Sie sind auf Seite 1von 132

COLLECTO RS

GL OW IN TH E
DA RK CO VE R
ALICE COOPER
THE ALBUM THAT MADE HIM A STAR
ZZ TOP
KENT BEARD RIOT!
ALTER BRIDGE
MYLES KENNEDY’S WILD MUSICAL TRIP

ISSUE 3
UK£5.00 US$10.50 CAN$11.99

“We Went Too Far Every Single Day…”


56 Alice Cooper
The artist formerly known as
Vincent Furnier transports Stevie
Chick back to early ’70s Detroit
for an education in the making
of the classic School’s Out album.
“What is this that
stands before me…” Contents
Issue 3 September 2017

F E AT U R E S

40
Rick Wakeman
Prog’s ultimate keyboard wizard on
Bowie, Sabbath, Yes and why having
DJRRGFDSHLVDFUXFLDOGHDOĦEUHDNHU

50
Airbourne
The Warrnambool warriors laugh in
the face of civil unrest, debt and threats
of actual bodily harm, but how would
they cope when faced with the genteel
surroundings of the Musilac festival?

64
Soundgarden
Seattle’s most contrary band set out to be
“Black Sabbath without the parts that
VXFNμ%XWLQDWLQ\/RQGRQFOXE&KULV
&RUQHOO·VQHZĦORRNDFWVHUYHGQRWLFHWKDW
they would become so much more…

70
Diamond Head
The Stourbridge quartet were
roundly tipped to be the NWOBHM’s
DQVZHUWR/HG=HSSHOLQ7KLQJVGLGQ·W
TXLWHSDQRXWWKDWZD\EXWVXSHUĦIDQV
Metallica have ensured Brian Tatler’s
EDQGZLOOQHYHUEHIRUJRWWHQ

76
Alter Bridge
Myles Kennedy reveals the songs
WKDWPDNHKLVSODQHWURFN%XWZKLFK
one reminds him of shovelling shit?

80
T H E C O V E R S T O RY

Black Sabbath
Phil Alexander delves deep into
6DEEDWK·VÀUVWWHQ\HDUVGLVVHFWLQJWKH
FODVVLFOLQHĦXS·VHLJKWVWXGLRDOEXPVDQG
hearing the inside story of their rise, fall
GETTY

DQGWULXPSKDQWUHXQLRQIURPULɲĦORUG
H[WUDRUGLQDLUH7RQ\,RPPL

PLANET ROCK 3
September 2017

U P F R O N T

8 32
Metallica The Darkness
Major maple leaf mayhem! 7KHVL[VRQJVWKDWLOOXPLQDWH
-XVWLQ+DZNLQV·OLIHZKHQ

10
WKHOLJKWVJRRXW

34
Black Sabbath
The End Of The End concert
ÀOPDUULYHV Rock Star Private Jets
:K\ÀUVWĦFODVVDLUWUDYHOZLWK
WKHJUHDWXQZDVKHGVLPSO\LVQ·W
JRRGHQRXJKIRUURFN·VHOLWH

14
Mollie Marriott
Look wot they
dun: backstage
with Slade. 18
&RUH\7D\ORUDQGKLVPRXWKĦ
6WHYH·VJLUOFRPHVJRRGSOXV
.LQJ.LQJDQGPRUHLQRXU
ZDWHULQJVWXɲHGSHSSHUV 36
1HZ5RFNVSHFLDO Michael Schenker
22 7KH%ORQGH%RPEHUVKDUHVKLV
KDUGĦZRQOLIHOHVVRQVLQFOXGLQJ
18 Budgie
%XUNH6KHOOH\VSLOOVWKHVNLQQ\
WKHNH\WRDSSDUHQWO\SOD\LQJRQ
Slade HYHU\VLQJOHURFNUHFRUG
RQWKHEDQG ·VDQWLĦFDSLWDOLVW
7DSSLQJLQWR$PHULFDZLWK DQWKHP%UHDGIDQ
:ROYHUKDPSWRQ·VFUD]HHJDQJ
30 38
24 Black Country
20 Spirit Of Radio
Joe Elliott
The Def Leppard frontman
Communion
+RZ*OHQQ+XJKHVDQG-RH
Stone Sour 3ODQHW5RFN·VSUHVHQWHUVVKDUHWKHLU DQG3ODQHW5RFNSUHVHQWHURQ %RQDPDVVDNLVVHGPDGHXS
7KH+DLU\%LNHUVSUHVHQW IDYRXULWH6DEEDWKVWRULHVDQGWHOO KLVIULHQGVKLSZLWK0RWW7KH DQGJRWWKHLUWXUERĦFKDUJHG
5RFN·Q·5ROO&RRNHU\ZLWK XVZKDW·VVRKRWULJKWQRZ +RRSOHOHJHQG,DQ+XQWHU VXSHUJURXSEDFNLQWKHJDPH

GET TY IMAGES, ROB BLACKHAM, REX, PAUL HARRIES


U P T H E B AC K

96 112 114 116 129


25 Albums Books & DVDs Unsung The Buyers’ Crossword
You Must Hear *XQV1·5RVHV $QRYHUĦGXH Guide 7\OHU%U\DQW 7KH :LQ%ODFN6DEEDWK·V
Right Now! )RUHLJQHU·V0LFN-RQHV DSSUHFLDWLRQRI Shakedown and The Ten Year War
6FRUSLRQVDWLSWRH
,QFOXGLQJ«)RR DQG-DQH·V$GGLFWLRQ <HV·V'UDPD ÀYHPRUHVL]]OLQJ
WKURXJKWKH7HXWRQLF ER[VHW
)LJKWHUV4XHHQV QHZDFWV
WHUURUV·WHUULÀF
2I7KH6WRQH$JH
130
FDWDORJXH
%ODFN&RXQWU\ 124
118
&RPPXQLRQ2K6HHV Who The Hell
Showtime
7KH'DUNQHVV'HDG Are These
7ZRÀVWIXOVRIWKHEHVW
&URVV*XQ3URSKHWV Live Wire Guys?
XSFRPLQJJLJVZLWK
2I5DJH$OWHU%ULGJH +RWURFNLQ·ZLWK== 0HWDOOLFD/LYLQJ 'R\RXNQRZWKH
6X]L4XDWURDQG 7RSīOHIWĬ &RORXU$QDWKHPD LGHQWLW\RIWKLV
PDQ\PRUH 6D[RQSOXV and PRUH ORQJĦORVWORW"

4 PLANET ROCK
478*(4)*&3&,*2*399)Ű
.3&884(.&9.43<.9-7*8*398ů&78-&11 7989)ŰN385.7*) 79.898 ,*3(>7*8*39

GLASGOW BARROWLAND // Saturday 2nd December 2017


MANCHESTER CLUB ACADEMY // Friday 8th December 2017
ELECTRIC BALLROOM, LONDON // Saturday 9th December 2017

NEW ALBUM ‘FAVOURITE PLEASURES’


released September 15th
Includes ‘FAVOURITE PLEASURES’
and ‘SILENT LOVERS
Buy concert tickets and the album at
,:34+æ (.&1Ű(4Ű:0 now
Olympian feats of excess, personal tales of chaos and
D GLVWLQFW VHQVH RI PLVFKLHI RIWHQ GH¿QHG %ODFN 6DEEDWK¶V ¿UVW
GHFDGH 6R PXFK VR WKDW RQ RFFDVLRQ WKHLU JURXQGĥEUHDNLQJ Academic House,
PXVLFDOLW\JHWVRYHUORRNHG7KLVLVVXHZHFHOHEUDWHWKHUHOHDVHRI 24-28 Oval Road,
London NW1 7DT
Email: mail@planetrock.com
WKHLUQHZER[VHWThe Ten Year WarZLWKD¿UVWĥKDQGYLHZRIWKH
M USIC &

TXDUWHW¶VPRVWVLJQL¿FDQWSHULRGDQGDQDOOĥUHYHDOLQJFRQYHUVDWLRQ CON T E N T DIR EC T OR


Ric Blaxill
(',7 25ĥ, 1ĥ &+,() 
ZLWK7RQ\,RPPLZKRORRNVEDFNDWWKRVHFUXFLDOIRUPDWLYH\HDUV $ 6 62&, $7 (38 %/,6+ (5
Phil Alexander
DVZHOODV6DEEDWK¶V¿QDOIDUHZHOO:H¶UHDOVRSURXGWREULQJ\RX EDIT OR
Paul Brannigan

