— W E ♦ 10 7 2
♣ AQ 5 3 2 S ♣ J764
♠ AJ842
♥—
♦ AQ9854
♣ 10 9
25 January 2015 BRIDGE Magazine
General Interest
Open Room
West North East South
Kowalski Welland Miszewska Auken
– Pass Pass 1♦
2NT* 3♣* 4♥ 4♠
Double 5♦ Pass Pass
5♥ Pass Pass 5♠
Double All Pass
2NT ♥+♣
3♣ Good raise in diamonds
With two apparently well-placed defensive cards North might have doubled 5♥.
West led the ace of hearts and declarer ruffed and played a club. West took the ace and contin-
ued with the two of hearts. Declarer won with dummy’s king and played a spade to the jack and
king. Declarer ruffed the heart return, laid down the ace of spades and conceded one down when
the queen did not appear, -200.
(I will refrain from mentioning the hackneyed phrase ‘the five-level belongs to the opponents’.)
Closed Room
West North East South
Zorlu Vainikonis Sinclair Gulevich
– Pass Pass 1♠
2♥ Double 3♥ 5♦
5♥ 6♦ Pass Pass
Double All Pass
West led the ace of clubs and then tried to cash the ace of hearts. Even though that was ruffed
declarer could not avoid the loss of two spade tricks, two down, -500 and 7 IMPs to Salvo.
Board 14. Dealer East. None Vul.
♠2
♥ A K 10 6
♦ A 10 6
♣ K J 10 9 7
♠ 10 7 6 N ♠ AQ 9 5 4
♥ Q7542 ♥ 98
♦ 753 W E ♦ QJ84
♣ Q5 S ♣ 64
♠ KJ83
♥ J3
♦ K92
♣ A832
Open Room
West North East South
Kowalski Welland Miszewska Auken
– – 2♠* Pass
Pass Double All Pass
2♠ Spades and a minor
East led the two of diamonds (low from a doubleton) and declarer went up with dummy’s ace
and played the king of clubs. East took the ace as West pitched the four of hearts and continued
diamonds, West winning with the king and clearing the suit. Declarer was up to eight tricks, but
there was no way to secure a ninth, -100.
If declarer plays a low diamond from dummy at trick one and West is tempted to make the
expert play of ducking, leaving East with a diamond to play when she gets in with the ace of clubs
then there is a risk. If East ducks the first round of clubs declarer will realise that it is necessary
to play on hearts to drive out West’s potential entry to the diamonds.
However, if West takes the king of diamonds at trick one a spade switch leaves declarer with
no chance.
(This was the defence found by the Pollacks in their match against Voldoire.)
To complete the picture if declarer had guessed to play a heart at trick two he would have made
the contract.
Closed Room
West North East South
Mahmood Vainikonis Michielsen Gulevich
Pass Pass Pass 1♣
1♦ 1♠* Pass 3NT
All Pass
West led the five of spades and declarer won with the king and played a heart. West went in
with the ace and played a second spade, but now declarer could force out the ace of clubs to ensure
nine tricks, +600 and 12 IMPs to Vitas, too little too late and Salvo advanced to the semifinal.
You can replay the deals from this match at:
http://tinyurl.com/l94q5bq and http://tinyurl.com/kw43hbf
Day 5
In the all Chinese semi-final Geely Automobile win both halves of their match against SAIC for
a comfortable 89-51 IMP victory.
http://tinyurl.com/kan2uls and http://tinyurl.com/mfwxsmf
Meanwhile Slavo trails 24-45 at halftime.
You can replay all the deals from the first half at:
http://tinyurl.com/kt65slp
In the second half, with Rossard leading 49-45 a quotation by Bill Pencharz springs to mind
‘It is essential at all times to be lucky’.
Zia’s fingerfehler (he meant to take the 2♣ card out of the bidding box) results in a violation of
Burn’s Law. Although declarer managed ten tricks, +130 does not look promising.
Zia thought the partnership was playing the XYZ convention whereby when the first 3 bids of
a partnership’s auction are at the 1-level (1X-1Y-1Z) the typical treatment is to use:
2♣ by responder as an artificial relay. Opener must bid 2♦.
2♦ by responder as an artificial bid, saying that the partnership is going to at least game.
Other bids by responder are natural and not Forcing; 2-level suit bids are typically weak, 2NT
and 3-level bids are invitational.
West North East South
Welland Gawel Auken Brewiak
– – – 1♦
Pass 1♥ Pass 1♠
Pass 2♦* Pass 2NT*
Pass 3♠ Pass 4♥*
Pass 5♣* Pass 5♦*
Pass 5♥* Pass 6♠
All Pass
2♦ XYZ, game-forcing
4♥ Cue-bid
5♣ Cue-bid
5♦ Cue-bid
5♥ Cue-bid
West led the jack of hearts and declarer took dummy’s ace, ruffed a heart, and played three rounds
of clubs, pitching a diamond, followed by a red-suit crossruff. West pitched a heart on the third
round of diamonds, overruffed the next heart and exited with a trump leaving declarer a trick
short, -100 and 6 IMPs to Salvo.
Give West a trump less and a diamond more and declarer’s line would have been a winning one.
That deal was immediately followed by one where Voldoire-Avon reached 5♠ with ♠AKQJ10832
North led the queen of diamonds and continued with the ten for the king and ace. South exited
with a trump and declarer won with dummy’s queen, cashed the ace and followed it with the ace
of clubs, a heart to the ten and the jack of clubs. When declarer ran it South won and exited with
a trump, leaving declarer with a spade to lose at the end, -50.
Closed Room
West North East South
Welland Gawel Auken Brewiak
– – – Pass
Pass Pass 2NT* Pass
3NT All Pass
2NT 22-24
South led the eight of spades for the king and ace and declarer cashed the king of clubs, went to
dummy with a heart and ran the jack of clubs for +400 and 10 decisive IMPs.
Salvo had won the second set 54-14, producing a final score of 81-62.
You can replay all the deals from this set at: http://tinyurl.com/lmydqjx
Symphonic Variations
A symphony is an extended musical composition in classical music, generally scored for orches-
tra, though more recent examples have been written for chamber ensembles, organ, choir, piano,
or combinations of these resources. Many symphonies are tonal works in four movements with
the first in sonata form, which is often described by music theorists as the structure of a classical
symphony, although many symphonies by the acknowledged classical masters of the form, Haydn,
Mozart and Beethoven do not conform to this model.
The final of the Red Bull World Mixed teams Championships, would like most symphonies,
consist of four movements.
Awakening of cheerful feelings on arrival in the Final
Board 3. Dealer South. E/W Vul.
♠ J7
♥ 10 8 6 4 2
♦ A4
♣ 10 9 8 6
♠ AQ 6 5 N ♠ 943
♥5 ♥ AQ J 7
♦ K 10 7 6 W E ♦ Q9853
♣ K754 S ♣Q
♠ K 10 8 2
♥ K93
♦ J2
♣ AJ32
Open Room
West North East South
Yang Zorlu Wang Sinclair
– – – 1♣
Pass 1♥ Pass 1♠
Pass 3♣ All Pass
North’s jump to 3♣ was preemptive and was intended to keep E/W out of the bidding. Given
that E/W can make eleven tricks in diamonds, it was not without merit, although it is hard to
see how they might get into the auction.
West led the five of hearts and East took the ace and switched to the queen of clubs, declarer
winning with the ace and playing a club to dummy’s eight, East discarding the five of diamonds.
The jack of spades went to West’s queen and two rounds of clubs exhausted everyone’s supply.
When declarer played a heart East followed with the seven and declarer put up the king only to
see West pitch the seven of diamonds. East took the heart continuation and switched to diamonds,
so that was four down, -200.
East led the king of clubs for the three, five and six and continued with the queen. Here the loss
of tempo was more crucial, as declarer could establish a heart for a diamond discard, +620 and
13 IMPs to Geely Automobile.
To defeat 4♠ East must switch to a diamond at trick two.
Then came what might have been the hand of the Championships:
Board 8. Dealer West. None Vul.
♠ KJ54
♥ AJ6
♦ 10 9 2
♣ A52
♠ Q 10 7 3 N ♠ 9862
♥ 10 8 3 2 ♥ KQ95
♦ KQJ53 W E ♦ 74
♣— S ♣ Q43
♠A
♥ 74
♦ A86
♣ K J 10 9 8 7 6
Open Room
West North East South
Yang Zorlu Wang Sinclair
Pass 1♣* Pass 2♣*
2♦ Pass Pass 3♦*
Pass 3♠ Pass 4♣
Pass 4♠ Pass 5♣
Pass 6♣ All Pass
2♣ Inverted
North’s raise to 6♣ was on the optimistic side but when East led the seven of diamonds he had a
chance to justify it in the play.
He won with dummy’s ace, cashed the ace of spades followed by the king of clubs. When West
discarded the contract was a goner, finishing two down, -100.
I am working on a new book with Eric Kokish and one of our themes will examine some of
the skills that declarer needs to master in order to reach a higher level.
One of these is the ability to project the play down to an end position. It may appear to be dif-
ficult, but on many occasions the application of the technique we will be describing will make
you realise that it is within most players’ grasp.
I was commentating on Our Game and although one has the benefit of seeing all four hands
it did not seem to be out of the question for declarer to find a winning line.
Zia was happy to rely on his powerful spade suit and had no trouble coming to eleven tricks, +990.
Closed Room
West North East South
Sinclair Dai Zorlu Zhang
– – Pass Pass
1♥ 2♥* 2NT* Pass
4♥ 4♠ Pass Pass
5♣ 5♠ All Pass
2♥ Michaels
2NT Heart support
Declarer took the same eleven tricks, but that was 8 IMPs for Salvo.
Zia doubled for business, knowing things weren’t behaving too well for declarer, a real “tiger dou-
ble” à la Jeremy Flint.
There was no real play for the contract as long as the defense didn’t give away any gifts. +100
would have been a simply brilliant score in Pairs, here it was worth 2 IMPs aginst the – 50 they
had conceded in the other room.
Board 25. Dealer North. E/W Vul.
♠ 10 9 7 3
♥ 98
♦ AQ86
♣ Q 10 3
♠ Q82 N ♠ AJ 5
♥ 10 4 ♥ KQ763
♦ K J 10 4 W E ♦—
♣ AK 8 6 S ♣ J9742
♠ K64
♥ AJ52
♦ 97532
♣5
Open Room
West North East South
Yang Mahmood Wang Michielsen
– Pass 1♥ Pass
2NT Pass 3♣ Pass
3♦ Double 3♠ Pass
3NT Pass Pass 4♦
Double All Pass
Here Zia’s double didn’t work out so well when it persuaded Michielsen to sacrifice against 3NT,
a contract which was at least two levels too high. (There is a case for South to double 3NT – she has
the hearts under control and it seems likely the clubs are not breaking. Editor)
Declarer scrambled eight tricks for two down, -300.
This hopeless contract drifted two down, -200 so 11 IMPs to Geely Automobile, who led 48-41
at the end of the set.
Thunder, Storm
Trailing by 7 IMPs Salvo was hoping to fire a few broadsides as the third session got under way.
They certainly came out with all guns firing.
Board 2. Dealer East. N/S Vul.
♠ 54
♥ K Q 10 6 2
♦A
♣ K 10 6 4 3
♠ Q 10 8 N ♠ AK J 7 6 3
♥ AJ 8 4 ♥5
♦ K863 W E ♦ J 10 5
♣ Q5 S ♣ J82
♠ 92
♥ 973
♦ Q9742
♣ A97
Open Room
West North East South
Yang Mahmood Wang Michielsen
– – 1♠ Pass
4♠ All Pass
South led the four of diamonds and North won with the ace and returned a spade. Declarer won
in dummy, came to hand with a spade, played a heart to the ace, ruffed a heart and advanced the
jack of diamonds. When that was covered by the queen declarer claimed ten tricks, +420.
If you would have returned a club at trick two, well done indeed.
Closed Room let me know.
West North East South
Welland Dai Auken Zhang
– – 1♠ Pass
2♥* Double 2♠ Pass
2NT Pass 3♠ All Pass
2♥ 9-13 with three spades
South led the three of hearts and declarer won with dummy’s ace and played the queen of clubs.
I was expecting East to double and wondering what West would do – Pass, jump to 5♣ etc when
up flashed three passes.
North led the ten of spades and South won with the queen and returned a spade, two down, -200.
Closed Room
West North East South
Welland Dai Auken Zhang
– 2♦* Pass 4♥
Pass 4♠ Double Pass
6♣ All Pass
2♦ Multi
4♥ Pass or correct
North led the king of spades and declarer ruffed in dummy, played a heart to the king, a heart back
to the ace, ruffed a heart, a club to the nine, ruffed a heart with the king of clubs, drew trumps
and played a diamond to the jack, +1370 and 17 restorative IMPs to Salvo.
West led the five of hearts and declarer won with the jack and played the jack of spades for the
king and ace. A spade to the nine was followed by a claim, +150.
Closed Room
West North East South
Welland Dai Auken Zhang
– – Pass Pass
2♥* 2♠ Pass Pass
Double Pass 3♦ All Pass
In first position Two Hearts (especially NV v Vul) would be 3-9, but here it was a wide range.
South led the ten of diamonds and when North withheld the ace declarer won in hand with
the king and played the king of clubs. South took the ace and returned the two of clubs, declarer
winning with dummy’s ten, cashing the top hearts throwing a spade, ruffing a heart and play-
ing a diamond to the queen and ace. North cashed the ace of spades and exited with a spade and
declarer ruffed in dummy and pitched a spade on a heart. South’s ruff was the last trick for the
defence, +110 and 6 IMPs to Salvo.
After Gui produced a support redouble and somewhat undisciplined spade raise Michielsen might
have worked out that dummy rated to put down a singleton club?
But there again ♦Q4 looked to be a terrible holding for the defence. One might sympathize
with a top heart lead (declarer wins the king to duck a diamond and has an answer for everything
the defence might do). Michielsen did better: she led a top club and shifted to a spade. When Zia
made the normal control-retaining play of ducking, Liping won in hand and ruffed two clubs
in dummy for +140. Had Zia played ace and another trump the defence would have prevailed.
