LOCUS MG679228 361 bp DNA linear PLN 16-JAN-

2019
DEFINITION Rosa eglanteria voucher EC026371 ribulose-1,5-bisphosphate
carboxylase/oxygenase large subunit (rbcL) gene, partial cds;
chloroplast.
ACCESSION MG679228
VERSION MG679228.1
KEYWORDS .
SOURCE chloroplast Rosa rubiginosa
ORGANISM Rosa rubiginosa
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae;
Rosoideae incertae sedis; Rosa.
REFERENCE 1 (bases 1 to 361)
AUTHORS Gaurav,A.K., Raju,D.V.S., Namita,N., Ram Kumar,M.K., Mahadani,P.,
Singh,M., Singh,M. and Amitha Mithra,S.V.
TITLE Phylogenetic studies in Indian rose based on molecular markers
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 361)
AUTHORS Gaurav,A.K., Raju,D.V.S., Namita,N., Ram Kumar,M.K., Mahadani,P.,
Singh,M., Singh,M. and Amitha Mithra,S.V.
TITLE Direct Submission
JOURNAL Submitted (10-DEC-2017) Division of Floriculture and Landscaping,
ICAR-IARI, Pusa Campus, New Delhi, Delhi 110012, India
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..361
/organism="Rosa rubiginosa"
/organelle="plastid:chloroplast"
/mol_type="genomic DNA"
/specimen_voucher="EC026371"
/db_xref="taxon:74636"
/country="India"
/lat_lon="31.09 N 77.15 E"
/collection_date="21-Jul-2016"
/collected_by="Abhay Kumar Gaurav"
gene <1..>361
/gene="rbcL"
CDS <1..>361
/gene="rbcL"
/codon_start=2
/transl_table=11
/product="ribulose-1,5-bisphosphate carboxylase/oxygenase
large subunit"
/protein_id="AZZ85926.1"

/translation="DLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYVKTFQ

GPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVN
SQPFMRWRDRFLFCAEAI"
ORIGIN
1 agaccttttt gaagagggtt cggttactaa catgtttact tccattgtag gtaatgtgtt
61 tgggttcaag gccttgcgcg ctctacgtct ggaggattta cgaatcccta ctgcttatgt
 121 taaaactttc caaggcccgc ctcacgggat ccaagttgaa agagataaat tgaacaagta
181 tggccgcccc ctattgggat gtactattaa acctaaattg gggttatccg ctaagaatta
241 cggtagagca gtttatgaat gtctccgcgg tggacttgat tttaccaaag atgatgagaa
301 tgttaattcc caaccattta tgcgttggag agaccgtttc ttattttgtg ccgaagcaat
361 t
//