JORULRXVSLHFHVRQHYHU\RQHIURP0LFKDHO6FKHQNHUYLD'LDPRQG A RT DIR EC T OR
Russell Moorcroft

+HDGDQG$LUERXUQHWR5LFN:DNHPDQ CON T R IBU T I NG EDIT OR S


Pat Gilbert
Mark Blake
:H¶GOLNH\RXWRVKDSHWKHGHYHORSPHQWRIWKLVDXJXVWRUJDQ PRODUC T ION DIR EC T OR
Julie Emery
$QG VR ZH LQYLWH \RX WR ORJ RQ WR ZZZSODQHWURFNFRPVXUYH\ DEPU T Y A RT DIR EC T OR
Tan Doan
ZKHUH\RX¶OO¿QGDEULHIVXUYH\ZH¶GORYH\RX PIC T U R E EDIT OR
Scarlet Borg
WR FRPSOHWH7KDQN \RX LQ DGYDQFH IRU \RXU CON T R IBU T OR S
Matt Allen, Paul Anthony, Jason Arnopp,
KRQHVWRSLQLRQV6HH\RXEDFNKHUHIRU9RO Liz Barnes, Steve Beebee, Keith Cameron,
Stevie Chick, Ian Danter, Paul Elliott, George
Garner, Caren Gibson, Ross Halfin,
DWWKHHQGRI2FWREHU« Paul Harries, James Hickie, James McNair,
Ben Mitchell, Darren Redick, Nick Ruskell, Amit
Sharma, Cathi Unsworth, Marco Vittur,
Wyatt Wendels, Ian Winwood

Group Managing Director, Advertising


Abby Carvosso
Music Director
Joel Stephan
Classified Sales Executive
Philip Nessfield
PHIL ALEXANDER, EDITORĥINĥCHIEF Production Manager
Carl Lawrence
Ad Production Controller
Helen Mear

Chief Executive
Paul Keenan
Group Managing Director
Contributors gathered in their masses… Rob Munro-Hall
Managing Director
Patrick Horton
Darren Redick is Planet Rock A journalist of 25 years standing, Managing Editor
Danielle O’Connell
Radio’s pet Yank and afternoon Ian Winwood is the co-author of Senior Marketing Manager
presenter. You can hear him yakking two books, Birth School Metallica Fergus Carroll
Marketing Manager
about Rush, dogs, BBQ-ing, playing Death and Into The Black. This Natalie Paszkowski
bass and ballet (!) daily between 2pm month he breaks off from writing his Head Of Marketing (Planet Rock)
Jon Norman
and 7pm. He also plays music, and in third book, Smash, a modern history Direct Marketing Manager
this issue reviews Saxon atop a rainy of ’90s American punk, to join Julie Spires
Direct Marketing Executive
Welsh mountain. Airbourne on tour in France. Olivia Caouki
Head of Communications
Jess Blake
In his 12 years at Kerrang! James Legendary music photographer
Hickie has stood, poised with pen Paul Harries has been shooting
and pad, in dark basements and bands for more than 20 years. His MOJO (ISSN 25144626) is published by
shiny enormodomes alike, in the portfolio amounts to nothing less Bauer Consumer Media Ltd.
Bauer Consumer Media Ltd is a company
service of rock and metal. His fave than a rock fan’s dream. Paul’s registered in England and Wales with company
number 01176085, registered address Media
band of all time is Jane’s Addiction, Slipknot: Dysfunctional Family House, Peterborough Business Park, Lynch
and in this issue he surveys the best Portraits book is available now. Wood, Peterborough PE2 6EA
For subscription queries, please contact CDS
new bands at Ramblin’ Man Fair. Go to www.paulharries.com Global on Bauer@subscription.co.uk
© All material published is copyright of Bauer
Consumer Media Ltd. No part of this magazine
may be reproduced without the prior permission of
the publisher. Planet Rock accepts no
responsibility for any unsolicited material.

SUBSCRIBE TO PLANET ROCK! COMPLAINTS: Bauer Consumer Media Limited


is a member of the Independent Press Standards
Organisation (www.ipso.co.uk) and endeavours to
'RQ¶WPLVVDFRS\RI\RXUQHZIDYRXULWHPDJD]LQH6XEVFULEHWRUHFHLYHWKHQH[W respond to and resolve your concerns quickly.
Our Editorial Complaints Policy (including full
details of how to contact us about
THREE ISSUES OF PLANET ROCK FOR JUST £15RUVLJQXSWRRXUJLIWEXQGOHDQG editorial complaints and IPSO’s contact details)
can be found at www.bauermediacomplaints.co.uk.
get yourself an EXCLUSIVE LIMITED GLOW IN THE DARK PLANET ROCK T-SHIRT Our email address for editorial complaints
covered by the Editorial Complaints Policy is
Ī+WKHPDJVīIRUMXVWĸPRUH+HDGWRSODQHWURFNFRPIRUDOOWKHLQIR2K/RUG\HDK complaints@bauermedia.co.uk.

6 PLANET ROCK
Lords of Summer:
Metallica on-stage in
Quebec, July 14, 2017.

Heroes
Of The Day
THE BIG PICTURE
Metallica thrill 135,000 crowd
at 50th anniversary staging of
the Festival d’été de Québec.

FORGET THE Glastonbury hype, summer


2017’s biggest festival was the extraordinary
)HVWLYDOG¶pWpGH4XpEHFDQĥGD\H[WUDYDJDQ]D
ĦZLWKKHDGOLQHUVLQFOXGLQJ7KH:KR0XVH
DQGRQ-XO\0HWDOOLFDĦIRUZKLFKIXOOHYHQW
WLFNHWVVWDUWHGDWMXVW&DQDGLDQGROODUVĪĸī
ROSS HALFIN

$UHFRUGLQJRI0HWDOOLFD¶VĥVRQJVHWLVDYDLODEOH
IURPOLYHPHWDOOLFDFRP7KHEDQG¶V¿YHĥGDWH8.
WRXUNLFNVRɱDW/RQGRQ¶V2$UHQDRQ2FWREHU
Find out more at W W W.L IVE M ETAL L I CA.CO M

PLANET ROCK 9
Upfront Over and out:
Sabbath say
goodbye.

Into The Void


Watch Black Sabbath’s farewell bow
in an emotional new documentary film.
Ozzy, Tony and
Geezer backstage
P L A N E T R O C K are proud to support in Birmingham,
WKHRQHĥQLJKWĥRQO\VFUHHQLQJRI7KH(QG2I February 4, 2017.
7KH(QG%ODFN6DEEDWK¶V¿OPGRFXPHQWLQJ
WKHFORVLQJQLJKWRIWKHLUKLVWRU\ĥPDNLQJ
ZRUOGWRXU'LUHFWHGE\'LFN ³0\HPRWLRQVDUHÀ\LQJDOORYHUWKH ZDVWKHEHJLQQLQJRIWKHPRVWLQFUHGLEOH
&DUUXWKHUVZKRZRUNHGZLWK/HG=HSSHOLQ SODFH´VD\V2]]\DWWKHRXWVHWRIWKH¿OP DGYHQWXUH,FRXOGHYHUWKLQNRI´
RQWKHLUDFFODLPHG&HOHEUDWLRQ'D\¿OP ZKLOH*HH]HUDGPLWV³,¶YHJRWEXWWHUÀLHVLQ 7RQ\,RPPLVKDUHVKLVWKRXJKWVRQ7KH
WKHĥPLQXWHGRFXPHQWDU\FHQWUHVDURXQG PHVWRPDFK,IHHOOLNH,¶PEHLQJVHQWHQFHG (QG2I7KH(QGDQGPXFKPRUHLQRXU
WKHPHWDOOHJHQGV¶¿QDOVKRZRQ7KH(QG WRGHDWK´ H[FOXVLYHLQWHUYLHZEHJLQQLQJRQSDJH
WRXUDVROGĥRXWGDWHDW%LUPLQJKDP¶V 7RXFKLQJO\&DUUXWKHUVDOVRUHXQLWHV
)RUDIXOOOLVWRIFLQHPDVVFUHHQLQJWKHÀOPORJRQWR
ĥFDSDFLW\*HQWLQJ$UHQDRQ)HEUXDU\ 2VERXUQH,RPPLDQG%XWOHUDW$QJHOLF
W W W. B L AC KSA B BAT H F I L M T I C K E TS . C O M
7KH(QG2I7KH(QGZLOOVFUHHQDWRYHU 6WXGLRVLQ2[IRUGVKLUHWKUHHGD\VDIWHUWKHLU
FLQHPDVZRUOGZLGHRQ6HSWHPEHU ODVWVKRZIRURQH¿QDOVXSULVLQJO\PRYLQJ
,QDGGLWLRQWRLQĥFRQFHUWIRRWDJHWKH EDQGUHKHDUVDO
ROSS HALFIN

TE L L U S WHAT
¿OPIHDWXUHVH[WHQVLYHLQWHUYLHZVZLWK2]]\ ³,FDQUHPHPEHUSOD\LQJ7KH&URZQ YO U TH I N K O F
2VERXUQH7RQ\,RPPLDQG*HH]HU%XWOHUDV SXEĬLQ$VWRQĭDQG,¶PWKLQNLQJ:HOOWKLV P L AN ET R O C K
MAGA Z I N E AN D WI N £500! G O TO
WKH\SUHSDUHWREULQJWKHFXUWDLQGRZQXSRQ LVJRRGIRUDFRXSOHRI\HDUVĬZH¶OOĭGULQND P L AN ETR O C K.CO M / S U R VEY
WKHLUPRPHQWRXVĥ\HDUFDUHHU IHZEHHUVDQGKDYHDMDP´VD\V2]]\³7KDW

10 PLANET ROCK
Upfront

10 Things You’d Forgotten IN BRIEF


About Headbangers Ball
Remembering MTV’s
flagship heavy metal
showcase, which
launched 30 years ago.
A Ronnie James Dio