Since N/S had competed to 4♣ (undoubled and down only one) in the other room, Geely had a
gain of 3 IMPs instead of a loss of the same number.
Gui’s jump to 2♠ suggest E/W were playing non-standard methods in response to takeout doubles.
North naturally led a heart rather than the club that would have held West to nine tricks. After
drawing two rounds of trumps to find the bad news, West ran the hearts, pitching clubs, then led
♦A and another diamond and could not be prevented from making ten tricks
Closed Room
West North East South
Welland Dai Auken Zhang
– 2♣ Double 3♣
4♠ All Pass
When play followed the same course as at the other table Salvo had 6 IMPs and the lead at 77-75.
Geely reclaimed the lead on the next deal when a conservative action by Welland backfired.
Responding to a (potentially light) 1♠ opening at favourable vulnerability, he elected to relay and
find a six-card spade suit opposite, then invite game in spades with: ♠Q ♥AK972 ♦K963 ♣732.
The good news when his partner also took a conservative view and passed was that 4♠ wasn’t
cold, the bad news was that as the cards lay both 4♥ and 4♠ were very straightforward. Geely
found their 5-3 heart fit and played 4♥ to gain 6 IMPs and regain the lead at 81-77.
♠ A K 10 3 N ♠ 84
♥ K 10 2 ♥ QJ5
♦ KJ W E ♦ A9 5 2
♣ AK Q 6 S ♣ J 10 7 2
Gui and Liping bid these cards 2♣*-2♦*-2NT-3NT, while Welland/Auken reached the club slam
after 2NT*-3♣*-3♦*-4♠* (3♣ puppeted 3♦ then 4♠ showed both minors, and a slam
invite). In 6♣ on a trump lead Auken won in dummy and played a heart. North took the ace
to return the suit and now Auken ruffed two spades in hand for her 12 tricks, putting Salvo in
front 89-81.
Both N/S pairs stayed out of a delicate vulnerable 4♥ where the key would have been to to pick
Welland found the more accurate defence of three rounds of spades. Declarer pitched a club from
dummy, and Auken ruffed in to play back a heart. Zhang won, drew the last trump, then advanced
the ♣Q, covered all round. Now she could run the trumps, pitching a diamond from hand.
Auken was squeezed on the last trump, and though she might have given declarer a nasty guess
had she bared her ♦K, she chose to pitch a club, and now declarer finessed in clubs and ran the
suit for ten tricks and 6 IMPs.
Note that to execute the squeeze successfully declarer had to pitch a diamond not a club from
dummy at trick three, playing West for ♣Kx. Welland could have broken up the squeeze by duck-
ing the ♣Q (and from a purely psychological case wouldn’t South have advanced the ♣10 from,
e.g., ♣QJ10x if she had wanted him to duck from ♣Kx?).
Last board…all to play for, with Salvo leading 102-90.
Board 56. Dealer West. N/S Vul.
♠ AK
♥ K975
♦ 94
♣ K 10 8 3 2
♠ 95 N ♠ Q 10 8 4 3
♥ A J 10 8 6 ♥ Q42
♦ Q762 W E ♦ 10 8 5
♣ 75 S ♣ QJ
♠ J762
♥3
♦ AKJ3
♣ A964
Open Room
West North East South
Gui Zia Liping Michielsen
Pass 1♣ Pass 1♠
Pass 1NT Pass 3NT
All Pass
Zia made 630 after the ♦10 lead by guessing clubs then sneaking a low diamond through to the
nine.
Closed Room
West North East South
Welland Dai Auken Zhang
2♥ Pass Pass Double
Pass 3NT All Pass
O
n September 11, 2014 , ACBL Headquarters had a flood. This wasn’t a leaky basement
sort of thing, but an honest-to-God, maybe-we-should-be-building-an-ark kind of
flood. Mississippi Governor Phil Bryant even officially declared our city a disaster area.
As far as real floods go, the mid-September rains could certainly have been much, much worse. As
it is, the ACBL was hit hard enough that office operations were shut down for nearly two weeks,
which is an agonizingly long time for a membership organization whose sole product is customer
service (and masterpoints).
We’d had several days of rain
leading up to that Thursday
morning. The intense pre-
dawn thunderstorms made
getting to work even more
challenging than usual. The
original flash-flood alerts
scheduled the deluge to stop at
around 10.00, but the weather
map showed more red cells on
the horizon. We ended up getting between eight and 10 inches of rain before noon.
By 10.00 the ground had swallowed as much water as it could hold. By 10.30, “Ruth’s bench”
out by the pond in front of the headquarters building was either under water or it had floated
away, no one was quite sure which. By 11.00, water from the pond and the raging creek out back
merged and started filling the natural moat around ACBL Headquarters. At 11.45, the situation
was clearly becoming unsafe, and ACBL management evacuated the building.
At 12.30 the last hold-
outs waded through
knee-deep, mucky,
cold water (“watch
out for the snakes!”)
to reach their cars.
At 14:30, an intrepid
staffer somehow
made it through the
police barricades and
back to the building,
“just to make sure that everything was OK.” Nothing was OK. The front doors were open, and
bubble-wrapped items from the warehouse were floating away. Water had reached six inches in
some areas of the building. In other areas, where the water was beginning to recede, he saw lay-
ers of mud and debris.
W hen David Kendrick and I were invited to make up a team with Michael Byrne and Mike
Bell for the Chairman’s Cup in Örebro, we jumped at the chance. Sweden was a country I
had not spent any time in, apart from flying there and crossing the magnificent Øresund
bridge from Malmö to Copenhagen once. It has a reputation for good food and good hospitality and
that proved to be the case. 166 teams from 13 countries entered the event, which had over 300,000
SEKs in prize money. and the defending champions, Fem på nya äventyr, had the most interesting
name. Swedish speakers familiar with Enid Blyton, will recognise the book Five Go Adventuring
Again. There are plenty of other Famous Five books to use if they keep the same team! They proba-
bly had 500 Swedish caps and a dozen Bermuda Bowl appearances in total. Johnny Östberg, Anders
Morath, Sven Åke Berregård, Christer Bjäring and Tommy Gullberg were justly the favourites for
the event. We started steadily in the 13-round Swiss Teams Qualifier, then this hand occurred:
Our opponents had an undistinguished auction after a strong-club start, and South had little
option but to bid 6NT at the end. Even though Kendrick ducked two hearts, declarer had to play
a third round and that was 12 tricks and a 13 IMP loss. Despite that result and our first loss, by
17-13, we steadily moved up the field. Kendrick jacked up a 1♠ overcall to four on ♠J9653 ♥J2
♦J83 ♣763 and that caused opponents to misjudge to bid 5♥, which drifted one off, leading to
a good win in the next round.
A strong NT auction led to the playable vulnerable game and North cashed two spades and played
a third, South showing an even number. Lamford ruffed low in dummy, cashed the ace of hearts
which went four, three, nine, and played a heart to the king, jokingly telling North to hold his
cards up when the queen appeared. This is an interesting problem, and the game-theory strategy
for the defenders is quite complex. North should play the nine half the time from 9x on the first
round, and South should play the ten from 107x two thirds of the time in total on either of the
first two rounds of hearts. That would make the finesse right, but in the real world one pays off
to these false cards, even against experts. With Futile Willie as North and South, the drop is sur-
prisingly around 2-1 on because 109 doubleton is half as likely as Q9 doubleton (adjusting for
restricted choice). Anyway that was 11 IMPS and a further move up the field. Day one finished
disappointingly when Dan Bylund and Helena Stromberg did well to bid 6♦ against us on the
following hands:
North ♠6 ♥A3 ♦A7642 ♣J10853; South ♠ AKQ932 ♥102 ♦KJ5 ♣A4. Spades were 4-2 but
Qxx of trumps were onside and Helena played it well. That was 12 IMPs away,.
Our next match was a draw; it would have been worse except team-mates caught the opponents
in 4♥x and took the maximum 500 with good defence. That made up for a poor 3NT reached
by us on one board in the other room which had no play.
We played friends of ours in the next round, JONATHAN (Harris, Capal, Root, Sobell) and
they were quite generous to their compatriots. Despite bidding a good slam, they bid two less-
good slams and went for 1100 on one board. That big win moved us back into the top ten again.
And the following round was solid with the only gain when declarer went off in a game that could
have made, so 9 IMPs to teammates on the Butler and another win . We moved further up with
a win against Zang. Expecting at least one Chinese player, we met four more Swedes all with a
diaeresis in their names. Then our opponents decided to bid another thin slam at our table:
South opened a 14-16 NT and 3♣ was a natural slam-try. I would have signed off over this, but
South bid 3♦ and soon they were in the poor Six Clubs. East’s speculative lead of the queen of
diamonds did not cause any problems, and declarer soon recorded +1370. Declarer may still make
on the lead of the eight of hearts, by rising, playing three spades pitching a heart, and then play-
ing a club. He can then ruff the fourth spade high and fell the jack of clubs, but there are plenty
of dead ends in this labyrinth. Declarer might have found one if East had led the three of hearts
which would be a good shot.
Our next opponents included John Solodar, a former Bermuda Bowl winner, and there was
only one swing of more than 1 IMP in the match when we reached slam quickly on the follow-
ing hand, where Lamford tried an aggressive preempt second in hand:
7KH6ZHGLVK%ULGJH)HVWLYDOLVVLPSO\IDQWDVWLF,
UHDOO\KRSHWRFRPHEDFNWRWKLVHYHQWLQWKHIXWXUH
ZKHUHWKHJDPHLVEHLQJSOD\HGDWWKHKLJKHVWOHYHO
DQGZLWKDQRUJDQLVDWLRQWKDWLV:RUOG&ODVV
0LFKDHO%\UQH(QJODQG
&KDLUPDQ·V&XS
3OD\&KDLUPDQ·V&XS\RXWRR
56 January 2015 BRIDGE Magazine
Intermediate
So, we qualified fourth in the Swiss, which was pretty comfortable, as 32 teams made it through
to the knock-out stage starting with two 32-board matches on the Monday. In the Chairman’s
Cup, the first 16 qualifiers choose their opponents from the teams that come 17-32 and we were
therefore fourth to pick, so the final ranking made a difference, as that system then continues
until the end
The two Michaels had some Swedish spies who had played junior bridge with them and gave
us some information on the strength of teams, so we left the picking of opponents to our skip-
per throughout. We picked Västergötland, an area of Sweden about which I learned more when I
visited the very interesting Örebro castle at the end of the event. It has two of Sweden’s national
parks, and Sweden’s largest lake, and I am told is incredibly beautiful. The match was quite close,
and the following board was interesting:
A simple strong-and-four auction led to the normal game here. In the open room, on a much
different auction, Mike Bell led the seven of diamonds and declarer had no problem. Lamford
faced the more testing lead of the eight of clubs (third and fifth) and he rose with the ace, cashed
the ace of spades, and played three top diamonds. North ruffed perforce with the eight of spades,
but Lamford over-ruffed, and exited with a club. Both opponents were Morton-forked simulta-
neously. If South won and played a diamond, dummy would ruff and play a trump and North
would be endplayed, declarer playing for split minor honours in hearts. Similarly if North won
the club, he would have to open up the hearts immediately. Some strong players, commenting on
BBO later, thought that playing three rounds of diamonds immediately was slightly better, but
a simulation showed that this fails to some layouts with Kx of trumps with a low doubleton dia-
mond, and even a singleton trump with a low doubleton diamond. Close, and certainly the line
chosen at the table was solid enough and had the virtue of bringing home the bacon. It would be
nice to have had more play or auctions from the other room, and perhaps out team-mates will
write those up sometime.
West signed off quickly opposite the splinter of 4♣ and North picked a safe ten of diamonds lead.
West, Lamford, won with the king, and wrongly played on trumps immediately. He did, how-
ever, trust North’s king and reverted to hearts playing the ace, king and queen. North, falsely but
foolishly, showed an odd number of hearts, so South naturally ruffed the third heart after which
declarer was home, over-ruffing, crossing to a diamond and ruffing the hearts good. The winning
defence for South was to discard a diamond on the third heart, and later he can get a diamond
ruff by under-leading his ace and king of clubs. West had an antidote to this strategy of a Scis-
sors Coup of leading a club at trick two, but that was not obvious to him. Even less obvious was
North’s antidote to the Scissors Coup of leading the stiff king of spades on the go, and declarer
cannot prevail. If he wins and ducks a club, South can clear the trumps.
We won that match 51-30, and were again fourth to choose in the round of 16, and our scouts
thought that we should pick Sundsvallsgänget. I knew that this translated as Sundsvall Chipmunks,
and also that Sundsvall did not have a team in the first division of the Swedish Allsvenskan, but
I did not know until later that the city had been burnt down four times, most recently in the
Great Northern War.
Twelve Top
Dealer South. All Vul.
♠ J53
♥ K43
♦ 10 4 3 2
♣ 10 6 3
♠9 N ♠ A8 7 6 2
♥ A J 10 5 ♥ Q96
♦ KQ986 W E ♦ AJ 5
♣ AK J S ♣ 97
♠ K Q 10 4
♥ 872
♦7
♣ Q8542
West North East South
Lamford Ek Kendrick Nordén
– – – Pass
1♦ Pass 1♠ Pass
2♥ Pass 3♣ Pass
3NT Pass 4♦ Pass
6♦ All Pass
As East-West was a relatively new partnership, Lamford adopted a pragmatic approach to the
auction: he reversed and then bid what he thought he could make. Even with the heart finesse
wrong, 12 tricks were easy and E/W were a bit surprised to gain on the board at this stage of the
competition.
Careless Talk
Dealer West. All Vul.
♠ A432
♥ A7
♦ A9754
♣ A7
♠ Q87 N ♠ 96
♥ 54 ♥ 10 6 3 2
♦ KJ32 W E ♦8
♣ KQ32 S ♣ 10 9 8 6 5 4
♠ K J 10 5
♥ KQJ98
♦ Q 10 6
♣J
West North East South
Lamford Ek Kendrick Nordén
Pass 1♣ Pass 1♥
Pass 1NT Pass 2♦*
Pass 2♠ Pass 3♠
Pass 4NT Pass 5♣
Double 6♠ All Pass
In the other room, West opened the bidding with a Precision Diamond, so when our teammates
reached Six Spades, Mike Bell, North, had no problem in playing West for the queen of spades.
Lamford, West, chose to Pass, and North, with 18 Binkies, opened a strong club and showed
17-19 balanced, and North-South were soon in slam when South showed a keycard. Kendrick
led the ten of clubs, and Ek finessed trumps against him, fatally, because he could pick up ♠Qxxx
with East and make if diamonds were favourable. A slightly random 17 IMPs to England, who
then ran away with the match. So, through to the quarters, where we were left with the shark
from the group 7-32 because teams 1-3 chose before us, and we played the team that remained.
Unsurprisingly they were the defending champions, Fem på nya äventyr, and the match length
went up to 64 boards for the last three rounds.
Some discussion took place among our team as to whether it was better to finish 4th or 5th in
the Swiss, without us reaching any firm conclusions. We spent some time discussing the conten-
tious issue of dumping, which was of academic interest only as we were now in a straight knock-out
against the team that nobody wanted to play, which would present our toughest challenge.
The first quarter was incredibly swingy and the Swedish juniors were impressed that we had
managed to exchange 112 IMPs in only 16 boards, while we were quite pleased to enter the sec-
ond segment only 10 adrift. Kendrick earned 11 IMPs from a solo effort on board 2, or we would
have been further behind:
South intended his 3♦ to be forcing, but Lamford decided that there seemed to be around 50
points in the pack, and the vulnerable opponents were less likely to be acting than Kendrick.
3NT in the other room was easy, and that was 11 in. That was about our only good board of the
set, however, and Lamford gave back those IMPs by being conservative on ♠832 ♥A6 ♦A102
♣108532, just inviting opposite a strong NT. Partner had ♠J96 ♥KQ4 ♦854 ♣AKQ4 and the
good game was missed, although only bid twice in the eight hands of the four matches in play. A
1000-deal simulation with Bridge Dealer opposite a 15-count had game making 29% of the time,
and inviting seems the correct strategy, assuming partner will pass with 15 and bid game with 16.
Opposite a 16-count, the above hand makes 3NT 47% of the time, which is easily enough to
bid game, and, for completeness, opposite a 17-count, the percentage goes up to 67%. Mike Bell
has a theory that one should pass or bid game on this type of hand, but I remain unconvinced.
Teammates definitely kept us in the game in this set, as we let through 4♠ which could be beaten,
and we played in the wrong vulnerable game.
The next set was also swingy, and Lamford went for 1100 when he overcalled 4♥ on ♠Q52
♥KQ109876 ♦Q2 ♣3 at favourable vulnerability over an auction of 1♣-Pass-2♠ which was nat-
ural and game-forcing. In theory, the opponents could make 6♣ but nobody was getting there.
He was consoled that the auction and result by Solodar-Nilsson was identical, but that was in the
other match, so it was 7 IMPs out. When the smoke had cleared the lead was down to 4 IMPs.
103-107 after only 32 boards!
England galloped into the excellent grand here, entirely naturally. 4NT was RKCB and East showed
2 plus the queen of trumps. 5NT said please cue kings, and 6♦ was a general grand-slam try. East
thought the king of spades was important and bid the grand. South led the ♠Q and Lamford
won in hand, drew two rounds of trumps and led a spade to the ace, but North ruffed. This was
an excellent grand, especially on a non-diamond lead. Finding out that the Swedes missed small
slam here was quite a shock, but it is one of the downsides of bidding grands. The odds are poor
if they are not in slam in the other room.
We got those 13 IMPs back on the last board of the set, bidding another grand, 7♥, that was
even better. ♠– ♥AQJ8652 ♦KQ87♣A10 opposite ♠A875432 ♥K ♦A4 ♣KQ8. If that one had
also failed it would indeed have been carelessness, but all was well and we still trailed by 4 at the
end of the third segment after an exciting draw in set 3.
The final set was surprisingly comfortable, and far less swingy. Byrne and Bell bid an excellent
and cold slam which was missed in the other room with a combined 26-count with ♠KQ103 ♥A8
♦K ♣Q108653 opposite ♠AJ986 ♥K1076♦A1054 ♣–. We only took the lead in the match on
board 62 but by the end of a gripping encounter, England had won by 15, 175-160, and would
play Westerlund in the semi-final.
That match again started in a lively fashion, and England pulled ahead with a good slam on
minimum values, again bid naturally:
Sometimes having few gadgets is no bad thing, and the above auction was entirely natural, to the
excellent 6♣ by East. If the diamond is right it is virtually cold, and might otherwise depend on
the ruffing spade finesse or a spade guess. When South led a diamond, Lamford claimed as soon
as he discovered trumps were 2-1.
So, on to the semi-final, and the other team Zmrzlina, who were the only team in the event
with five consecutive consonants, chose Solodar in the semi-final. As an aside, I suppose you all
know the only London Underground station with six consecutive consonants (Knightsbridge Ed.).
We were therefore due to play Westerlund in the semi-final. That we were not picked first flattered
us, as John Solodar won the Bermuda Bowl in 1981 and is still a strong player at the age of 74.
The first set was very wild, and a slam swing went to England when Karlsson and Svensson
had ♠AK2 ♥AK852 ♦7 ♣AJ82 opposite ♠ J8 ♥QJ1093 ♦A1083 ♣53 and did not bid the slam
reached at the three other tables including the other semi-final. Given that it only needs trumps
2-1, and was still cold as the cards lay when they were 3-0, that was a “fumble” as they say in
American Football. Mike Bell received a more testing lead against a Four Spades contract, and
his reasonable line was unsuccessful. Byrne made a thin 3NT on another board, which Kendrick
and Lamford tried to let through in the other room, and an over-aggressive non-vulnerable over-
all of 2♦ by Westerlund on ♠Q7 ♥K95 ♦K10863 ♣J92 led to an 800 penalty. So, at the end of
the segment, England led by 32, 65-33.
The second set was equally swingy. Westerlund and Sundell bid a vulnerable slam on minimum
values with ♠10 ♥AJ5 ♦AQ754 ♣KQJ9 opposite ♠ A752 ♥KQ8 ♦2 ♣76432. With diamonds
4-3 and clubs 2-2 that could not be touched, and the solid 800 teammates extracted from 3♠x in
the other room was not enough compensation. Teammates found an excellent sacrifice in 5♣ at
Love All on one board, and that paid rich dividends when Karlsson and Svensson misjudged to
go on to 5♥ for a 10 IMP pick up. Lamford and Kendrick reached a very good Five Diamonds
on a combined 21-count with ♠AK1095 ♥965 ♦A10764 ♣– opposite ♠J2 ♥82 ♦KQ82 ♣A8754
and that was another 10 IMPs. One final board of the set clawed back the early losses and was
definitely the one that got away.
Kendrick does not like too much auction, so picked 3NT on the first round, and South led a
deceptive ♠9, in theory showing shortage. Lamford, East, ducked, won the small diamond switch
with the king, noting the fall of the 10, and advanced the jack of clubs. South ducked smoothly,
but Lamford ran it, as he was 100% even if it lost, as North would be endplayed in four suits. If
South had covered, declarer would give up a club to him and rise with the ace of spades on the
next round of the suit and knock out the remaining club guard while the spades were blocked.
The only way he could be beaten was if South had 98x of spades, so South was hoist on his own
petard by the false-card lead of the nine! Note the good play of not covering by South which might
beat the contract if declarer, not knowing who has the long clubs, rises with the king on the first
round and finesses on the way back, which he might do if his heart pips were weaker.
On another board, Kendrick overcalled 3♣ with 4♣ on ♠1075433 ♥J98543 ♦AQ ♣–. His
partner expected a better hand and drove to slam, which had some play but went off when the
diamond finesse was wrong. They made up for this bad result by collecting 800 from 3♦x when
North, Sundell, balanced, not unreasonably, at Game All on ♠Q ♥Q10742 ♦A8752 ♣J9 after
the auction Pass-(1♣)-Pass-(1♠)-Pass-(2♠)-Pass-(Pass).-Double. To rub salt into the wound, they
guessed to play in the worse 5-3 fit and that was 800 from nowhere. A few small pick-ups by
Westerlund trimmed the lead to 22, but a solid last set, with no double digit swings led to Eng-
land running out comfortable winners by 156-114, only conceding a few overtricks and a total
of 4 IMPs.
So, we move to the final, where we faced the redoubtable John Solodar and his team of top
Swedes. The match started well, with Larsson and Tornqvist reaching a slam that needed the club
finesse. That failed and 11 IMPs to England was the punishment. There was a misclaim by Lam-
ford, who specified the correct remaining tricks in 3NT, but the total was 8 not 9, and only the
director (who was watching but could say nothing) noticed. That was discovered at the break,
and corrected. Potential misinformation led to Michael Byrne making the wrong lead against a
game, which he would have beaten with his normal lead, and the score was, at one time, 34-1 to
England for the set, but later, as England pulled away, the Solodar team were given those IMPs
back as they persuaded the director that Byrne had received the correct information but Nielsen
Grand Aspirations
Dealer West. N/S Vul.
♠ J52
♥ K J 10 9 8 4
♦9
♣ 965
♠ KQ63 N ♠ A9 5 4
♥— ♥ AQ 2
♦ A K Q J 10 W E ♦ 7543
♣ KJ43 S ♣ Q 10
♠ 10 7
♥ 7653
♦ 862
♣ A872
West North East South
Kendrick Sundell Lamford Westerlund
1♦ Pass 1♠ Pass
4♥ Pass 5♠ Pass
5NT Pass 6♦ Pass
6♠ All Pass
The only good thing I can say about the Kendrick-Lamford auction is that it was better than the
one in the other room which got to 7♦, for a 14 IMP pick-up to England. I do not have that auc-
tion, but in any case it would not be allowed in a family magazine. In this room, 5♠ was intended
by Lamford to be a general slam-try, or asking for a club control, but interpreted as asking for
good trumps by Kendrick. I am not sure what West thought 5NT was, but East thought it was
“pick-a-slam”, a sensible attempt to avoid a potential spade loser when spades were 4-1, but that
did not seem to tally with the correction to Six Spades from a much safer slam. All’s Well that
Ends Well, as the bard said, and I think that South’s lead of a low club was excellent, despite the
commentators criticising it on BBO. Had I held the jack of spades instead of the queen of clubs,
I might well have gone down.
Lady Luck
Dealer West. N/S Vul.
♠ Q5
♥ AJ83
♦5
♣ QJ8742
♠ 962 N ♠ K874
♥ Q762 ♥9
♦ KQ32 W E ♦ J9764
♣ 63 S ♣ K 10 5
♠ A J 10 3
♥ K 10 5 4
♦ A 10 8
♣ A9
North-South bid, after three passes, uncontested, 1NT-2♣-2♥-4♥, which seems a bit pessimis-
tic, although slam is only so-so. They were nearly in Four Spades, when North bid 3NT over
2♥, and then told East, his screen-mate, that he had made the wrong bid, just as East was about
to pass. East asked North if it was a mechanical error, and North stated it was, so East allowed
North to correct it. Of course, the director should have been called then, not by East when he
saw dummy and realised that it might have been some inexplicable error, but was not likely to
have been mechanical. The TD ruled that the auction had ended, so the change of call stood.
Lamford, East, had noticed by the end of the hand that 4♠ was cold, so did not complain. In the
other room North was in 6♥, and mis-guessed the play. Michael Byrne’s line of playing for hearts
to be 3-2 looked right at the time. I will leave readers to decide how they would have played it,
as it easy to make looking at all the hands.
Byrne and Bell, with ♠852 ♥Q7 ♦K4 ♣AQ8752 opposite ♠ AQ43 ♥AJ2 ♦AQ10 ♣K64 bid to
an excellent Six Clubs, missed in the other room, and on this occasion one of the major finesses
was right, so they gained 10 IMPs against the +490 by South in the other room. By the end of the
set, England had stretched their lead to 69-31. And we still had at least one potential ruling, on the
misinformation in segment one, if things got sticky, but we hoped that it would not come to that.
The third set began wildly and it was clear that the Solodar team was going to overbid in order
to try to get the IMPs back. And this approach led to an opportunity on the second board of the
set after a dull first one. Instead of 17 in, it could easily have been 14 out, and I think this may
have been the point where the match was effectively decided:
The double of 7♠ was duly alerted by Lamford on his side of the screen, so maybe North should
have corrected to 7NT, which, as observant readers will notice, is cold on the double squeeze. I
might have led a diamond anyway (as partner did not double 5♥) but I think doubling by West
is reasonable. And North viewed that Kendrick was quite capable of making a psychic lightner
double when leading by over 50 in a match, if he judges that 7NT is going off, but 7♠ is making.
East dutifully led a diamond and that was 17 IMPs to England. Another 13 IMPs came when
declarer did not view to drop the queen of hearts doubleton offside in a slam with ♥AJ5 oppo-
site ♥K9432. I think he might have guessed this at the state of the match. He needs a swing, and
opponents might also be there, so playing the standard line might just get a flat board. “One
might as well be hung for a sheep as for a lamb”, as they say in Wales. The opponents went a little
on tilt after that board, and pulled back 10 IMPs when Nilsson raise a strong NT to three with
♠63 ♥1098 ♦AQJ109 ♣1053. On this occasion, there was ♦Kxx in the hole, and partner has
♠AKJ72 so 12 tricks rolled in for Solodar. Par was 6♠=, but 2♠+4 normal!
Perhaps the final nail in the coffin was the following board where teammates were given a chance
to make 4♥x, and we misdefended in our room but it was still 14 IMPs in.
Imaginative Cardplay
Terence Reese & Roger Trézel, 280 pages
RRP £13.95 BM Online Price £10.46
Imaginative Cardplay is the second of these two books, and
comprises the following titles from the original series:
Master the Odds in Bridge; Snares and Swindles in Bridge;
Those Extra Chances in Bridge; The Art of Defense in Bridge.