6
hologram is embarking upon
Ace gets spaced a world tour. Backed by Dio’s
'XULQJD+% Disciples, the hologram kicks
DSSHDUDQFH$FH)UHKOH\ off the Dio Returns tour in
GHFODUHGKHZDVLQDQ Helsinki on November 30.
HVSHFLDOO\JRRGPRRGGXH
WRDQ³DQLQFUHGLEOHGRVH
RIVQRZ´7KHJXLWDULVW
ODWHUFODUL¿HGWKDWKH¶G
EHHQHOHYDWHGE\OLVWHQLQJ
WRVLQJHUVRQJZULWHU
3KRHEH6QRZ

1 7
Its roots lie in a mobile disco The Ball hits the road
7KH¿UVWLQFDUQDWLRQRI+HDGEDQJHUV%DOO 7KH¿UVW+HDGEDQJHUV%DOOĥ
Slipknot’s Day Of The
ZDVQ¶WD79VKRZEXWUDWKHU/DQFDVKLUH'- EUDQGHGWRXUVDZ$QWKUD[ Gusano documentary will
-RKQ%UHQW¶VKHDY\PHWDOURDGVKRZ7KHQDPH ([RGXVDQG+HOORZHHQKLWWKHURDG be screened in cinemas
UHFHLYHGQDWLRQDOSURPLQHQFHZKHQ%UHQW¶V LQ$SULO0D\ worldwide for one night only
on September 6. Tickets for

8
SOD\OLVWFKDUWVZHUHSULQWHGLQ6RXQGV
Axl flexes his muscles? the film are available from

2
Two ’Head cases launched it 'HVSLWHKDYLQJQRSULRU79 dayofthegusano.com/regions/.
0RW|UKHDG¶V/HPP\DQG3KLOμ3KLOWK\ H[SHULHQFHLQ5LNL
$QLPDO¶7D\ORUKRVWHGWKHVKRZ¶V¿UVW 5DFKWPDQFRĥRZQHURI6XQVHW6WULS
HSLVRGHEURDGFDVWRQ$SULO μKDLUPHWDO¶PHFFD7KH&DWKRXVHZDV
7KHLUJRQ]RGHOLYHU\KLQWVDWSUHĥWDSLQJ DSSRLQWHGDVWKH%DOO¶VUHJXODUKRVW
DPSKHWDPLQHLQJHVWLRQ *ORZLQJUHIHUHQFHVIURPKLVSDO$[O
5RVHDOOHJHGO\KHOSHG

3
A royal variety

9
performance Grunge goes glam 1LUYDQD¶VVROH
)RUPHU0HUF\IXO)DWH +%DSSHDUDQFHWDSHGRQ2FWREHU
IURQWPDQ.LQJ'LDPRQG IRXQG.XUW&REDLQUHVSOHQGHQWLQD\HOORZ
VXEYHUWHGKLV6DWDQLFSHUVRQD GUHVV$VNHGZK\E\DEHPXVHG5LNL Bruce Dickinson will release
E\UHDGLQJ0DU\+DG$/LWWOH 5DFKWPDQ&REDLQUHSOLHG³,W¶V+HDGEDQJHUV his autobiography What Does
%DOOVR,WKRXJKW,¶GZHDUDJRZQ´ This Button Do? via Harper
/DPEGXULQJKLVJXHVW Collins on October 19. The

10
SUHVHQWHUVWLQWLQ book promises a “long-awaited
Hair today, gone tomorrow

4
window into the life, heart and
GN’R’s appetite ,Q5DFKWPDQDFNQRZOHGJHGWKDW mind” of Maiden’s polymath.
for destruction WKHKHDY\PHWDOZRUOGZDVFKDQJLQJE\
,QYLWHGRQWRWKHVKRZ JHWWLQJKLVORQJZDY\WUHVVHVFXWRQDLU
Axl-endorsed RQ2FWREHUD 7KRXJK+HDGEDQJHUV%DOOUHPDLQHGRQ
Riki with YLVLEO\ERUHG*XQV 079LQWKH86XQWLO-DQXDU\LWV
Traci Lords. VRXOGLHGWKDWGD\
1¶5RVHVREOLJLQJO\WUDVKHGWKHVWXGLR
DWWKHLQVLVWHQFHRISDLQIXOO\RXWĥRIĥ
KLVĥGHSWK9-$VKHUμ6PDVK¶%HQUXEL
ALAMY, GETTY, REX

5
Ozzy hooked in )RUUHDVRQV
EHVWNQRZQWRKLPVHOI2]]\
The Seattle Repertory Theatre
2VERXUQHVSRUWHGDSLUDWHKRRN is developing a grunge musical
ZKHQSUHVHQWLQJWKHVKRZ¶V&KULVWPDV and has acquired the rights to
VSHFLDOLQ&RĥKRVW=DNN:\OGH use music by Soundgarden,
GLGQ¶WEOLQNDQH\HREYLRXVO\ Alice In Chains, Smashing
Pumpkins and more.
King Diamond
(left) and Kurt
12 PLANET ROCK in gown.
LONG-AWAITED DEBUT SOLO ALBUM

Featuring a raw an’ stripped-back


presentation of 14 classic blues cuts
produced by Grammy-winner Jim Gaines
OUT NOW
CD / LP / DIGITAL
CD INCLUDES BONUS TRACK
‘DYNAFLOW BLUES’
georgethorogood.com

spinefarmrecords.com
Fringe benefits: Mollie
Marriott steps out of
the shadows.
Upfront

Mollie
Marriott
Here Comes
The Nice
NEW ROCK
Scion of rock’n’roll royalty and former backing
vocalist for Ronnie Wood and Oasis steps into
the solo spotlight. W O R D S : I A N W I N W O O D

MOLLIE MARRIOT T 7KHVHVVLRQVIRUWKHUHFRUG


ZDVGHVWLQHGWR¿QGDOLIHLQ ZHUHLQLWLDOO\VORZJRLQJDQG
PXVLF7KHGDXJKWHURI6PDOO UHPDLQHGVRXQWLO3DXO:HOOHU
)DFHVDQG+XPEOH3LHYRFDOLVW LQYLWHGKHUDQGKHUEDQGWR
JXLWDULVW6WHYH0DUULRWWVKH UHFRUGDWKLV%ODFN%DUQVWXGLR
VSHQWKHUHDUOLHVW\HDUVLQDKRXVH LQ5LSOH\6XUUH\7KH0RGIDWKHU
¿OOHGQRWMXVWZLWKWKHVRXQGVRI WKUHZLQDFFRPPRGDWLRQWRR
URFNDQGEOXHVEXWDOVRRSHUD DQGDVLIWKLVZDVQ¶WHQRXJKKH
DQGEDOOHW)ROORZLQJKHUSDUHQWV¶ WKHQDVNHGLIKHFRXOGSOD\RQWKH
GLYRUFHKHUPRWKHUUHPDUULHG DOEXP7KHDQVZHUWRZKLFKZDV
URFN¶Q¶UROOVLQJHUJXLWDULVW-RH \HVEXWRQO\RQWZRVRQJV
%URZQPDNLQJ0ROOLHDVWHSĥ ³,WZDVWHUULI\LQJKDYLQJ3DXO
VLVWHUWR6DP%URZQZKRPVKH LQWKHVWXGLRZLWKPH´VD\V
GHVFULEHVDV³RQHRIWKHJUHDWHVW 0ROOLH³3DXODQG,DUHYHU\YHU\
VLQJHUVWKLVFRXQWU\KDVHYHU FORVH:H¶UHOLNHDPXVLFDOIDPLO\
produced”. %XWLWZDVVWLOO
³2EYLRXVO\,FRPH intimidating.”
IURPDPXVLFDOEDFNĥ “I HAVE 7KLVWKRXJKZDV
JURXQG´VKHVD\V MY DAD’S DOOSDUWRIWKHSURFHVV
³$QGREYLRXVO\,KDYH SURNAME – RIVWHSSLQJRXWRIWKH
P\GDG¶VVXUQDPH A HELP AND VKDGRZV:LWKDVROLG
ZKLFKLVERWKDKHOS HINDRANCE.” EDQGDV³DVHFXULW\
DQGDKLQGUDQFH,¶P EODQNHW´DQGHQRXJK
YHU\SURXGRIKLP H[SHULHQFHRIOLIH¶V
DQGDORWRIGRRUVKDYHEHHQ VKDUSHUHGJHVWR¿OODO\ULFVKHHW
RSHQHGIRUPHE\SHRSOHZKR 0ROOLH0DUULRWWKDVPDGHKHU
NQHZKLPDQGZKRZDQWWRKHOS transition and is now hoping to
PH%XWWKHUHKDYHEHHQGRRUV make her mark.
WKDWKDYHEHHQVKXWDQGEROWHG ³,DPTXLWHDSULYDWHSHUVRQ
IRUWKHRSSRVLWHUHDVRQ´ DQG,NQRZWKDWVWHSSLQJRXWWR
)ROORZLQJ\HDUVRISURYLGLQJ WKHIURQWPHDQVWKDW,¶OOKDYHWR
EDFNLQJYRFDOVIRUDUWLVWVVXFKDV WDONDERXWSULYDWHDQGSHUVRQDO
2DVLV5RQQLH:RRGDQG3DXO WKLQJV´VKHVD\V³$OVR,¶OOKDYH
:HOOHUĦDQGDFDUHHUVDEEDWLFDO WRWDONDERXWP\GDGDORW%XW
during which she worked as a WKDW¶V2.EHFDXVHLW¶VWLPHIRU
GHQWDOQXUVHĦ0ROOLHGHFLGHGWKH PHWREHFRPHDQDUWLVWLQP\
WLPHZDVULJKWWRPRYHIURP own right.”
VLGHĥVWDJHWRFHQWUH+HUGHEXW LISTEN TO: TRUTH IS A WOLF
DOEXPTruth Is A WolfVHWIRU
UHOHDVHRQ1RYHPEHULVD
WANT MORE NEW ROCK?
ĥVRQJVHWWKDWPDUULHVWKH Check out T H E N E W R O C K
VXOWU\JURRYHRIVRXOIXOURFN S H OW with W YAT T , every
ZLWKWKHNLQGRIO\ULFDOELWH Saturday at 10pm, exclusively
IRXQGRQ$ODQLV0RULVVHWWH¶V on Planet Rock Radio.
Jagged Little Pill.