Winning Duplicate Tactics
David Bird, 224 pages
RRP £12.95 BM Online Price £9.71
Duplicate bridge is a different game. It’s true that you
can get by if you play exactly the same way as you would
in a home social game or a team match. Duplicate pairs
is a highly competitive game, though, and few
contestants are happy just to ‘get by’. They want to win
— not just once in a while but regularly!
To be successful at duplicate pairs, you must adjust your
bidding. You must know when to compete vigorously,
taking a risk in doing so. You must also know when it is
right to bid conservatively. You have to understand which
contract to choose in various situations. In the play and
defense you meet similar dilemmas. Should you risk the
B rother Tobias handed the Abbot a mug of tea. ‘We drink it black here,’ he informed him.
‘The local milk comes from the water buffalo. It can be a bit lumpy.’
The Abbot took a cautious sip of his tea. ‘That’s a strong brew,’ he observed.
‘Changing the subject, there’s one rather sad aspect of our great success in the African champi-
onship,’ continued Brother Tobias. ‘Ridiculous as it may seem, coming second actually qualifies
us to play in the next Bermuda Bowl in Chennai. Of course, the flights would cost a fortune and
we’re practically penniless here. I suppose the team that came third will have to replace us.’
For a moment the Abbot froze, his mug of tea halfway to his lips. The Bermuda Bowl? The
Holy Grail of bridge on this planet? How truly wonderful it would be to face the famous players
that he had only read about. Was there any chance, just a tiny possibility, that he might be able
to put a slice of James Porteous’s £20,000 bequest to good use? And, wait a moment, if he was
acting as sponsor of the team, they would have to find him a place on it. Just imagine the tales
he could tell, back in Hampshire. Why, they would last a lifetime!
‘What sort of sum would be required to fund your participation?’ enquired the Abbot casually.
‘There must be plenty of cheap accommodation in India. If the cost of the flights could be met,
perhaps £4,000 or so, it might all become a possibility.’
‘And where are we going to find a princely sum like that?’ asked Brother Tobias. ‘Even if such a
fortune magically descended from the heavens, we could hardly justify blowing it on a bridge event.
There are so many pressing needs here in the Mission. The main water-pump hardly functions at all.’
The Abbot had no intention of letting such a momentous opportunity slip from his grasp. He
strode towards the Witchdoctor’s hut, where a bridge four was about to start.
‘You playin’?’ asked the Witchdoctor, who was already seated at the table with the Parrot and Mbozi.
The Abbot nodded and took the vacant seat opposite the Parrot. He would bide his time, intro-
ducing the subject at a suitable moment. This was an early deal:
Dealer North. None Vul.
♠ 10 8 6 2
♥ AK
♦ AK
♣ QJ954
♠ J3 N ♠ AQ 9 7 4
♥ 98652 ♥ QJ3
♦ 10 4 3 W E ♦ J862
♣ K83 S ♣2
♠ K5
♥ 10 7 4
♦ Q975
♣ A 10 7 6
West North East South
Witch- Parrot Mbozi The
doctor Abbot
– 1♣ 1♠ 1NT
Pass 3NT All Pass
The Witchdoctor led the king and ace of hearts against the spade game, Mbozi playing high-low
to show his doubleton. When the queen of hearts appeared on the table, the Abbot lost no time in
ruffing with dummy’s eight. Even if Mbozi did have his proclaimed doubleton heart, which was not
guaranteed, there was always a chance that he didn’t hold the ♠9 and would be unable to overruff.
Mbozi overruffed with the nine of trumps and returned a low diamond to the nine, ten and
dummy’s ace. The Abbot surveyed the scene with no great enthusiasm. After this unfortunate
turn of events, it seemed that he would need the clubs to break 3-3. He could then discard his
two diamond losers, ruff a diamond in his hand and draw trumps. He leaned forward to play
dummy’s ace of clubs.
The Parrot was already shaking his head disapprovingly. The Abbot glared at him. How on
earth could the stupid bird know what was going on when he didn’t know what his partner held?
The Abbot discarded a diamond on the king of clubs. When he continued with the club queen,
throwing the last diamond loser, his luck ran out. The Witchdoctor slapped a trump onto the
table, ruffing the trick, and the game was one down.
‘Awful play, awful PLAY!’ screeched the Parrot. ‘100 a day? 100 a day? Not ENOUGH!’
‘Parrot-bird quite right,’ said the Witchdoctor. ‘He should gettin’ 150 a day, for extra stress of
partnerin’ Abbot-bwana.’
The Abbot had no idea what they were talking about. Why on earth should the Parrot need
such vast sums of money? What was the price of birdseed in these parts? In any case, was it some-
how his fault that clubs hadn’t broken 3-3?
Mbozi turned towards the Abbot. ‘You should discardin’ from dummy on third heart,’ he
F or the first of three busy weekends I revisited the wonderful Peebles Congress.
The winners of the teams were led home by that bridge stalwart John Matheson playing
with Les Steel, Sam Punch & Stephen Peterkin. This freak hand only earned 5 IMPs for his
team but is an interesting example of judgement pulling in the IMPs.
Dealer South. None Vul.
♠ 10 6 5 2
♥ 10 6 4 2
♦6
♣ AK95
♠ QJ74 N ♠—
♥Q ♥ 985
♦ AK J 10 7 5 4 W E ♦ Q9832
♣6 S ♣ Q 10 8 4 2
♠ AK983
♥ AKJ73
♦—
♣ J73
West North East South
Steel Matheson
– – – 1♠
2♦ 2NT* 5♦ 5♥
6♦ Double All Pass
2NT 4 spades, limit bid
With no honours in his side’s suits, Steel judged well to double. At the other table they took the
push to Six Spades doubled for another 100.
Matheson’s team beat the runners-up 15-5, which accounted for their winning margin.
Suspecting that E/W might have a better spot South wisely kept his counsel.
The following weekend I played in the Tunbridge Wells weekend congress. Kay Preddy and
Norman Selway led the field. Kay gave me this pretty defence to defeat a contract which was
made by the rest of the field.
Dealer North. None Vul.
♠ 10 9 8 6 4
♥ QJ
♦K
♣ K9853
♠ AK 5 2 N ♠ Q3
♥ 10 9 5 ♥ A8 7 6 3
♦ 62 W E ♦ QJ975
♣ 10 7 6 2 S ♣Q
♠ J7
♥ K42
♦ A 10 8 4 3
♣ AJ4
West North East South
Selway Preddy
— Pass 1♥ Pass
1♠ Pass 2♦ Pass
2♥ All Pass
West led a low heart to the three, queen and king. Declarer played a club to the king, noting the
ten from West. Next came a diamond for the ten and ace. It was difficult for West to see that the
only safe exit was the queen of clubs (the jack of hearts is another possibility, but declarer can always
score eleven tricks with careful play. Editor.) and he continued with a second heart to the ten.
Declarer led the eight of clubs to dummy’s ace, a diamond through East finessing against the
queen, crossed to the king of diamonds and continued with the jack of clubs and the carefully-
preserved four of clubs, reaching dummy in order to cash the thirteenth diamond. He threw two
losing spades on this and ace of hearts and West was squeezed down to ♠KJ and ♥J. He threw
the ♠J and Thornton played a spade to the ace making 12 tricks, two more than at the other table
which made a tournament-winning difference of a victory point.
Have Some Madeira M’Dear is a song by Michael Flanders and Donald Swann from their after-
dinner farrago ‘At The Drop of a Hat’ staged in 1957. It tells the tale of a mildly lecherous elder
gentleman trying to take advantage of a young lady by plying her with Madeira wine.
I was asked if I would like to visit Madeira and assist with the Daily Bulletin at the 2014 Inter-
national Bridge Festival. In all of half a dozen nanoseconds I had replied in the affirmative. Who
would not like a week in a temperate climate with good value food and drink and some interest-
ing bridge to boot.
The festival is run so that you can enjoy a holiday whilst playing some serious bridge. There
is a pairs tournament and team competition, each lasting three days. If you wish you can join
in a ‘warm-up pairs’ the day before the festival starts. Only on the second day of the team event
are there two sessions. For the pairs event it starts at 16.30 each day allowing you plenty of time
before for relaxing by the pool, where the water is wonderfully warm, or shopping, or sightsee-
ing. With the bridge finishing at about 20.00 gives you time to have a nice dinner in one of the
many close-by restaurants. The same principle of timing is used in the team event.
So the first of November arrives and in the morning I leave a cold and misty Vaupillon for
Orly aeroport to catch a plane to Lisbon where I transferred with minimal fuss for an airplane to
Funchal where I arrived early evening and checked in at the Vidamar Resort hotel. It was a balmy
evening in low twenties Centigrade, much more in Fahrenheit.
Warm-Up Pairs
Starting at 9.30 p.m. was the ‘Warm-Up Pairs’. It is probably fair to say that a significant minor-
ity warmed up in the bar beforehand.
I found a vacant chair and found myself sat behind a Dutch pair sitting North South, Allie
Hoenstok and Hans Metselaar, who are regular attendees to the festival. They were playing a com-
plicated system, I must confess it confused me a little as most of the explanations were given in
Dutch as frequently their opponents were also Dutch, please note that no remark about ‘Double
Dutch’ appears now or later in this article. Both 1♣ and 1♦ were forcing and had relay responses
and the opening 1NT was a three-suited hand! They finished 36th with 51.85% and whilst they
were not blameless they can count themselves unlucky on a few deals.
An early board showed the importance of discarding correctly.
Board 5. Dealer North. N/S Vul.
♠ AJ5
♥ J75
♦ 10 7 2
♣ K Q 10 2
♠ K 10 6 4 N ♠ Q9873
♥ Q92 ♥ 10 6 3
♦ AQ J 6 3 W E ♦ 95
♣6 S ♣ 974
♠2
♥ AK84
♦ K84
♣ AJ853
West North East South
Allie Hans
– 1♣* Pass 1♥*
Pass 1♠* Pass 3♠*
Pass 3NT All Pass
I gleaned from the explanations that the 1♥ response showed 14+ points and the 1♠ rebid a 11-14
no-trump hand.
The lead was the ♠3 (third and fifth) to the king and ace. Declarer now cashed five rounds of
clubs and put West to the test. He discarded one diamond and three spades so now when declarer
tried to make his contract by cashing the ace and king of hearts hoping the queen would drop
now disconsolately exited with a heart hoping for some miracle. In fact it was a double miracle as
not only was West thrown in to give a trick to the diamond king but also declarer now had the
thirteenth heart to cash for +1 and 75% instead of 25% for one down. Surprisingly twelve of the
twenty pairs who played 3NT were successful.
The next board of interest was the grand slam, though only two pairs bid it, whilst three pairs
did not even manage to bid game, in fact the eventual winners Grethe Teksum and Bjorn Duf-
seth had a complete top when their opponents stopped in 2♠ and made +1!
I believe the explanations are that the 1♠ response was 12-14, the 1NT rebid a 14-16 no-trump
and surprisingly 2♣ was Stayman.
The lead of the ♥3 (third and fifth) was covered by West’s jack and taken with the ace. Declarer
As N/S were not playing a strong no-trump the contract ended up being played by South. The
majority of the room, however, played a spade contract from the North hand. This had a pro-
found effect upon the play. At this table West led the jack of hearts, declarer lost his two trump
tricks but West was loathe to open up the club suit and so declarer go away his losing club when
the diamonds broke 3-3 and scored +1 for 85%. When played by North East had an easy club
This contract breached Burn’s Law. It states that the declaring side should have more trumps than
the defending side. Not only did the defending side have more than twice as many trumps as
declarer but they split 6-3. Evidently East thought she was showing a big hand with a heart con-
trol and equally evidently West thought she was showing a weak hand with hearts. Four down
did not trouble the scorers’ tally for East/West, especially as they had a small slam in either of the
black suits.
Our next hand shows that even in the hands of experts the Multi is not foolproof in reaching
the best contract.
Board 12. Dealer West. N/S Vul.
♠ 95
♥ AQ9753
♦ Q2
♣ 753
♠ 8743 N ♠ KQ2
♥ J 10 ♥ 862
♦ K73 W E ♦ J 10 9 6 4
♣ J962 S ♣ Q4
♠ A J 10 6
♥ K4
♦ A85
♣ A K 10 8
As I understood the explanations 2NT was a game force and the Three Diamonds showed some
extras in that suit, the opposition refrained from further questions and so the precise meaning of
Three Hearts and Three spades is not completely clear. With South having first mentioned the
heart suit they were getting close to reaching Six Hearts from the South seat. Whilst not a great
contract it is, according to Hamman, a good slam, because it makes. It will make anytime on a
non-diamond lead with at least one spade honour in East’s hand but also on a diamond lead if
West holds the king. In other words it will fail when East has the diamond king and West finds
the diamond lead.
The lead of the four of spades was not designed to test declarer and he soon wrapped up twelve
tricks for an impressive 86%, thus not reaching the slam cost very little – I know if I failed to
reach the best contract and still got 86% I would be over the moon, as they say.
(If you are wondering how Six Hearts makes if the spade honours are split, then I’ll reveal
part of the answer – in one ending West is down to ♠8 ♦K7 ♣J and is squeezed when a trump is
played from dummy, declarer having ♠6 ♦A8 ♣10 and pitching a diamond. The one snag is that
declarer has to guess who has the four-card length in spades, as if it is East then the winning line
involves starting spade by playing a low one from hand!)
When people ask me how to become a better bridge player, one of the tips I give them is to
watch the judgement of top players. On this hand my pair did nothing special but got close to
70% as a large proportion of the field pushed too hard.
Board 26. Dealer East. All Vul.
♠ K J 10 6 4
♥ A5
♦ Q 10 2
♣ K 10 7
♠ A8 N ♠ Q53
♥ KQ84 ♥ 10 7
♦ J965 W E ♦ 873
♣ 832 S ♣ A9 6 5 4
♠ 972
♥ J9632
♦ AK4
♣ QJ
West North East South
Michael Helmut
– – Pass Pass
Pass 1♠ Pass 2♣*
Pass 2♠ All Pass
Two Clubs was a Drury variant and North said he had nothing more than his opening bid. South
showed good judgement in passing his eleven count. Relocate the club honours to another suit
South’s Double was asking North to bid something and discovering he had a six-card suit he bid
it. Some might say that East’s intervention was bold, but it had the effect of making N/S play in
an inferior scoring contract. The lead was a small heart taken with the ten. Declarer cashed the
ace of diamonds, played a spade towards dummy on which East hopped up with his king and
The right contract reached but the great shuffler had the last laugh when West had an obvious
lead of a heart to his partner’s ace and when he continued the suit South was in hand and natu-
rally played a small spade towards the queen and now had two spade losers. Those whose bidding
system allowed North to play the contract frequently received a minor-suit lead and so naturally
lead a small spade towards the king and so picked up the trumps for just one loser. There was one
pair who bid and made Six Spades, “for a top?” I hear you cry, “No” is the response for one pair
bid and made Five Spades redoubled, scoring 1000 as opposed to the 980 of the slam bidders.
Failing in Five Spades was still worth 33% of the matchpoints.
Our next hand again features a pre-empt but this time at the two-level.
Board 6. Dealer East. E/W Vul.
♠ 64
♥ 8765
♦ A 10 3 2
♣ Q62
♠ A9 5 3 N ♠ J 10 8 7 2
♥ 10 ♥ AJ
♦ KQ7 W E ♦ J98
♣ K 10 9 7 4 S ♣ A8 3
♠ KQ
♥ KQ9432
♦ 654
♣ J5
89 January 2015 BRIDGE Magazine
General Interest
West North East South
Miguel Diego
– – Pass 2♦
Pass 3♥ All Pass
The Two Diamonds bid was a weak two in hearts and Three Hearts was to play. With the points
almost equally divided between the East and West hands neither of them found a way into the
auction and so got nowhere towards their game contract in spades. Three Hearts drifted a peace-
ful two off for an impressive 85%.
Earlier sessions have featured grand slams and this one is no different.
Board 7. Dealer South. All Vul.
♠ K 10 9 6 4 3
♥ A87653
♦—
♣7
♠ QJ75 N ♠ A8 2
♥ Q2 ♥ 10 4
♦ KJ63 W E ♦ Q 10 9 8 4
♣ Q84 S ♣ 632
♠—
♥ KJ9
♦ A752
♣ A K J 10 9 5
West North East South
Miguel Diego
– – – 1♣
1♠ 2♥ 2♠ 3♠
Pass 4♥ Pass 4♠
Pass 6♥ Pass 7♥
All Pass
Yet again we have an ‘interesting’ interjection by West. If, like me, you are easily amused by lit-
tle things then the fact that the person with a six-card spade suit was the only person at the table
not to bid them will amuse you. I don’t know whether West’s overcall made things harder or eas-
ier for North/South but it was hard for South to visualise North’s actual hand and after the Six
Hearts bid went into the tank before emerging with a raise to the grand slam. It was now North’s
turn for deep thought after the lead of the ace of spades. He started well by ruffing this but how
should he continue? To make the contract hearts have to be 2-2 and the clubs have to come in but
now we have the question of tackling the clubs. Miguel decided on taking one round and then
ruffing one in hand, this will work whenever the clubs are 3-3 or the queen of clubs is singleton
or doubleton, just over 50% according to my calculations which is certainly a lot better than a
first-round finesse. The bridge gods were smiling on this contract and it duly came home for all
the matchpoints as no one else bid the grand.
Wednesday evening is yet another dinner; yes a bridge writer’s life is a hard one. This time there
are three coach loads of bridge players going to the ‘O Lagar’ restaurant for a ’typical Madeira’
meal experience. Normally I am not a fan of these ‘experiences’ but I can honestly say this was a
fantastic evening. We started with tasting some Madeira for the aperitif. Then we sat down and
The opening bid was limited to sixteen points so South had no reason to consider further action.
When East elected to start with king of clubs he had signed his own death warrant as North calmly
won with the ace, cashed two top trumps, felling the queen, and played up to the jack of clubs to
establish a discard for her losing diamond . The jack of spades being on-side held her spade los-
ers to two and thus made ten tricks for a pleasing 62.5% board.
As the chair next to Miguel Teixeira and Diego Brenner was still vacant, and they were still
North/South, I sat down to watch a few hands. The first highlights the occasional pitfall of open-
ing light.
Board 12. Dealer West N/S Vul.
♠ 9743
♥ AK2
♦ 54
♣ KJ32
♠ AK J 8 5 2 N ♠Q
♥ 98643 ♥5
♦ 62 W E ♦ AK Q 7
♣— S ♣ 10 9 8 7 6 5 4
♠ 10 6
♥ Q J 10 7
♦ J 10 9 8 3
♣ AQ
West North East South
Miguel Diego
1♠ Pass 2♣ Pass
2♥ Pass 3♦ Pass
3♥ Pass 4♣ Pass
4♦ Pass Pass Double
All Pass
East/West tried to make things difficult for Diego and Miguel but they chose not to take heed of
Zia’s law about the five-level and carried on to Five Hearts. West led the jack of clubs, taken by the
king. Declarer cashed the ace and king of trumps and led a small club and ducked. East had a deci-
sion to make now, to try and decode the discard on the club or decide by other means as to which
pointed suit he should try. He did not choose wisely when he placed a spade on the green baize as
declarer now took the ace and calmly ruffed a spade cashed the club ace and ruffed out the clubs.
He then crossed again to dummy by ruffing his last spade and cashed the good club to discard his
losing diamond. That was 87.5% to declarer.
The Winners of the Pairs were Michael Gro-
moeller and Helmut Haeusler with Sabina and
Igor Grzejdziak in second place followed by
Nuno Paz and Carlos Luiz taking third.
Before I commence my disquisition on the
Teams event I must mention the sponsors.
Without sponsors there would no events like
this. Good sponsors make good tournaments
and good tournaments find good sponsors. I
could not have been present without the help
of the event’s sponsors, for me it was the local
council, the Tourist Board and Sports authority
Open Teams
It’s Friday night so it’s Teams night. I love the start of a Teams event, it always appears to be a
cacophony of unresolvable confusion, but of course it always turns out all right in the end. Finally
it was resolved that there were 68 teams who would play three rounds on Friday, two sessions of
three rounds on Saturday and finally on Sunday a concluding three rounds before the prize-giv-
ing and gala dinner.
I sat at table one as this was being covered in the open by BBO so in theory it should be easier
for me to have the results from two tables.
Session 1
Session 1 had ‘Fast & Furious’ meeting ‘XXX’, no that’s their team name and not some mistake of
mine. ‘Fast & Furious’ had the Open Pairs winners Gromoeller and Haeusler paired with Gunther
and Schlicker, whilst ‘XXX’ had the Engens with teammates Grosmann and Bégas. In the closed
room where I was kibitzing, Gromoeller and Haeusler were facing the Engens. It was a low scor-
ing match with little in the way of exciting hands.
Board 4. Dealer West. All Vul.
♠ K32
♥ 10 7 4
♦ A7654
♣ J5
♠ 764 N ♠ A9 8 5
♥ 53 ♥ AQ J 2
♦ K J 10 W E ♦ 983
♣ Q 10 8 7 6 S ♣ K4
♠ Q J 10
♥ K986
♦ Q2
♣ A932
West North East South
Hauesler Engen Gromoeller Engen
Pass Pass 1NT* Double*
2♣ 2♦ All Pass
1NT was weak and the Double said “I’ve got a weak no-trump too.” Two Diamonds was a mis-
erable contract and slid three off whilst in the open room.
West North East South
Grosmann Gunther Bégas Schlicker
Pass Pass 1♣ Pass
1NT All Pass
North elected to lead a spade after South’s support for his suit to the nine jack and queen. Declarer
now had an easy route home to nine tricks. The same contract was reached in the open room but
the lead of the nine of clubs made the going much harder for declarer, whilst double dummy Three
Diamonds is makeable, in practice, failing by one trick is the norm and thus XXX lost another
five IMPs, They lost the match 11-3 which translates to 13.12 – 6.88 VPs.
Round 2
Round 2 saw HOK, Bruynsteen, Delft, Snellers and Boer, drawn against ‘The Fab Five’. Ferg-
mann, Ingolfsdottir, Shaw and Gudjonsdottir. Virtually all of the IMPs went on the second board.
Board 10. Dealer East. All Vul.
♠ K Q J 10 6 5 2
♥ K Q J 10
♦—
♣ 73
♠ 74 N ♠ 93
♥8 ♥ A7 6 4
♦ KQJ842 W E ♦ A 10 6
♣ AJ 6 4 S ♣ K 10 9 8
♠ A8
♥ 9532
♦ 9753
♣ Q52
West took a sharp intake of breath before going on to 5♦, some would say she was lucky to find
the dummy she did, but as a general rule I like to look at the deal and see what would happen if
the South and East hands had been swapped – well Five Diamonds minus one would be a good
result against Four Spades making.
North led the spade king and South tanked and showed her doubleton spade by overtaking
with the ace and continuing with a small one to North’s ten. North continued with the heart king
to the ace. Declarer tried to get a count on the hand by ruffing a heart in hand and then crossing
to dummy with a trump and ruffing another. North did not help her cause by following with the
ten and the knave. If she had discarded the jack and the queen declarer would not have an accu-
rate count of the heart suit and may well have placed the cards differently but she calmly finessed
(after significant anguish, it must be said) against East and brought home her contract.
In the open room the first six bids were the same but the seventh was a pass. If East finds the
miracle lead of the ace of hearts the contract is two off, if the lead is a club then it is one off but
if East starts with partner’s suit then the contract makes, here as on many tables East chose the
diamond and so a double game swing and fifteen IMPs changed hands.
On board 11 in the closed room East opened a strong no-trump and West with, albeit, a balanced
eight-count, including a couple of tens, made no effort, so 1NT +1 was written in the scorecard.
In the open room there was no problem in reaching the laydown game and so 7 IMPs went out.
The only other swing worthy of note was Board 14.
Board 14. Dealer East. None Vul.
♠ AQ4
♥ K86
♦ A K J 10 5 4
♣6
♠ J9 N ♠ 86532
♥ AQ 9 2 ♥ J 10 5
♦ 762 W E ♦ Q8
♣ KQ43 S ♣ A8 7
♠ K 10 7
♥ 743
♦ 93
♣ J 10 9 5 2
West North East South
– – Pass Pass
1♣ Double 1♠ Pass
1NT 2♦ All Pass
East kicked off proceedings with a small spade and North took the trick in dummy with the king
and took the failing diamond finesse and eventually took her eight top tricks to fulfil her contract.
I think declarer might have done better at trick one by playing small, it’s not impossible that West
plays the jack so if one then wins with the ace you have two entries to dummy. If that scenario
does not present itself then surely playing off the top diamonds, and if fortune is on your side the
Round 3
Round 3 brought Das Autobahn, Bilde, Eyde, Buchlev and Reim to table one to meet KOK who
stayed there. This was a very low-scoring round with Das Autobahn winning by the smallest of
margins 9-8 or 10.44 – 9.56 VPs. Board 18 was probably the most interesting.
Board 18. Dealer East. N/S Vul.
♠ Q98543
♥ J 10 7 4
♦5
♣ 97
♠ 10 N ♠ K72
♥ AQ 8 6 3 2 ♥ K95
♦ A7 W E ♦ KQJ642
♣ A8 5 4 S ♣3
♠ AJ6
♥—
♦ 10 9 8 3
♣ K Q J 10 6 2
Obviously Six Hearts is trivial if the trumps are not 4-0 and equally trivially cannot be made when
they are as unkind as that. The question is can you make Five Hearts with the cards as they are.
Neither table did in this match. Both Souths had owned up to a club suit. On the lead of the nine
of clubs the simplest way to make eleven tricks is to win and lead a spade, you can try the king
if you like in case North was sleeping, then on a black-suit return you ruff and simply play four
rounds of trumps. North can do you no harm as he has no club in his hand and the spade entry
to his partner’s hand has been nullified so you can now cash the diamonds in peace.
The opening no-trump bid was strong and the Two Hearts overcall natural. If I understood the explana-
tions then the 3NT was a Lebensohl type bid showing enough points for game but no heart stop. South
was now on lead and at my table chose the king of hearts, not a resounding success. If you trust the oppo-
sition’s bidding is there a case for not leading a heart? If so should you try diamonds or spades. I would
chose spades for as if West had a significant spade holding it probably would have been mentioned in
the bidding and frequently in these situations the responder will have a minor of some significance. I am
attempting to find the records of this deal to see if anyone found the opening spade lead and heart switch.
Team Baleal won by 23 -18 or 12.05 – 7.95 VPs.
Round 5 saw Das Autobahn facing Sigdonnemann. The first swing of significance was a defen-
sive question.
Board 10. Dealer East. All Vul.
♠ Q75
♥ 8643
♦ J 10 5
♣ Q92
♠ A9 6 4 N ♠ J8
♥ K Q 10 9 7 ♥ J5
♦ AK 7 3 W E ♦ 94
♣— S ♣ A8 7 6 5 4 3
♠ K 10 3 2
♥ A2
♦ Q862
♣ K J 10
98 January 2015 BRIDGE Magazine
General Interest
Open Room
West North East South
Reim Inversen Buchlev Skaanning
– – Pass 1♦
1♥ Pass 2♣ Pass
2♠ Pass 3♥ All Pass
North found the only lead to tax declarer, namely a small trump, won by South who continued
the suit. Declarer won in dummy and took a diamond discard on the ace of clubs. He then played
the jack of spades round to North’s queen who continued with a club. Declarer ruffed and drew
North’s trumps. South made his first error by discarding his last club. West now played a small
spade to the eight taken by South’s ten. He got off lead with a small diamond. Declarer won with
the king, cashed the ace and South now made the fatal error of not unblocking his queen of dia-
monds. Declarer now exited with his diamond and South was thrown in to lead into the spade
tenace and give declarer his contract. In the open room Eyde also found the heart lead to Bilde’s
ace who also continued trumps. This time the defence was on the ball and did not surrender an
unnecessary trick. This was six IMPs to Das Autobahn.