PLANET ROCK 15
Upfront

ONES TO WATCH
Three more Wyatt
Wendels-approved acts
to keep an eye on.

Red Sun Rising


A decade into their career,
Akron, Ohio’s Red Sun Rising
have graduated to the Planet
Rock A-List, thanks to the
classy post-grunge stylings
of The Otherside, one of two
cuts from 2015’s Polyester
Zeal to top the US Mainstream
Rock chart. Scorchio!
Find out more at:
redsunrisingmusic.com

King rocker: Alan


Nimmo (third from
left), kilt not shown.

King King
Greta Van Fleet
NEW ROCK
The gutsy Glaswegians had ballsy blues-rock EDVVLVW/LQGVD\&RXOVRQDQG
nailed. Now they’ve added soul and songs to their +DPPRQGRUJDQPDHVWUR%RE Youthful Michigan hard rockers
)ULG]HPDVXSSRUWHG7KXQGHU Greta Van Fleet’s stunning
formidable weaponry. W O R D S : J A M E S M C N A I R debut EP Black Smoke Rising
DW:HPEOH\$UHQDODVW\HDUEXW sounds like Zeppelin at their
WKHLUPRVWH[RWLFHQJDJHPHQW most cocksure. The quartet’s
WKXVIDUZDVDVWLQWDW0XPEDL debut UK show at London’s
A S K E D A B O U T his EXWWKHLUIRXUWKVWXGLRDOEXP ,QGLD¶V0DKLQGUD)HVWLYDO Black Heart on September
26 is already sold out: beg,
JXWV\*ODVJRZĥERUQURFNHU Exile & GraceKDVFODVVLFURFN ³,W¶VWKHODUJHVWEOXHVIHVWLYDO borrow or steal a ticket for
OLQHDJH.LQJ.LQJ¶VIURQWPDQ JORU\LQLWVVLJKWV5HFRUGHGDW LQ$VLDEXWZHRQO\IRXQGWKDW their Boston Music Room gig
DQGJXLWDULVW$ODQ1LPPR 6XSHUÀ\VWXGLRVLQ2OOHUWRQ RXWZKHQZHJRWWKHUH´VD\V in the capital the next evening.
UHVSRQGV³,ZRXOGQ¶WGDUHSXW 1RWWLQJKDPVKLUHĦ³,W¶VSDUWĥ 1LPPR6XFKDGYHQWXUHVĦDQG Find out more at:
P\VHOILQWKHVDPHOHDJXHDV RZQHGE\RXUGUXPPHU:D\QH DVXSSRUWWRXUZLWKYHWHUDQ gretavanfleet.com
SHRSOHOLNH)UDQNLH0LOOHUDQG Ĭ3URFWRUĭ´VD\V1LPPR³VR EOXHVOHJHQG-RKQ0D\DOOĦKDYH
0DJJLH%HOOEXW,WKLQNWKHLU WKHUHZDVQRSUHVVXUH´ĦDQG SUHSSHGWKHTXDUWHWIRUDELJ
JOANovARC
Having produced the quartet’s
PDLQVWUHQJWKVZHUHKRQHVW\ PL[HGE\&KULV6KHOGRQĪ)RR OHDSRIIDLWK debut album Ride Of Your Life,
DQGSDVVLRQ(YHU\ZRUGWKDW )LJKWHUV)HHGHUīExile & Grace )HEUXDU\¶V8.WRXULQFOXGHV Foo Fighters knob-twiddler Gil
FDPHRXWRIWKHLUPRXWKVZDV EDUHVLWVVRXOLQ DVKRZDW/RQGRQ¶V Norton hailed JOANovARC
KHDUWIHOWDQGKRSHIXOO\,¶PWKH PLJKW\VRQJV 6KHSKHUG¶V%XVK as: “the new queens of rock”.
R AY TA R A N T I N O
VDPH,DOVRORYHGSHRSOHOLNH VXFKDV+HHG7KH “WE LOVE (PSLUHWKHLU Their Seeds Of Summer single
backs up the hype. Sam and
%LJ*HRUJHIURPĬORFDOOHJHQGVĭ :DUQLQJDQG FREE AND ELJJHVWKHDGOLQLQJ Shelley Walker’s sister act are
%LJ*HRUJH$QG7KH%XVLQHVV )LQG<RXU:D\ WHITESNAKE JLJVRIDUZKLOHDQ only getting started…
,¶GGRWKHRGGJLJSOD\LQJJXLWDU ³:KHQZHUHDOO\ AS MUCH AS DSSHDUDQFHDWWKH Find out more at:
ZLWK*HRUJHDQGKH¶GGULQNDOO VWDUWHGJHWWLQJLQWR BLUES.” 3ODQHW5RFNVWRFN joanovarc.co.uk
WKHPRQH\EHIRUHZHJRWSDLG WKHVRQJZULWLQJZH IHVWLYDORQ
+H¶GVD\WRPHμ<RX¶YHD¿UHLQ UHDOLVHGZHORYHG 'HFHPEHU
\RXĦQHYHUOHWWKDWGLH¶´ )UHHDQGHDUO\:KLWHVQDNHDV ZLOOFURZQDSLYRWDO
7KHSDVVLRQWKDWWKHODWH PXFKDVVWUDLJKWĥDKHDGEOXHV´ \HDUIRU1LPPR¶V
%LJ*HRUJHVSRWWHGLQ1LPPR VD\V1LPPRDNLOWĥGUDSHGPDQĥ EDQG7KH¿UH
UHPDLQVDEOD]HLQ.LQJ.LQJ PRXQWDLQZKR¿UVWFDPHWRWKH LVVSUHDGLQJ«
7DNLQJWKHLUQDPHIURPERWK IRUHDORQJVLGHKLVHOGHUVLEOLQJ
DIDPHG/$EOXHVFOXEDQGDQ DQGIHOORZJXLWDUDFH6WHYLHLQ LISTEN TO:

DOEXPE\LOOĥVWDUUHG&DOLIRUQLDQ 7KH1LPPR%URWKHUVEDQG EXILE &


GRACE
EDQG7KH5HG'HYLOVWKLVDEOH $IRUPLGDEOHOLYHDFW.LQJ (ALBUM,
TXDUWHWEHJDQDVEOXHVSXULVWV .LQJZKRDUHFRPSOHWHGE\ 2017) Catch
their fire:
JOANovARC.
16 PLANET ROCK
999T-+0)-+0)T%1T7-
999T/#0*#6104'%14&5T%1/
999T(#%'$11-T%1/f/#0*#6104'%14&5F
Upfront

Slade
Entertain
LA’s Rock’n’
Roll Queens
BACKSTAGE
WHO:Slade
WHERE: Los Angeles
WHEN: May 8, 1973

W I T H F O U R UK Number 1
singles already under their belts,
Slade were being promoted by
Polydor Records as ‘England’s
New Beatles’ ahead of their secĥ
ond American tour in the spring
of 1973. The Wolverhampton
quartet were in bullish mood as
they talked up their prospects.
“We’re presenting music and
excitement and fun,” guitarist
Dave Hill told a Californian
newspaper. “It’s like having a good
SDUW\,W¶VDZRUNLQJĥFODVVWKLQJLQ
England, it’s a teenage thing in
America. I can’t see what group
here is catering to teenagers.”
Ultimately, it wouldn’t be
Slade. Released to coincide with
the tour, Cum On Feel The Noize
stalled at Number 98 on the US
Billboard charts, while the press
coverage wasn’t charitable: “Slade
proved themselves to be an inept
simplistic group bordering on
musical idiocy,” one critic wrote.
“America wasn’t quite ready,”
Hill later mused. It would, in fact,
be a full 11 years later before the
group scored their sole Top 20
single in the States with Run
Runaway reaching Number 20 in
June 1984. Still, with popular local
scenesters Lori Maddox and Sable
Starr in attendance, at least their
GETTY

LA promotional bash was a night


worth celebrating…

18 PLANET ROCK
Skweeze me, pleeze me:
Slade’s Dave Hill provides the
meat in a Sable Starr (left)
and Lori Maddox sandwich.
Upfront

otherwise I won’t be able to sleep.