The following board provided a swing back to Sigdonnemann.
Board 11. Dealer South. None Vul.
♠ KQ8
♥ 10 8 6 5 4
♦ Q2
♣ K92
♠ 10 5 2 N ♠ AJ 7 6
♥ AK Q 3 ♥—
♦6 W E ♦ A K 10 9 7 3
♣ A Q 10 8 6 S ♣ 753
♠ 943
♥ J972
♦ J854
♣ J4
Open Room
West North East South
Reim Inversen Buchlev Skaanning
– – – Pass
1♣ Pass 1♦ Pass
1♥ Pass 1♠ Pass
2♣ Pass 4♣ Pass
5♣ Pass 6♣ All Pass
As the cards lie the contract is without hope, exchange the club jack and king then there is a dou-
ble dummy line. Give South the king and jack of clubs and reasonable splits then the contract is
a good one but that is only about 20%.
As East’s opening bid was limited to 16 points the Two Spades bid showed a good distributional
hand and West had no hesitation in bidding the game.
The lead was the ace of clubs which declarer ruffed. She played a small spade up to the king
which fetched the knave from North. The losing diamond finesse followed and South persevered
with another club, again ruffed by declarer.
Declarer has now lost one trick and has no top losers outside the trump suit. Even if South
has four trumps the most he can make is two them, especially with the nine sitting over them.
Declarer seemed to be mesmerized by the prospect of a 4-1 trump split, (it was getting to the end
of a long session) but recovered her equilibrium and chose one of the many winning lines lead-
ing a diamond to the jack which North ruffed with his ten. North persisted with a club which
declarer ruffed and she then just led winning diamonds through South who could do nothing
other than take his trump ace when he wanted.
Goldberg ran out winners 41 – 1 or 19.74 – 0.26 VPs.
On the third day Das Autobahn motored on to the title by winning all three of their matches
and claimed victory by more than one match. Second were the ‘Dream Team 17’ of Nuno Matos,
Carlos Luiz, Rodrigo Soares, Miguel Teixeira, Nuno Paz and Reinaldo Timòteo and they just
headed Franck Multon’s team of K Ward-Platt, Peter Bertheau and Jessica Hayman in third.
In the evening there was the gala dinner attended by nearly two hundred, and yet another cor-
nucopia of food and wine. It was followed by the prize-giving and then the band struck up and
played till late. There is even a rumour that I was spotted on the dance-floor but as yet I have not
been approached to appear in Strictly Come Dancing.
And so it was with great sadness that on the Monday I packed my bags flew back to the grey
mist of Vaupillon.
S hark Bridge took the title at the 18th World Computer Bridge Championship held in
Sanya, China, as part of the 14th World Bridge Series. This year’s competitors were three-
time world champion WBridge5 (France), Shark Bridge (Denmark), Micro Bridge (Japan),
Bridge Baron (USA) and RoboBridge (The Netherlands). Defending champion Jack (The
Netherlands) took this year off but is looking forward to competing next year, at the Chicago
summer NABC.
Year after year the best robots continue to improve. You can see their progress as well as the
18-year history at the official website, robots.allevybridge.com. The improvement in robot play
has created more and more interest in a human-robot game. In some ways, a perfect game will
have all the human competitors sitting South playing with the same robot partner against the
same robot opponents. There are a number of excellent websites and Apps. My favourite is www.
bridge-now.com/.
The top two finishers of the round robin, Micro Bridge (56 5 VPs) and Shark Bridge (53), faced
off in a 64-board final match, with WBridge5 (47.5), Bridge Baron (26) and RoboBridge (17)
sidelined, but with their developers as interested bystanders as seen below.
In the 48-board round robin Shark Bridge had a big win against WBridge5 to advance to the
final KO, in part due the following deal.
Board 11. Dealer South. None Vul.
♠8
♥6
♦ J 10 7 5 4 3 2
♣ A653
♠ A9 N ♠ K532
♥ K97432 ♥ J 10 8 5
♦8 W E ♦—
♣ KJ94 S ♣ Q 10 8 7 2
♠ Q J 10 7 6 4
♥ AQ
♦ AKQ96
♣—
West North East South
WBridge5 Shark Bridge WBridge5 Shark Bridge
– – – 1♠
2♥ Pass 2 NT* 3♦
4♥ 6♦ Pass Pass
Double Pass Pass Pass
2NT limit raise, as 2♠ would be asking for a spade stopper for NT♦ Yves Costel.
WBridge5 developer, calls 2NT bid a clear mistake, and a costly one. It comes from evaluation,
upgrading the hand based on distribution, rather than looking at the strategic need to preempt
The jump to 4♥ put pressure on South, which bid 4♠ and then doubled 5♥. ♣A lead would defeat
the contract, but North led the ♠8. Shark Bridge +650 and 17 IMPs
With three boards to play in the final KO, Micro Bridge led by 5 IMPs. John Norris, developer
of Shark Bridge could see that the last two boards would be flat so the only hope for victory was
bidding and making a slam on board 62. Tomio Uchida, developer of Micro Bridge was hoping
for Shark Bridge to stay below slam as Micro Bridge had bid to 5♥ and made 450 on a club lead
at the other table.
Board 62. Dealer East. None Vul.
♠ K 10
♥ K9862
♦ KQ3
♣ Q95
♠ QJ5 N ♠ A8 4 2
♥ J73 ♥ 10
♦ 986 W E ♦ 742
♣ J632 S ♣ K 10 8 7 4
♠ 9763
♥ AQ54
♦ A J 10 5
♣A
West North East South
Micro Bridge Shark Bridge Micro Bridge Shark Bridge
– – Pass 1♦
Pass 1♥ 1 NT* 4♣
Pass 4♦ Pass 4♥
Pass 4NT Pass 5♦
Pass 5♥ Pass 6♥
All Pass
The slam is quite good and is only defeated with a diamond lead as there are limited entries to
ruff two clubs and draw trumps. On a club lead the slam makes if declarer plays ♥A and, noting
the drop of the ♥10, ruffs one club with the ♥Q and finesses against the jack to pull trumps. A
good prospect on the auction and restricted choice. East led the ♠A. Shark Bridge +980, 11 IMPs
and the title.
It is hard to imagine a better location for a major Bridge event than the city that is described as the Paris
of the North. Having lived there as a child Knut knows the region by heart, and he is rightly proud of
the fact that the Norwegian Bridge Federation is working hard to promote the championships, aiming
to ensure that they are the best ever.
Knut describes Tromsø and the surrounding region as a spectacular destination, observing that the
location affords a once in a lifetime opportunity to experience its fiords, mountains and midnight sun.
In August last year Tromsø played host to the world's fourth-largest sporting event, the Chess Olympiad
so is more than ready to stage what they are sure will be the biggest event in the history of European
Bridge. Enquiries are already flooding in from such faraway places as Australia, China and the USA.
Knut reminds me that summer is low season in the North of Norway, with many people going South
on vacation. This has enabled them to negotiate very good rates with a local hotel group in Tromsø.
The city is easy to reach, with direct flights from London, Munich and Stockholm and you can easily
connect via Oslo or Stockholm. The Norwegian Federation has negotiated a special deal with the Star
Alliance which will ensure excellent conditions for those travelling by air. Remarkably the airport in
only 5 minutes away from the centre of Tromsø.
When I ask Knut about things to do he is not short of answers, suggesting I take the cable car to the
mountains, play golf at 02.43 (!) enjoy the world's best fish, or even take the Hurtigruten, the daily passenger
and freight shipping service along Norway's western and northern coast between Bergen and Kirkenes. It
used to operate as a bus service, and now there are 11 ships operating a hop on, hop off service.
Renting a car is cheap and while exploring the North Cape you might catch sight of moose or reindeer.
When I ask him about the day to day expense of living in Tromsø Knut tells me that there are restaurants to
suit every pocket along with a wide choice, including Chinese (of course!) Italian, Indian and French etc.
A pint of beer will cost from €6.00 but will be much cheaper in a supermarket, where you can expect to
pay from €2.50 upwards.
Having chatted to Knut my unbiased opinion is that a trip to Tromsø really is the bridge
player's opportunity of a lifetime.
BLACK BRIDGE
Vienna for Connoisseurs a unique bridge holiday
August 23 - 29, 2015
Travel Itinerary
Day 1 - August 23rd Day 3 – August 25th finger food from Vienna’s award- in a Michelin award-winning
winning catering and a bridge restaurant in the historic vaults.
I ndividual arrival and check-in
at your hotel, with free time to
settle in and explore the neigh-
T he morning is at your
leisure. Lunch will be held in
the garden of a former city mo-
tournament await.
Day 7 – August 29th
borhood, such as the nearby nastery (Gault et Millau award- Day 5 – August 27th
Museum Quarter, one of the
world‘s greatest art and cultural
winning restaurant), then you
will depart for a bridge tour-
T he morning is at your
leisure. Lunch will be served
I ndividual check-out and depar-
ture.
areas. Late in the afternoon, en- nament in the Viennese Bridge * Subject to change. Alternative acti-
in an upscale restaurant right on
joy an official welcoming drink Club with dinner afterward at a vities will be arranged in the event of
the Danube River with a view of
at the hotel and then dinner in a winery under the stars. bad weather.
the Vienna’s modern skyline, fol-
stylish Art Nouveau atmosphere.
lowed by a bridge tournament
Day 4 – August 26th afterward in the Bridge Center. No scheduled activity is
Day 2 – August 24th In the evening, we will surprise
www.blackfish-bridge.com
Register by email: The booking and payment for the rements with respect to religious, More detailed information about
tour is handled by our partners HTS- cultural or medical restrictions. We the activities and your hosts is
office@blackfish-bridge.com Reisen (please use the keyword “Vi- will be happy to assist you. available on our website.
enna for Connoisseurs”):
Deadline: April 30, 2015 For questions about the program www.blackfish-bridge.com
Ms. Katharina Brauner schedule and the activities offered,
Immediately upon receiving your HTS-Reisen contact us directly at We look forward to an unforgettable
registration, our travel partners Liechtensteinstr. 107, 1090 Wien time with you in Vienna!
HTS-Reisen will contact you to Tel. +43 1 3198553 office@blackfish-bridge.com
provide all application forms as well E-Mail: reisen@hts-reisen.at
as information on the payment terms
and cancellation policy. For more
information, please visit our web-
On the form that you’ll receive by
email from us upon registration, Bridge
site: please indicate if you are vegetari-
an/vegan, suffer from food allergies Tournaments in Viennese bridge clubs
www.blackfisch-bridge.com or have any special dietary requi- Partners guaranteed
Bidding challenge
HTS Reisen
Katharina Brauner
Liechtensteinstraße 107, 1090 Veinna, Austria
Culture
E-Mail: reisen@hts-reisen.at Special city walking tours
Telephone: +43 1 3198553 www.hts-reisen.at Exclusive sightseeing
Margit Schwarz Vintage tram ride
BLACK BRIDGE
www.blackfish-bridge.com
R oy Welland started playing bridge to be able to work on Wall Street. Today he works as
little as possible to be able to play bridge.
I catch Roy in between two matches and since he just had a big win, he has enough mental
capacity to bear with my curious questions.
Can you tell me about your business career?
“I was on Wall Street for more than 20 years as a trader. I worked for myself and risked my own
capital. I actually started out working for somebody else. It was the reason I took up bridge. I
was trying to get a job as a trader and I was told that there were these two guys, Mike Becker and
Ron Rubin, who hired all the best bridge players to trade options, so I took up bridge hoping to
become a good enough bridge player for one of them to hire me. And it worked.”
He was playing poker in the evening in a bridge club in New York when Debbie Rosenberg asked
him what he knew about bridge.
“I know that if you have 13 points you open in your longest suit,” Roy replied.
“Excellent,” Debbie said. “Would you mind filling in on a few hands?” And so Roy was hooked.
He knew a little about card play from other games such as whist, so despite starting at the age of
24, Roy quickly caught up.
However he was working full time on Wall Street and did not have much time to dedicate to
bridge. Then a friend of his suggested that they found him a good partner and hired a pair for a
team at the American nationals.
“I had not played so much bridge for 2-3 years and I hadn’t played more than a little this and
that. I felt a little awkward, you know, being concerned that I would let my teammates down
because I was a bit out of practice.” During the following years Roy and his various teammates
won all imaginable American titles.
In Opatija he plays his first European Championship with Sabine Auken on the German open
team. Roy being a famous American bridge player, his eligibility to play for Germany has been
intensely debated.
How do you feel personally about all this debate whether or not you were eligible to play for Germany?
“Oh, I didn’t mind. I kind of expected it. Maybe I expected a little bit less since there had already
been some precedents with other people playing… and, you know. Hm. I want to be careful about
how I phrase this… people who are obviously of other nationalities than the country they repre-
sent. So I didn’t expect too much of controversy… and there really wasn’t, mostly it was just one
person. I cannot change and go to play for Sweden next year, I have committed to be a resident
of Germany, to play for Germany, I don’t see why that should be a problem.”
Even though he says he does not mind much, I sense it has bothered him a little.
What is it like playing with Sabine?
“Oh, it’s the best. We have the most fun system of any bridge players in the world. Every time it is
our turn to bid we have a multitude of options. We don’t have to bid hearts just because we have
a five-card suit. Should I be declarer, should I be dummy, show my four-card suit or ask partner?
Test Your
Defence
with Julian Pottage Solutions on page 118
♠ 8763 ♠ A Q 10 4 2
1 ♥ 10 6 3 2 ♥ 76
♦ J 10 7 4 2 ♦ 9643
♣ Q ♣ K8
♠ 954 N ♠ KJ N
♥ AQ 9 ♥ Q982
♦ 853 W E ♦ K 10 8 7 5 W E
♣ A K 10 5 S ♣ 10 6 S
WEST NORTH EAST SOUTH WEST NORTH EAST SOUTH
– – – 2♣ – – – 1♥
Pass 2♦ Pass 2NT* Pass 1♠ Pass 3♥
Pass 3♣* Pass 3♠ Pass 4♥ All Pass
Pass 4♠ All Pass You lead the seven of diamonds. Partner wins with the
2NT 23-24
3♣ Five-card Stayman ace and returns the jack. You capture the queen with
You lead the ace of clubs. Partner plays the four and the king. How do you continue?
declarer the six. How do you continue?
The Hands
(This month all the deals were played at IMPs.)
Hand 1. Dealer West. None Vul.
♠ J9654 N ♠—
♥A ♥ Q54
♦ K9874 W E ♦ A6 5 3
♣ 98 S ♣ AQ 5 4 3 2
North opens 1♠ and South raises to 2♠.
West North East South
Kranyak Helness Demuy Helgemo
Pass 1♠ 2♣ 2♠
Pass Pass Double Pass
2NT* Pass 3♦ Pass
4NT Pass 6♦ All Pass
When East reopened with a double West placed him with a shape-suitable hand that almost cer-
tainly included a spade void. When his partner bid 3♦ he bid 4♠ to show a good hand with all
his values outside spades. 4NT promised a good hand and East backed his judgement by jump-
ing to the slam.
West North East South
Fantoni Lall Nunes Lee
Pass 1♠ 2♣ 2♠
Pass Pass 2NT* Pass
3♠* Pass 4♣* Pass
4♦ Pass 5♦ All Pass
When East reopened with 2NT suggesting diamonds West showed a good hand with 3♠, but
when East could only bid 5♦ he called it a day, +420, but 11 IMPs to the USA.
Recommended auction: It would be hard to improve on the American pair’s sequence.
Marks: 6♦10, 5♦ 6, 4♦ 3.
Running score: Masterminds 10.
Hand 2. Dealer South. E/W Vul.
♠ K J 10 6 3 2 N ♠ AQ 9 8
♥ 642 ♥ AK Q 5
♦ QJ9 W E ♦ K84
♣2 S ♣ 10 3
South opens 1♦.
When I spotted Fulvio Fantoni at breakfast I asked him if his 3NT bid had any special signifi-
cance. In his typically jovial and disarming way he described it as an idiotic bid (of course he had
envisaged a situation where his side might lose the first four tricks, two diamonds and two clubs)
considering 3♦ to be more accurate.
When South attacked with the second string to his bow (he held ♠5 ♥J73 ♦A10752 ♣AK94) by
leading the ace of clubs the defenders soon had the first seven tricks in the bag, three down, -300.
West North East South
Wu Dong
– – – 1♦
1♠ Pass 2♦* Pass
2♠ Pass 3NT Pass
4♠ All Pass
It seems that great minds think alike, but here West earned China 14 IMPs by bidding spades
for a third time.
Recommended auction: (1♦)-1♠-2♦-2♠-3♦-3NT-4♠.
Once West shows values in diamonds with 3NT it is clear for East to go back to spades as there
can be no danger of four fast losers.
Marks: 4♠ 10, 3♠ 4, 3NT 1.
Running score: Masterminds 20.
Hand 3. Dealer East. All Vul.
♠ Q875 N ♠ A9 4 3
♥Q ♥ K875
♦ KJ4 W E ♦ A6 5
♣ 76532 S ♣ AJ
West North East South
Multon Zimmermann
– – 1NT Pass
2♣* 2♥ 2♠ Pass
4♠ All Pass
Opposite a 15-17 INT West looked for a major-suit fit and then bid what he hoped his partner
could make.
South, who held ♠K106 ♥4 ♦Q109832 ♣KQ10 led his heart and North won with the ace
and returned the seven of diamonds to the queen and king. A spade to the ace was followed by a
spade to the ten and queen and when North’s jack appeared declarer claimed ten tricks – he could
ruff both his losing hearts in dummy, +620.
North led the king of diamonds and continued with the three, forcing declarer to ruff.
He played a heart to the queen and ace, followed by the queen of clubs. South took the king and
returned the two, so declarer won with dummy’s jack, ruffed a diamond, cashed the king of hearts
and played a club to the ace. South could ruff, but that was the last trick for the defence, +620.
West North East South
Herbst Fantoni Herbst Nunes
Pass Pass 1♣* Pass
1♦* 1♥* 2♥ 3♦
3♥ All Pass
1♦ Hearts
1♥ Take out
Missing the game cost Israel 9 IMPs.
Recommended auction: I can’t improve on the one to 4♥.
Marks: 4♥ 10, 3♥ 5.
Running score: Masterminds 73.
♠ 8763 ♠ A Q 10 4 2
1 ♥ 10 6 3 2 ♥ 76
♦ J 10 7 4 2 ♦ 9643
♣ Q ♣ K8
♠ 954 N ♠ 10 ♠ KJ N ♠ 9763
♥ AQ 9 ♥ J872 ♥ Q982 ♥ 5
♦ 853 W E ♦ 96 ♦ K 10 8 7 5 W E ♦ AJ
♣ A K 10 5 S ♣ J97432 ♣ 10 6 S ♣ J9543
♠ AKQJ2 ♠ 85
♥ K54 ♥ A K J 10 4 3
♦ AKQ ♦ Q2
♣ 86 ♣ AQ7
WEST NORTH EAST SOUTH WEST NORTH EAST SOUTH
– – – 2♣ – – – 1♥
Pass 2♦ Pass 2NT* Pass 1♠ Pass 3♥
Pass 3♣* Pass 3♠ Pass 4♥ All Pass
Pass 4♠ All Pass You lead the seven of diamonds. Partner wins with the
2NT 23-24
3♣ Five-card Stayman ace and returns the jack. You capture the queen with
You lead the ace of clubs. Partner plays the four and the king. How do you continue?
declarer the six. How do you continue? You have made two tricks and can be sure of making
a third with the queen of trumps. How can you find a
If South has a full 23 points, partner has at most two,
fourth trick?
which means no ♥K. Since any high cards partner holds
in the pointed suits will drop or be subject to a finesse, A quick count of points tells you that your partner can
you need to aim for three heart tricks. have few high cards beyond those you have already seen.
The ace of clubs is out of the question. Moreover, the
For a start East will need to hold the ♥J. This in turn spade position could hardly be worse from your side’s
means that South holds all the missing diamond hon- perspective. The jack or ten of hearts would certainly
ours. You can more or less write down the layout. be helpful. Either of those would give you a second
Declarer has ten tricks, if not eleven: five trumps, five trump trick. Is there any other useful card that partner
diamonds and a club ruff. You need to take advantage could hold?
of the blockage in the diamond suit by forcing dummy Both of the unseen hands are now out of diamonds.
to ruff. Perhaps partner can ruff the third round of diamonds to
If you thought about continuing with a high club, it is force out something from declarer. If you think about
a good idea but not good enough. Rather than ruff in it, the lowly five of hearts is all you need to find.
dummy, declarer calls for a heart. You need to continue If you continue with the ten of diamonds, the need to
with a low club, hoping partner has the jack. Throw- ruff may not be apparent. The way to be sure that your
ing a heart will be not land the contract if you do that partner ruffs is to play a low diamond. The five seems
because partner will be on lead. the natural card, though anything small should do.
Just before Christmas as I write this and it will prob- THE BIDS & MARKS
ably be New Year before you see it so Happy Holidays 1. Double 10
to one and all. We start the season with a bumper set Four Spades 8
of problems – some of which attracted no less that seven 4NT 8
different bids. This month problem 1 was sent to me Five/Six Diamonds 8
Three Diamonds 7
by ever present panelist Mike Lawrence, problem 2 Three Spades 7
comes from Manchester player and reader Alan Jones, 4NT 7
problems 3 and 4 were sent to me by Malcolm Pryor 3NT 5
Four Diamonds 5
and both come from the English Premier League, prob- 2. Pass 10
lems 5 and 6 were sent to me by Iain Sime and comes 4NT 9
from a Scottish Western first division match and the Five Clubs 9
qualifier for the Rayne trophy (a Scottish competition) Six Clubs 7
Five Spades 4
respectively, problem 7 comes from a Manchester first Five Hearts 3
division league match and was held by my teammate 5NT 3
Michael Byrne and finally problem 8 was sent to me All other bids 1
by Marc Smith and again comes from the English 3. Two Diamonds 10
Four Diamonds 9
Premier League. Before we start some congratulations. Three Diamonds 7
Firstly to Sally Brock for yet another gold medal, this Five Diamonds 5
time in the Beijing World Mind Sports and secondly 3NT 3
to Andrew Robson for his third successive victory in Pass 1
4. 4NT 10
the Gold Cup. The fact that he beat me by 6 in the Pass 9
semi-final will have no bearing on his scores at all Five Hearts 8
obviously. None at all. Really…. Double 6
OK, on with the show. Five Spades/NT 6
Five Clubs 5
Six Hearts 3
PROBLEM 1 Six Clubs 1
5. Four Hearts 10
IMPs. Dealer South. All Vul. Three Spades 9
Four Diamonds 9
♠ AK Four Clubs 9
♥— Pass 8
♦ AQ J 9 7 6 2 Five Diamonds
Four Spades
5
4
♣ AQ 4 2 6. 1NT 10
West North East South Two Hearts 8
– – – 2♠* Pass
One Spade
7
7
? Two Clubs 5
2♠ Natural and weak 2NT 2
3NT 1
Marks: Double 10, Four Spades 8, 4NT 8, Five 7. Three Hearts 10
Diamonds 8, Six Diamonds 8, Three Diamonds 7, 3NT 9
Three Spades 7, 4NT 7, 3NT 5, Four Diamonds 5 Four Clubs 7
Well as I live and breathe I never thought I would see 4NT 2
Five Clubs 1
this happen! We have an absolute pig of a hand with 8. 4NT 10
every bid significantly flawed, but for all that I never Six Clubs 9
believed that I would set a problem where the 10 marks 5NT 8
went to a takeout double with a void in the unbid Five Clubs 6
Seven Clubs 4
major. Still see for yourselves dear readers. Not only Five Hearts/Spades 2
did double get the most votes (albeit with only 7 of Pass 0
Hearts which could be part of a 5-1-5-2 hand. Marks: 4NT 10, Six Clubs 9, 5NT 8, Five Clubs 6,
Teramoto: 3NT. Three Hearts is fourth suit, it Seven Clubs 4, Five Hearts 2, Five Spades 2, Pass 0
doesn’t show hearts, so bid NTs with a stopper. OK a quick piece of theory. In BM standard we play
Rigal: 3NT. I play Three Clubs as a second nega- first round cue-bids (watch this space as this may
tive so would bid either Three Clubs or 2NT at my change soon). However even playing that style we just
second turn. Now 3NT seems sensible – maybe HAVE to bid Four Diamonds with any diamond con-
not best but how else do we get there facing ♥Jx? trol. To play that Four Diamonds promises the ace (or
Eric thinks it may have been better to give a positive: a void) in an auction like this just makes life impossi-
Greco: 3NT. I might have been better placed to start ble when partner does not have a diamond control. So
with Two Hearts to at least get both my suits in. even playing first-round cue-bids we have essentially
At this point I want to slow things down and 3NT denied a diamond control. This means that partner’s
seems the best way as Three Hearts is a bit murky. Four Spades must PROMISE a diamond control, as
And Liz comes up with a third meaning for Three otherwise she knows we are off two diamonds and
Hearts: would sign off. Of course all the panel play cue-bids
McGowan: 3NT. I think Three Hearts would be a of first or second round up the line so this isn’t an issue
cue for one of his suits (Really? Can I not just bid Three for them anyway. So we know partner has a diamond
Spades or Four Diamonds). Four Clubs is an alternative, control and is slam interested. We have magnificent
but if he has ♣AKx he should bid Four Clubs now. trumps. What does all this add up to? Somewhat to
OK, partner’s hand is…… I’m not going to tell my surprise for half the panel it adds up to Blackwood:
you. After a few months when you have all forgotten Greco: 4NT. I now have a huge hand for small slam.
this hand I will set partner’s. I have denied a diamond control and partner has
now confirmed one with the Four Spade bid. I will
bid 4NT and follow with 5NT if we have all the
CARD TABLES key cards and leave it up to partner.
FOR SALE Brock: 4NT. First thoughts were Six Clubs, but a
grand could be cold. Partner knows I don’t have
Refurbished old tables standard size diamond control, and it can’t have escaped his
with new green baize top notice that he doesn’t have a top club honour! If
he responds Five Hearts, as expected, I can bid 5NT
£29 each to say that we have all the ‘aces’ and the queen of
Will deliver within reasonable distance trumps, and he should know what to do.
DANNY ROTH Robson: 4NT. Assuming it’s keycard. Probably
47 Bearing Way, CHIGWELL,
headed to seven – partner must have a diamond
ESSEX IG7 4NB control given his lousy clubs. When he replies Five
Hearts and I bid 5NT confirming all the keycards
020 8501 1643 tel/fax dannyroth@btinternet.com he’ll know my hand and can likely bid Seven Clubs
on tricks.
Eric Greco
clubs are trumps (essentially, the bidding becomes
cramped).
Lawrence: Five Clubs. Likely enough. Doesn’t have
to end the bidding. If 4NT was progressive, I would
bid that. May owe partner a stronger bid but dia-
monds can be a worry here. Should I assume that
my Four Heart bid denied a diamond control? (Eve-
ryone else on the panel did Mike ) If so, then my
hand should bid Six Clubs.