Having said that, if I’ve had a good
steak, I might have to have an
espresso afterwards to help me
through the meat coma that slowly
I ONLY LISTEN TO starts to set in.

METAL DURING What music would you listen to?

THE MEAT- I probably wouldn’t be listening to


metal. If I were going to, it would be
The Hairy Bikers Present... POUNDING STAGE DWWKHPHDWĥSRXQGLQJVWDJHRI

ROCK’N’ROLL COOKERY
preparation for the meal. I tend to put
OF COOKING. RQVWXɱWKDW¶VDOLWWOHHDVLHUWROLVWHQ
to. I’ll listen to anything from Frank
Sinatra to the Dave Brubeck Quartet,
but also Looking Glass and the
$WODQWD5K\WKP6HFWLRQĦVWXɱWKDW

WITH COREY TAYLOR


I’ll know the choruses to but not the
verses. That way I can concenĥ
WUDWHRQWKHLQWULFDWHVWXɱ
during the verses, but when
those choruses kick in I’m
singing loudly while throwing
everything into the pot.
cream cheese, Parmesan, and
Stone Sour/Slipknot polymath garlic salt and garlic pepper. I Who would be your dream
dishes out his tips for a ‘hit’ mix that all up and bake it for guests for a night in?
recipe, soundtracked by Ol’ Blue about 25 minutes until the top 'H¿QLWHO\+HQU\5ROOLQV,
Eyes and Dave Grohl’s jokes. starts to bubble. During that could pick that guy’s brain all
time I cut the peppers into QLJKWĬ'DYHĭ*URKOEHFDXVHKH
OLWWOHWDFRVKHOOĥW\SHVKDSHV OLJKWHQVDQ\IXFNLQJPRRGĦKH¶V
What food would you cook on but you don’t cook them just joke, joke, joke. I’ve been
a good night in? because you want them to have that RXWWRGLQQHUZLWK'Xɱ0F.DJDQ
Cooking is a lesson in patience. It’s FUXQFK2QFHWKHVWXɷQJLVRXW\RX and he’s an absolute fucking pleasure
How to make
OLNHEHLQJLQWKHVWXGLR\RX¶UH OHWLWFRRORɱDELWDQGWKHQVSRRQLW to hang out with and talk to, so he’d
stuffed peppers:
‘producing’ a meal, and gradually into the peppers. It’s quick, it’s easy, garlic salt and GH¿QLWHO\EHWKHUH%H\RQGWKDWLW¶G
layering in the ingredients, but you and it’s delicious. pepper, Parmesan, start to get a little crazy because I
can’t rush it otherwise the whole cream cheese, ZRXOGEHSXOOHGLQVHYHUDOGLɱHUHQW
thing goes to shit. If it comes out What would you drink? sausages, peppers.
directions…
right, however, you may well have a I haven’t drunk alcohol in seven years.
‘hit’ on your hands. I would always do ,ORYHFRɱHHEXW,KDYHWRFXWP\VHOI What’s the best night in you’ve
VWXɱHGEHOOSHSSHUVWRVWDUW,VWXɱ RɱDWDFHUWDLQSRLQWGXULQJWKHGD\ ever had?
them with a mix of breakfast sausage, ĦXVXDOO\DWDERXWSPĦEHFDXVH 2QRQHRIP\ELUWKGD\V,KDG'Xɱ

I L L U S T R AT I O N : M A X I M I N
DQGKLVZLIHĬPRGHO6XVDQ+ROPHVĭ
.HUU\.LQJDQGKLVZLIH$\HVKDDQGD
EXQFKRIP\IULHQGVZKRDUHQ¶W'Xɱ
0F.DJDQDQG.HUU\.LQJ7KRVH
friends were sitting there going, “Holy
fuck!”, because of the other people
that were there. I was sitting at the
other end of the table laughing
because it was such an awesome thing
I N T E RV I E W : JA M E S H I C K I E

to witness. It was one of those rad


nights where I didn’t know what was
going to happen, but I ended up
surrounded by great people.

Present
T H E H A I RY B I K E R S
on Sunday
T H E H A I RY R O C K S H OW
PRUQLQJVIURPDPĦSP5HSHDWHG
Good taste:
Stone Sour,
HYHU\7XHVGD\QLJKWIURPSP
with Corey
Taylor (centre).
32
Upfront
Bread famous:
Budgie, with
Burke Shelley
centre.

HOW
I WROTE...
BREADFAN
Budgie vocalist/bassist Burke
Shelley on how channelling
anti-capitalist hippy vibes helped
birth a heavy metal standard.

It wasn’t too deep and meaningful, Metallica had already covered


it was just that idea that it won’t do &UDVK&RXUVH,Q%UDLQ6XUJHU\ĬRQ
you any good having too much money. ¶V7KHIJ(3*DUDJH'D\V
,¶GKDGDZRUNLQJĥFODVVEDFNJURXQG
one of seven kids on a council estate, METALLICA 5Hĥ5HYLVLWHGĭDQGWKH¿UVW,KHDUGRI
WKHPGRLQJ%UHDGIDQĬDVD%ĥVLGHRQ
and in the late ’60s/early ’70s there COVERING US their 1988 Harvester Of Sorrow

DEFINITELY
W E W E R E rock ZHUHDOOWKHKLSS\ĥLVKLGHDVDERXWORYH VLQJOHĭZDVZKHQWKHUHFRUGODEHO
DQGSHDFHĦμ<RXGRQ¶WQHHGPRQH\ phoned up and said, ‘Oh, you got

PHOTO: FIN COSTELLO/GETTY


stars by 1973. I could
walk down the main
VWUHHWLQ&DUGLɱDQG
PDQDOO\RXQHHGLVORYH¶ĦVRWKHVRQJ
ZDVDUHÀHFWLRQRIWKDW DIDN’T HURT. covered again…’
We’d had a few younger bands
everyone knew who I was. We never We recorded Never Turn Your Back BURKE
TXRWLQJXVDVDQLQÀXHQFHĦ6RXQGĥ
actively courted stardom, but we had On A FriendDW5RFN¿HOGVWXGLRVĬLQ SHELLEY garden covered Homicidal Suicidal,
a good following and being ‘famous’ 0RQPRXWK:DOHVĭ:HZHUHSDUWRI Iron Maiden covered I Can’t See My
helped when it came to chasing girls, WKHIDPLO\ĦZHXVHGWRUHFRUGWKHUH Feelings and Van Halen would play In
of course. By the time it came to ZKHQWKH\KDGWKHLUĥWUDFNGHVNLQD )RU7KH.LOOOLYHĦDQGLWGLGXVWKH
make our third record we were on a converted cow shed. Rodger Bain world of good, really. We’d be playing
roll. We were only young, so we were SURGXFHGWKH¿UVWDQGVHFRQGDOEXPV JLJVLQRXU¿IWLHVDQGWKHDXGLHQFH
IXOORIRXUVHOYHVYHU\FRQ¿GHQW Ĭ¶VBudgie and 1972’s SquawkĭEXW would be packed with all these kids in
We had a rehearsal room in the by the third album I wanted my their twenties. I’ve no idea how much
I N T E RV I E W : PAU L B R A N N I G A N

FRXQWU\VLGHRXWVLGH&DUGLɱDQGZH¶G ¿QJHUVRQWKHIDGHUVWRRVRZHGLGLW money Metallica’s version has brought


go in most days and jam on ourselves with our engineer in, I didn’t check our royalty stateĥ
ideas, until it was time for a WRITERS
Pat Moran. We’d set up in the ments in that kind of detail, but their
cup of tea. Breadfan came out Tony Bourge, studio as we would at a gig, HQGRUVHPHQWGH¿QLWHO\GLGQ¶WKXUW
RIRQHRIWKRVHMDPVĦ,WKLQN Ray Phillips, and try to get a live feel to the ,VWLOOGR%UHDGIDQRQĥVWDJHDQG
Burke Shelley
7RQ\Ĭ%RXUJH%XGJLH tracks. It wasn’t exactly I’m still writing music. We’ve been
RELEASED
JXLWDULVWĭcame up with the June 1973, on
complicated and I’m not sure talking about bringing
PDLQULɱDQG,ZURWHWKH Never Turn that we considered Breadfan out another Budgie
slower middle bit and the Your Back the album’s most special song DOEXPĦDQGWKDW¶VWKH
melody and lyrics. On A Friend but it was good. standard I’m aiming for.
LABEL
MCA
22 PLANET ROCK
CLASSIC ROCK MUSICIANSHIP
ON ANOTHER LEVEL!

EXCLUSIVE EUROPEAN SHOWS


WOLVERHAMPTON LONDON
CIVIC HALL EVENTIM APOLLO HAMMERSMITH
Tue 2 Jan 2018 Thur 4 Jan 2018

NEW STUDIO ALBUM


BOOK TICKETS AT
BCCIV ticketmaster.co.uk
Released worldwide on
FRIDAY SEPTEMBER 22ND wolvescivic.co.uk • eventim.co.uk
Available on CD, 180 gram vinyl
and download
Upfront Kiss and tell:
Liz Barnes
and Ozzy
Osbourne.