SET 287 – THE PANEL’S BIDS & MARKS
1 2 3 4 5 6 7 8 Total
Eric Greco USA Dble Pass 2♦ 4NT 3♠ 2♥ 3NT 4NT 76
Tadashi Teramoto Japan 4♠ Pass 2♦ 4NT 4♥ 2♥ 3NT 4NT 75
Alon Apteker South Africa Dble Pass 2♦ Pass 3♠ 1♠ 3NT 4NT 74
David Bird England 6♦ 5♣ 2♦ 5♥ 4♥ 1NT 3♥ 6♣ 74
Eric Kokish Canada 4♠ Pass 2♦ Pass 4♣ 1NT 3♥ 5NT 74
Adam Zmudzinski Poland Dble Pass 2♦ Pass 4♣ 1♠ 3NT 4NT 74
Drew Cannell Canada Dble Pass 2♦ Dble 4♥ 2♥ 3♥ 6♣ 73
Ben Green England 3♠ 4NT 4♦ 4NT 4♦ 1NT 3NT 4NT 73
John Matheson Scotland Dble 4NT 2♦ 5♠ Pass 1NT 3♥ 4NT 73
Andrew Robson England 5♦ 5♣ 2♦ Pass 3♠ 2♥ 3♥ 4NT 73
Joey Silver Canada 3♦ Pass 2♦ 4NT Pass 1NT 3♥ 5NT 73
Sally Brock England Dble 4NT 3♦ Pass 4♥ Pass 3♥ 4NT 72
Iain Sime Scotland 5♦ 5♣ 4♦ 4NT 4♥ Pass 3NT 4NT 72
Bobby Wolff USA 6♦ 5♣ 4♦ 5♥ 4♦ 1NT 3♥ 6♣ 72
Mike Lawrence USA 4NT 5♣ 4♦ 4NT Pass 1NT 3♥ 5♣ 71
Paul Bowyer England Dble 5♣ 4♦ 4NT 3♠ 1♠ 3♥ 5♣ 70
Liz McGowan Scotlan 3♠ 4NT 4♦ 5♣ 4♦ 1NT 3NT 6♣ 69
Barry Rigal USA 4♠ 6♣ 3♦ 4NT 4♦ 1NT 3NT 6♣ 69
John Carruthers Canada 6♦ 4NT 3♦ 5NT 4♣ 1NT 3♥ 6♣ 68
Marc Smith England 5♦ 4NT 5♦ 5♥ 4♣ 2♥ 3♥ 6♣ 66
Tadashi Teramoto Japan Dble 3♦ 6♣ 3♦ 5♥ 4♥ 5♥ 4♠ 70
David Bird England Pass Pass Pass Pass Dble 4♥ 4♥ 4♠ 67
Marc Smith England 5♣ 3NT 6♣ 3♦ 6♥ 4♥ 6♥ 4♠ 66
BIDDING COMPETITION Why not enter a bridge hand or bidding problem of your
own for use in BRIDGE Magazine?
SET 288
♠
(for the January Competition) ♥
♦
My answers are (the Adjudicator) ♣
1. ♠ ♠
♥ ♥
2. ♦ ♦
3.
♣ ♣
♠
4. ♥
♦
5. ♣
6.
WEST NORTH EAST SOUTH
7.
8.
Total marks:
Email to marksandcomments@sympatico.ca
or post to: Bidding Competition (288),
John Carruthers, 1322 Patricia Blvd.
Kingsville ON N9Y 2R4, Canada
Name: ___________________________ (please print)
Address:
Telephone: ___________________________________
Hand 1. Dealer West. None Vul. Hand 5. Dealer North. None Vul.
♠ — ♠ K 10 9 8 4
♥ Q54 ♥ AJ5
♦ A653 ♦ 97
♣ AQ5432 ♣ AQJ
North opens 1♠ and South raises to 2♠. North opens 1♥. If East bids 1♠ South doubles.
Hand 2. Dealer South. E/W Vul. Hand 6. Dealer South. Both Vul.
♠ AQ98 ♠ 76
♥ AKQ5 ♥ K 10 9 8 7
♦ K84 ♦ K Q 10 6 5
♣ 10 3 ♣ J
Hand 3. Dealer East. All Vul. South overcalls 1♠
♠ A943 Hand 7. Dealer South. Both Vul.
♥ K875 ♠ AK64
♦ A65 ♥ 10
♣ AJ ♦ A K 10 8 7 4
Hand 4. Dealer South. E/W Vul. ♣ A9
♠ J98432 South opens 3♣ and North raises to 4♣.
♥ K93
Hand 8. Dealer West. E/W Vul.
♦ J9
♣ J5 ♠ 85
North overcalls 2♥, South raises to 4♥ and then North bids ♥ A J 10 8
6♥. If E/W bid 6♠ South bids 7♥. ♦ J 10 5
♣ AQJ7
If East opens 1♣ and West responds 1♥, North doubles and
South bids 3♦.
BIDDING COMPETITION
Set 286 Top Scores Other Good Scores: 1 Ryan Stephenson 379
2= Peter Hawkes 378
Prize winners should quote the month, 75 Derek Markham, Stuart Nelson, Mike
competition and value of their prize when 2= Andrew Lum 378
Perkins, Nick Simms, Martin Turner
placing an order for Master Point Press 2= Mike Perkins 378
74 Harald Bletz, Alan Sant 5 Nick Simms 377
books. Prize winners can refer to the list of
73 Malcolm Copley, Andy Poole, Tony Poole 6 Stuart Nelson 376
MPP titles on the inside back cover of the
current issue of Bridge Magazine. 72 Ray Stubbs 7= Tony Poole 374
Well done Peter Hawkes on 78; Peter 71 Peter Barker, Tugrul Kaban 7= Mike Ralph 374
wins ₤50 worth of Master Point Press 70 David Barnes, Phil Callow, James 9 Bill Gordon 370
books from Chess and Bridge. Tied on 77 Dunlop, Andre van der Werff 10= Malcolm Copley 368
are Andrew Lum and Ryan Stephenson 10= Graham Johnson 368
- the coin toss awarded ₤25 worth to Final Grand Prix Stand- 10= Norman Massey 368
Andrew and ₤15 worth to Ryan. ₤10 ings for 2014 13 Nigel Guthrie 367
worth goes to Bob Brown, after a random (subject to corrections reported this 14 Ray Stubbs 366
draw to separate Bob, Bill Gordon, Nigel month) 15 Kresten Kristensen 363
Guthrie and Norman Massey, all on 76. Congratulations to Ryan Stephenson, 16= David Barnes 361
winner of this year’s Grand Prix title and 16= Bill Linton 361
Note: Problem #8 was incorrectly printed ₤100 worth of Master Point Press books 18 Olga Shadyro 360
for the competitors (missing a second line from Chess and Bridge. Ryan scored 77 19= Axel Johannson 359
of bidding), and so all entrants scored 10 in Set 286 to jump into the lead at the
19= Tugul Kaban 359
on that problem. Our editor notes: We are very last minute. Tied in second place are
Peter Hawkes, Andrew Lum and Mike 19= Derek Markham 359
on the case. The cause is identified - it will
not happen again (after Set 287)! Perkins, each of whom wins ₤30 worth. 19= Alan Sant 359
19= Frank Turton 359
Deadly Endplay (fiction) Allen, Ken £12.95 Complete Book Takeout Doubles (2nd ed.) Lawrence, Mike £15.95
Shades of Grey (fiction) Allen, Ken £11.95 Falsecards (New Edition) Lawrence, Mike £14.95
I Love This Game Auken, Sabine £12.50 Encyclopedia of Card Play Techniques Levé, Guy £21.95
25 Bridge Myths Exposed Bird, David £10.50 Bridge Squeezes Complete Love, Clyde. E £14.95
Bridge Endplays for Everyone Bird, David £12.95 Bridge, Probability and Information MacKinnon, Robert F. £12.95
Bridge Squeezes for Everyone Bird, David £11.95 Win the Bermuda Bowl with Me Meckstroth & Smith £11.50
Clever Plays in the Trump Suit Bird, David £12.95 The Setting Trick McCance, Ian £11.95
Defensive Signaling at Bridge Bird, David £11.95 Competitive Bidding in the 21st Century Miles, Marshall £11.50
Off-Road Declarer Play Bird, David £11.95 Inferences at Bridge Miles, Marshall £11.50
Somehow We Landed in 6NT Bird, David £12.95 It's Your Call Miles, Marshall £12.95
Winning Notrump Leads Bird & Anthias £10.95 Modern Constructive Bidding Miles, Marshall £11.95
Winning Suit Contract Leads Bird & Anthias £10.95 My System: The Unbalanced Diamond Miles, Marshall £11.95
Leading Questions in Bridge Brock, Sally £11.95 Bridge in the Menagerie Mollo, Victor £13.95
Bridge at the Edge Brogeland, Boye & Bird, David £13.95 Card Play Technique Mollo & Gardener £14.95
Bridge Crosswords Chen, Jeff £7.95 Diamonds are the Hog’s Best Friend Mollo, Victor £13.95
Following the Law Cohen, Larry £9.95 Swings and Arrows Mollo, Victor £13.95
Larry Cohen's Bidding Challenge Cohen, Larry £9.95 The Hog Takes to Precision Mollo, Victor £11.95
To Bid or Not To Bid Cohen, Larry £11.50 Kickback: Slam Bidding at Bridge Munger, Robert £7.95
Death in Duplicate Coplea, Carole £13.95 First Book of Play Problems O’Connor, Patrick £10.95
Standard Bidding with SAYC Downey, Ned & Ellen Pomer £11.95 Second Book of Play Problems O’Connor, Patrick £10.95
Bridge with Bells and Whistles Dufresne, MA & Ellingsen, M £11.95 Bridge Behind Bars (fiction) Pottage & Smith £12.95
A Modern Approach to Two-Over-One Eichenbaum, Ken £8.95 Clues from the Bidding Pottage, Julian £10.95
Winners, Losers and Cover Cards Eichenbaum, Ken £8.95 Defend These Hands with Me Pottage, Julian £11.50
Can You Win The USBC Team Trials Felmy, Matthias £13.95 Play or Defend? Pottage, Julian £8.95
I Shot My Bridge Partner (fiction) Granovetter, Matthew £9.50 Defend or Declare? Pottage, Julian £11.95
Murder at the Bridge Table (fiction) Granovetter, Matthew £9.50 Deadly Hold-Up Priebe, Jim £11.95
Bridge Conventions in Depth Granovetter & Granovetter £13.95 Double Elimination: A Bridge Mystery Priebe, Jim £11.95
Bridge Master Vs Bridge Amateur Horton, Mark £11.95 Matchpoint Defense Priebe, Jim £11.95
Misplay These Hands with Me Horton, Mark £11.95 Takeout Double: A Bridge Mystery Priebe, Jim £11.50
The Hands of Time Horton, Mark £10.50 Thinking on Defense Priebe, Jim £9.95
The Mysterious Multi Horton, Mark £12.95 Positive Declarer Play in Bridge Reese & Pottage £10.50
Duplicate Bridge at Home Horton & Gittelman £12.95 Positive Defense in Bridge Reese & Pottage £10.50
The Bridge Magicians Horton & Kielbasinski £11.50 The Extra Edge in Play Reese & Pottage £10.95
For Love or Money Horton & Senior £12.95 Modified Italian Canapé System Rexford, Ken £8.95
The Rabbi’s Rules Horton, Mark £12.95 New Frontiers for Strong Forcing Openings Rexford, Ken £8.95
Building a Bidding System Hughes, Roy £11.50 Overcalling Opponent's 1NT Rexford, Ken £6.95
Canada’s Bridge Warriors Hughes, Roy £15.95 Really Unusual Notrump (R.U.N.T.) Rexford, Ken £7.95
Card by Card Hughes, Roy £11.50 Variable Key Card Blackwood Rexford, Ken £8.95
Fantunes Revealed Jacobs, Bill £9.95 Breaking the Bridge Rules Rigal, Barry £12.95
One Trick at a TIme Jackson, Jim £11.95 Rodwell Files: Secrets of a champion Rodwell, Eric £17.95
Polish Club International Jassem,Krzysztof £10.95 How Good is Your Bridge Roth, Danny £11.95
Patrick Jourdain’s Problem Corner Jourdain, Patrick £12.95 Bridge on a Shoestring Schoenborn, Michael £13.95
Advanced Bridge Defense Kantar, Eddie £13.95 25 Bridge Conventions You Should Know Seagram & Smith £10.50
Classic Kantar Kantar, Eddie £9.50 25 More Conventions You Should Know Seagram & Bird £10.50
Defensive Tips for Bad Card Holders Kantar, Eddie £14.95 25 Ways to Be a Better Defender Seagram & Bird £10.50
Kantar on Kontract Kantar, Eddie £10.50 25 Ways to Compete in the Bidding Seagram & Smith £10.50
Modern Bridge Defense Kantar, Eddie £13.95 25 Ways to Take More Tricks as Declarer Seagram & Bird £10.50
Roman Keycard Blackwood - 5th ed. Kantar, Eddie £13.95 Declarer Play at Bridge: A Quizbook Seagram & Bird £9.95
Topics in Declarer Play Kantar, Eddie £13.95 Defensive Play Quizbook: A Quizbook Seagram & Bird £9.95
Improve Your Bidding Judgment Kimelman, Neil £12.95 Planning the Play of a Bridge Hand Seagram & Bird £12.95
The Thin Line Kimelman, Neil £12.95 Pocket Guide to Defensive Play Seagram & Bird £6.95
365 Winning Bridge Tips Kleinman, Danny £13.95 Scotland’s Senior Moment Smith & Adamson £13.95
Human Bridge Errors Kleinman & Straguzzi £10.50 Becoming a Bridge Expert Stewart, Frank £13.95
A Bridge to Inspired Declarer Play Laderman, Julian £12.95 Frank Stewart's Bridge Club Stewart, Frank £10.50
A Bridge to Simple Squeezes Laderman, Julian £11.95 How to Play Bridge with your Spouse Tevkolsky, Roselyn £9.95
Bumblepuppy Days Laderman, Julian £14.95 Bridge at the Breakfast Table Thurston, Paul £1.50
Still Not Finding Squeezes? Laderman, Julian £7.95 25 Steps to Learning 2/1 Thurston, Paul £10.50
25 Conventions for ACOL Players Landry & Horton £11.95 North of the Master Solvers’ Club Vine, Frank £11.95
Complete Book on Overcalls (2nd ed.) Lawrence, Mike £13.95 Bridge at the Enigma Club Winkler, Peter £11.95
Complete Book on Passed Hand Bidding Lawrence, Mike £13.95 The Lone Wolff Wollf, Bobby £15.95