BLACK
SABBATH
AND ME...
SPIRIT OF RADIO
A selection of Planet Rock’s
presenters share their latest
eventually had to carry it out the
front door like a plank of wood,
praying no one saw me looking
tips and Sabbath memories.
like an idiot on his CCTV!

PAUL LIZ BARNES IAN DANTER


ANTHONY The best thing I’ve The best thing I’ve
The best thing I’ve seen recently I’m seen recently Pretty
seen recently The UHĥUHDGLQJ(ULF much everything at
reaction that Stone Broken Clapton’s autobiography. I’ve the Steelhouse Festival,
received from a packed crowd always been fascinated with how including Stone Broken and Last
as they opened the Planet Rock ‘anonymous’ he is as a In Line. Best festival in the
main stage on the Sunday at SHUVRQDOLW\DQGRQUHĥUHDGLQJLW country, and they even let myself
Ramblin’ Man Fair. It comes ,¶P¿QDOO\XQGHUVWDQGLQJZK\ DQG'DUUHQ5HGLFNJXHVWĪRQ
just a year after they played GUXPVDQGEDVVUHVSHFWLYHO\īRQ
The best thing I’ve heard
the Rising Stage. Wishing Well with Bernie
recently I love the Motörhead
Marsden and Hand Of Dimes!
The best thing I’ve heard cover of David Bowie’s
recently Def Leppard’s Joe “Heroes”. It shouldn’t work The best thing I’ve heard
Elliott talking in depth to me but it completely does. recently The new Cats In Space
about the iconic Hysteria album album ScarecrowĦVXSHUEO\
My favourite Black Sabbath
on its 30th anniversary, at our crafted melodic rock with
memory I once got stuck in
recent Facebook Live Q&A delicious harmonies and ‘kitchen
Ozzy Osbourne’s sitting room.
event at the Gibson Guitar sink’ production. Also Alice
I’d been to interview him at his
Studios in London. Cooper’s ParanormalĦWKHEHVW
house in Buckinghamshire and
thing he’s done in yonks.
My favourite Black Sabbath was told to take a
memory For me it’s more Planet Rock branding My favourite Black Sabbath
‘memories’. I’ve really enjoyed board with me for a memory Meeting Tony Iommi,
seeing them live throughout SKRWR,WZDVDIROGĥXS along with Eddie Van Halen in
WKH\HDUVZLWKPDQ\GLɱHUHQW contraption but it was 1993 at the Musical Exchanges
OLQHĥXSVDQGYRFDOLVWVIURP much taller than me. I guitar shop in Birmingham
Ozzy through RJD, to Ian managed to get it in where I worked. I’m on the right
Gillan, Tony ‘The Cat’ Martin, place and we took the in the pic above. Van Halen were
and a particular favourite gig on photo at the end of touring and EVH wanted a jam
0D\DWWKHPXFKĥPLVVHG the interview, but after ZLWK6DEEDWKRQKLVGD\RɱEXW
Birmingham Odeon featuring Ozzy left I couldn’t DOOKLVJXLWDUVZHUHLQ6KHɷHOG
Hysterical: Paul
the late Ray Gillen. fold it up again. I Anthony and Def so Tony brought him into our
Lep’s Joe Elliott.

24 PLANET ROCK
ROOM
666
store to hire one of his EVH WYAT T
signature models from us. We let WENDELS 565 times more
KLPERUURZRQHĦHYHQLIKH The best thing I’ve evil than Room
GLGQ¶WKDYHDQ\,'ZLWKKLP seen recently 101! The things
([WUHPHDW5DPEOLQ¶0DQ)DLU you love to hate…
DARREN 7KHLU¿UVWĥHYHU8.IHVWLYDO
REDICK headlining performance. That People who talk
The best thing I’ve JXLWDUWKHPKDUPRQLHV«HYHQ during band’s sets!
seen recently , LQWKHSRXULQJUDLQLWZDVMXVW We don’t pay to listen
VWXQQLQJ to you! Shut it,
WLFNHGDFRXSOHRIDUWLVWVRɱP\ respect the band.
EXFNHWOLVW7RP3HWW\DQG
6WHYLH1LFNVSOD\HG+\GH3DUN
The best thing I’ve heard
Guys that think it’s Danny
for the British Summer Time
recently *UHWD9DQ)OHHWĦ
+LJKZD\7XQHIURPWKHLUGHEXW
appropriate to cop
a quick grope in the
Bowes
IHVWLYDODQG6WHYLHDEVROXWHO\ DOEXP7KHZRUOG¿QDOO\KDV mosh pit. Presents
POCKET MONEY PICK
NLOOHGLWWKRXJK7RP3HWW\ZDV VRPHRQHWKDWHɱRUWOHVVO\VRXQGV Any ’80s rock videos
DELWÀDW,ZDVDOVRDWWKH like Robert Plant in 1971 containing women as
6WHHOKRXVH)HVWLYDODQGZKLOH ZLWKRXWWKHEDQGWU\LQJWREH decoration.
DOOWKHEDQGVZHUHWHUUL¿FWKH /HG=HS7KH\KDYHVROGRXW People who don’t use The first record you bought
KLJKOLJKWVIRUPHZHUH5LYDO WKHLU¿UVW8.JLJLQ6HSWHPEHU deodorant before a
6RQV%HUQLH0DUVGHQDQG concert. with your own money.
DQG,H[SHFWELJWKLQJV
Skindred. This month: PR listener
Grunge. It ruined rock
My favourite Black Sabbath David Pyne on AC/DC’s
music for me.
The best thing I’ve heard memory ,QWHUYLHZLQJ2]]\ Blow Up Your Video.
recently Alice Cooper’s 2VERXUQHEHIRUHWKHLU¿QDO People who watch a
Paranormal&DWV,Q6SDFH¶V whole gig through a
'RZQORDGDSSHDUDQFH,¶YH “I loved it from the minute it went
ScarecrowDQG6WHYHQ:LOVRQ¶V mobile phone!
QHYHUVSRNHQWRVRPHRQHVR on the turntable! I think it gets
To The Bone,DPDOVRORRNLQJ LQRɱHQVLYHO\RɱHQVLYH+H Rush – a poor man’s
forgotten but I reckon AC/DC’s
IRUZDUGWRIXOO\DEVRUELQJWKH Yes…
rattled through all manner of best tunes were when they still let
QHZ%ODFN&RXQWU\&RPPXQLRQ VXEMHFWVXVLQJWKHZRUVW Elitism in rock… “My Brian [Johnson] write the lyrics.
album BCCIV$QG,ORYHWKH language in the happiest kind of genre is cooler than Nothing against the stuff they’ve
new Prophets Of Rage album your genre.” done recently but it hasn’t got the
ZD\PDNLQJLWVHHPVRQDWXUDO
Ħ8QIXFN7KH:RUOGLVP\ ,W¶VKDUGWRNHHSDVWUDLJKWIDFH Bohemian f**king swagger of these songs. My mum
DQWKHPRIWKHVXPPHU Rhapsody. As soon used to work near the local Our
EXWKH¶VDOZD\VJUHDWIXQ
as I hear “Is this the Price so I gave her my five quid and
My favourite Black Sabbath real life?” off goes she went in there and bought Blow
memory Seeing them at the H EAR TH E GANG AN D A the radio. Up Your Video on its day of release
W H O L E L OT M O R E :
2$FDGHP\LQ%LUPLQJKDP People at festivals like [January 18, 1988] in her lunch
Tune in to Planet Rock Radio, hour and brought it home. That night
EDFNLQ,WZDVDJUHDW say Ramblin’ Man Fair
DYDLODEOHYLD'$%RQOLQHīYLD being seated in their I played it in full to my parents on
VKRZ2QDQRWKHURFFDVLRQ
KWWSZZZSODQHWURFNFRPOLYHĬ picnic chairs. What their stereo downstairs much to their
7RQ\,RPPLFRQYLQFHGPHWKDW RQ79YLD6N\īFKDQQHOĬ about dancing, people? delight. I think it was a bit louder than
P\UHFRUGLQJGHYLFHKDGQ¶W 9LUJLQ0HGLDīFKDQQHOĬ
Demos as CD ‘bonus’ the Jack Jones albums my mum
UHFRUGHGWKHLQWHUYLHZ,KDG )UHHVDWīFKDQQHOĬRURQ\RXU
tracks. was used to! My favourite song was
just done with him. After a mobile via the Planet Rock app. That’s The Way I Wanna Rock’n’Roll.
VZHDW\WULSEDFNWR3ODQHW VISIT: Metallica covering
The tour accompanying the album
W W W. P L A N E T R O C K . C O M other band’s songs.
5RFN,GLVFRYHUHGLWZDVLQWDFW F O R M O R E I N F O R M AT I O N was also the first-ever gig I went to,
Guys, don’t do it, they
:KDWDMRNHU always sound terrible! at Wembley Arena
[in March 1988]
Men in Lycra pants. when AC/DC
No, just, no!
were supported
by Dokken. A
Thanks for the rants to great gig and it
Planet Rock listeners made them a firm
Jen Roper, Sarah favourite in my
5HHYH&UD]\%LUG record collection
Drew Coull, Helen ever since.”
S, Stuart Taylor,
Morgan Mason, Jason
Pearson, Mark Adlam, Hear T H U N D E R frontman
Andrew Farnell and DA N N Y B OW E S on P L A N E T
-RQDWKDQ.DUGDV] R O C K HYHU\6XQGD\IURPĦSP

Mail us at M A I L @ Or the repeat on Thursday from


PLAN ETROCK.COM
ĦSP(DFKZHHNKHEULQJV\RX
Iron men: Tony a P OCKET M ON EY PICK.
Iommi and or commune via Twitter
Darren Redick. via # R O O M 6 6 6

PLANET ROCK 25
Upfront

LETTERS

IT’S ALL WRITE!


YO U R L E T T E R S P R I N T E D ! I N C LU D E S YO U R T H O U G H T S O N T H E P U N K WA R S ,
DAVE BROCK’S VEGANISM AND FRANCIS ROSSI’S “SHIT”…

Lemmy and
I’M A ROCK’N’ROLL SOLDIER John Lydon:
a beef-free

FIRST-CLASS MAIL I have a comment to make about your editorial approach in


the last two issues. With both the Motörhead and Queen cover
bromance.

stories there seems to have been this sense that hard rock bands were somehow
battling the punks. As someone who was 15 in ’76/’77, I can tell you that that is not how
it felt at all. Maybe I’m the exception but, to me, punk was a continuation of that original
rock’n’roll spirit. I liked Motörhead as well as the Pistols, and The Damned were something
of a bridge between the two scenes. Listening to those records now, I feel that even more.
Never Mind The Bollocks is simply one of the greatest rock albums ever, up there with
Zeppelin’s first LP and Sabbath’s. And there’s no need to have a war about that, is there?
George Rogers, London

SORTING OUT not write about the peak of their Zep, Marillion, Rush, Aerosmith Most musicians probably just see that
WHAT’S TRUE career with the 1983 album Frontiers (again!), brilliant Queen main feature, feature as a bit of fun but Dave still
where Journey became megastars and – although I’m not a Quo fan managed to introduce the concept
There seems to be a misprint in your
but it was also the end of the classic – I did enjoy Mr Blake’s chat with of veganism into the piece which is
otherwise fine Issue 2. On page
line up of Neal Schon, Jonathan Francis [Rossi], who didn’t seem pretty good going. As a vegan myself,
42 (bottom right), Francis Rossi,
Cain, Steve Perry, Ross Valory and to mind chatting to him for longer I was glad to see him spread the
referring to your reporter’s question
Steve Smith? than allowed. Then there was a bit message. I was also touched to read
about “classic Quo albums, Piledriver,
Kaj Roth, Sweden of Saxon, a bit of Glenn Hughes, a his comments about Lemmy. Very
Hello!, Quo, Blue For You”, appears
Thanks, Kaj. Watch this space… bit of Judas Priest’s Rob, all in one humanising indeed.
to say, “I think there were moments
issue! Quirky regulars like Full Metal Sam Jones
of magic on them coupled with a lot
Jacket (if only I’d kept mine!), Nights
of shit.” This should surely read: “I WHAT CAN I DO Out With Alice, My Planet Rocks,
think there are moments of shit on MEET THE BOYS…
I have just bought Issue 2 of Planet Backstage all have the vibe of ‘Who
them, coupled with a lot of magic”? RE: Who The Hell Are These Guys?
Rock magazine, but was unable to will it be this month?’ anticipation.
He’s been playing songs from those [Issue 2] I remember Teeze from
find Issue 1. Can you please tell me So, in answer to your question:
albums and other ones from that era around 1985. I have the album on
how I can get one? “What would we like in this new
for the last 40-something years Roadrunner Records (somewhere!).
Steve Calder publication?” Well, more of the
as typically around half of Quo’s I think musically they were more Ratt
live set or more. He wouldn’t Sadly, Steve, yours is one of many same, please. Stories behind the
wannabes than Crüe. I don’t recall
deliberately serve us up shit, would letters we have had concerning albums, frank interviews like Rossi’s,
them ever playing in the UK. Some
he? Would he? Issue 1. Unfortunately, the print and those Upfront quirks like Ten
of the songs on the album were
Hattie Des Nimes, Midlands edition is sold out, though a digital Things…, Nights Out With, How I
OK such as Party Hardy and When
copy is available. Please download Wrote, etc. Personally, I’d love to see
The Moon Is Full. They eventually
the MOJO magazine app from the my favourite band Horslips featured.
I SIT HERE WAITING How about an interview or album
changed their name to Roughhouse,
Apple App store (iOS) or Google I believe, so maybe a full-blown rise
I am a huge fan of your great mag, I Play store (Android) and you can guide? So far, so good, PR mag!
bought the first two issues and love and fall of hair/glam metal feature is
download Planet Rock Issue 1 as Do keep it up, and don’t forget we on the way, yes?
them both. Planet Rock has started an in-app purchase. read (and listen!) to you over here in
like Godzilla entering this planet! Shaun Freeman, via email
Ireland, too…
Lots of interesting interviews and Martin Kilbride, Wexford
awesome articles so your mag is my WHAT A COMBINATION Congrats, Shaun. The band in
favourite one at the moment. I wish After a great first issue, I held my question are indeed Pennsylvanian
you would feature Journey or Steve breath taking home my copy of JUST LIKE THE HERO ’80s outfit Teeze. Hats off, too, to
Perry in the next issue. Journey Issue 2, and was wondering whether I would like to applaud Dave Brock Lauren Tilley, Danny Wyckaert,
were inducted into the Rock’n’Roll everything was going to be thrown for using the platform of your Grey Robinson, Richard Wesley
Hall of Fame this year and [former into the first issue to get us hooked, magazine to make a valid and serious and Jonathan James, who guessed
ALAMY

frontman] Steve Perry is making a and then it would thin out afterwards. point when he appeared in your correctly. Now check out this issue’s
solo comeback later this year. Why Well, how wrong wuz I? AC/DC, Rock’n’Roll Cookery slot in Issue 2. suspects on page 130…

26 PLANET ROCK
PLUS SPECIAL GUESTS

AND

Join My Live Nation for exclusive benefits. Go to livenation.co.uk/register


Upfront
FULL METAL JACKET
Planet Rock listeners show us their colours.
S L I P K N OT DAT E O F B I R T H : 1 9 8 1 R E BOR N: 2011
“I caught Slipknot at W H E R E F O U N D : Boyle, Ireland
Alexandra Palace last year.
³7KLVLVDQDPDOJDPDWLRQRIWZRMDFNHWVĦWKHRULJLQDOLV
It was so packed that I had
to change my headbanging
IURPDQGWKHQLWZDVXSGDWHGDERXWVL[\HDUVDJR´VD\V
stance that night and it RZQHU%ULDQ+LFNH\³$ORWRIWKHROGHUSDWFKHVOLNH6WDWXV
gave me health problems 4XRDQG$&'&DUHIURPZD\EDFNZKHQ0\GDGZDV
afterwards. I had to take DWDLORUDQGKHXVHGWRVWLWFKWKHPXSIRUPHDQGP\
two weeks off work!” EURWKHU:HWKRXJKWZHORRNHGVRFRROEHFDXVHZH
ZHUHWKHRQO\SHRSOHDURXQGZLWKGHQLP
MDFNHWVWKDWKDGSDWFKHVRQ´

WH ITE S NAKE S KAM


“I bought this “A trio from Leicester
Lovehunter patch that actually have
when I was 11 from two patches on this
Minstrel Music in my jacket – one of which
little town of Boyle on is the original logo
the west of Ireland. from when they were
I was wondering if called Skam# – and
I’d get away with the it’s another patch
naked woman, but that nobody else
my mum shouted has. I was talking
at my dad for to their singer/
stitching it on.” guitarist Steve Hill
at Glastonbudget
festival and he gave
me this patch for
my jacket.”

TH E AN SWE R
“I’ve seen The
Answer more than
any other band,
around 20 times.
I heard their song
D R EAM Come Follow
T H E AT E R Me in 2006 and
“For me, Dream wondered, Who
Theater’s The are these guys?
Count Of Tuscany The next year I
is the greatest saw them open
song of all time. for Aerosmith in
Seeing them play Hyde Park in the
it in full at High pouring rain, and
Voltage Festival knew they were a
2010 was probably band for me. I’ve
my best musical even met their
moment ever. I’ve mums now!”
all their albums,
MARCO VIT TUR

D I STU R B E D
and I’ve seen them
a good few times.” “I could have gone with AC/DC or Iron Maiden,
but I thought I’d get something no one else
has. Everyone bangs on about how good
Don’t be shy. Raid that wardrobe, cellar or
Disturbed’s cover of The Sound Of Silence is,
loft and email us a photo of your old colours
and it is good, but it’s their own stuff that I
to appear in the next issue of Planet Rock.
like most because it’s hard and heavy. David
Contact: mail@planetrock.com.
Draiman is a brilliant vocalist.”
28 P L A N E T R O C K
PLUS SPECIAL GUESTS

PLUS SPECIAL GUESTS

sold out
Upfront

JOE ELLIOTT

WHO:
IAN HUNTER
Joe Elliott, Ian Hunter WRSOD\DVRQJZLWKKLP:HGLG
&OHYHODQG5RFNVD6WHYLH9DQ=DQGW
WHERE: High Voltage Festival,
VRQJFDOOHG:KLOH<RX:HUH/RRNLQJ
Victoria Park, London
WHEN: July 25, 2010
At Me and All The Young Dudes,
probably, and that was when we IAN WAS
VZDSSHGSKRQHQXPEHUVSHUPDQHQWO\ HOLDING HIS
GUITAR LIKE
I F I R S T became I can’t remember how many times
aware of Mott The he’s dragged me on a stage since,
Hoople when I heard
their version of Crazy
EXWWKHUH¶VDVWRU\WRWKLVSKRWR
'RZQ¶Q¶2XW]ZHUHERRNHGWRSOD\WKH A BASEBALL
Horse’s Downtown on Radio ¿UVW+LJK9ROWDJHIHVWLYDODQGZH¶G
UHKHDUVHG¿YHVRQJVZLWK,DQ6RPH
BAT, READY
TO BATTER
Luxembourg, though that had
ĬJXLWDULVWĭ0LFN5DOSKVVLQJLQJ7KHQ 3$FRFNĥXSPHDQWZHKDGWRJRRQ

SOMEBODY.
,KHDUG2ULJLQDO0L[HGĥ8S.LGRQDQ ODWHDQG,DVNHGLIZH¶GQHHGWRGURS
Island Records sampler album, and a song or two, but I was told it was
7KXQGHUEXFN5DPRQWKHBumpers ¿QH6RZH¶UHKDOIZD\WKURXJK2QFH
compilation I bought second hand for Bitten… and a stage guy motions for
SLQ9LROHW0D\VLQ6KHɷHOG,ZDV XVWRVWRSDQGZH¶UHOLNH)XFNRɱ
DOZD\VJRLQJRQDERXW0RWWDWVFKRRO 7KHQZHVWDUWHGLQWR:KR'R
I N T E RV I E W : PAU L B R A N N I G A N P H O T O : G E T T Y I L L U S T R AT I O N S : C W B

Then they have a hit with All The You Love and they pulled the PA and
Young Dudes and they’re on Top Of WKHFUHZVWDUWHGWRZDONRQWRWKH
The Pops and there’s this guy with big VWDJH,DQZDVKROGLQJKLVJXLWDUOLNHD
hair and big shades and his mad guitar baseball bat, ready to batter
DQG,WKRXJKWKHZDVWKHFRROHVW somebody, and I was ready to ram my
,¿UVWPHW,DQRQ-XQH JXLWDUGRZQRQHJX\¶VIXFNLQJWKURDW
when Overnight Angels, the name of ,WZDVDIXOOĥRQEUDZO
his band touring his third solo album, -LPP\3DJHZDVLQRXUGUHVVLQJ
SOD\HGWKH'RQFDVWHU*DXPRQW$IWHU URRPDQGKHZDVRXWUDJHG,DQDQG,
WKHJLJPHDQGP\PDWHVMXVWZDONHG stayed in some hotel that night and
EDFNVWDJHDQGNQRFNHGRQWKH JRWDELWVKLWĥIDFHGGURZQLQJRXU
GUHVVLQJURRPGRRUĬ*XLWDULVWĭ(DUO VRUURZV+HORYHVKLVFKDPSDJQH,
6OLFNOHWXVLQDQG,JRWDSKRWRWDNHQ was with him on the last night of the
ZLWK,DQ,FDQ¶W¿QGWKDWSKRWRQRZ 0RWWUHXQLRQDQGOHIWDERXW
EXW,¶OODOZD\VKDYHWKHPHPRU\ DP,DQNHSWJRLQJ¶WLO
0\¿UVWSURSHUFRQYHUVDWLRQZLWK DP+H¶VLQGHIDWLJDEOH
KLPZDVLQZKHQ,VSRNHWRKLP DWKH¶VVWLOOJRWWKH
over the phone from Paris while we HQHUJ\RIDWHHQDJHU
ZHUHPDNLQJHysteria7KHQLQ
,DQZDVSOD\LQJ5RFN¶Q¶5ROO+HDYHQ Listen to J O E E L L I OT T on Planet Rock
5DGLRIURPSP6DWXUGD\VīUHSHDWHG7XHV
in Toronto on the same night that
SPĬN I G H TS W I T H A L I C E C O O P E R
Def Leppard were playing the LVRQ0RQGD\DWSPDQG7XHVĦ)ULSP
([KLELWLRQ6WDGLXPVRKHLQYLWHGPH

30 PLANET ROCK
All smiles: Elliott
and Hunter before
all hell broke loose...
Upfront

dancing in the dark? I’ve got a


tattoo of the artwork from Hot
Space on my hand, one face on
HDFK¿QJHU)UHGGLHLVRQP\
PLGGOH¿QJHU

4
10CC
Feel The Benefit
(on Deceptive Bends, 1977)
10cc were huge but not huge
enough. Maybe because they
did jokes, and because some of
WKHLUVWXɱLVDELWPXFKĦOLNH)HHO
Is it just him?: 7KH%HQH¿WZKLFKLVLQWKUHHSDUWV
The Darkness, over 11 minutes. It’s fucking brilliant.
with Justin
Hawkins (left).
,WVWDUWVRɱZLWKDVLOO\LGHDDQGHQGV
up sublime, really massive and
pompous with a beautiful string

Six songs to... arrangement. By the end the lyrics


DUHDERXWIHHOLQJWKHEHQH¿WRI

LISTEN TO
everybody singing together in the
name of humanity. It’s like, fucking
KHOOĦZKHUHGLGWKDWFRPHIURP"

5
JIM STEINMAN

IN THE DARK
I’VE GOT
The Storm
(on Bad For Good, 1981)

FREDDIE The Storm is an instrumental piece


and for years I’ve wanted it to be
MERCURY WKHZDONĥRQPXVLFIRU7KH'DUNQHVV

TATTOOED ON
It invokes the power of the storm,
and what better way to spend a night

Justin Hawkins of The Darkness


something that other people don’t. MY MIDDLE than to listen to a storm as interpretĥ
ed by an orchestra which has Jim
on “peacocking”, the joys of
That might be because it comes from
that era of Deep Purple that is a little FINGER Steinman presumably waving his
arms about conducting it? I love the
Queen’s “shittiest” LP and “mad overlooked, when they had David man. He’s obviously as
as a box of beaks” producers. Coverdale and Glenn Hughes singing. mad as a box of beaks.
Lots of people say, “I liked that band In a good way.

1
before they were famous.” No one

6
ELTON JOHN ever says, “I liked them after they BILLY
Madman Across The Water were famous.” But that’s sort of what SQUIER
(on Madman Across The Water, 1971) I’m saying here. Listening to Sail Emotions In Motion
This song has a brilliant orchestral Away makes me feel special, and I (on Emotions In Motion, 1982)
arrangement by Paul Buckmaster, think it will make you feel special too )UHGGLH0HUFXU\DQG
ZKHUHYLROLQVDUHSOD\LQJVWXɱWKDW if you listen to it in the dark. Roger Taylor sing on

3
you would expect a guitarist to do. It’s this song. Billy Squier PHOTO: ALAMY
really startling and a bit scary. The QUEEN is a great guitar player
idea with all the songs I’ve chosen is Dancer
and I really admire his songwriting.
that they are so detailed and luxurious (on Hot Space, 1982)
2QKLVHDUO\DOEXPVĦThe Tale Of The
that you get more out of them I love Hot Space and I get Tape and Don’t Say NoĦWKHUH¶VDORW
listening with your eyes closed. But a kick out of the fact that RI/HG=HSSHOLQVWXɱZLWKDKXJH
with this one you might open your everybody else hates it. It
I N T E RV I E W : PAU L E L L I O T T

drum sound. The track Emotions


eyes at the end and glance around might be Queen’s shittest In Motion was a departure from
the room anxiously, in case there is work, and even members KLPDQG,ORYHWKHIXQN\ULɱ,W¶V
literally a madman who has come of the band dislike it, but a song for peacocking, preening
across the water to stab you. LW¶VVWLOODIXFNĥWRQEHWWHU and prancing.

2
than most of the shit
DEEP PURPLE that’s out today. My
Sail Sway favourite song is Pinewood Smile by T H E DA R K N E S S is
(on Burn, 1974) 'DQFHUĦZKR Let’s prance: released on October 6 via Cooking Vinyl.
This song makes me feel like I know doesn’t like Billy Squier
gets funky.

32 PLANET ROCK
S.J.M. CONCERTS PRESENTS

2017 UK TOUR
Plus guests FRI 29 SEPT SUN 08 OCT FRI 20 OCT
CARDIFF MILTON KEYNES THEATRE SOUTHEND
MOTORPOINT ARENA TUE 10 OCT CLIFFS PAVILION
SAT 30 SEPT SHEFFIELD CITY HALL SAT 21 OCT
BIRMINGHAM WED 11 OCT BOURNEMOUTH
BARCLAYCARD ARENA NOTTINGHAM INT. CENTRE
MON 02 OCT ROYAL CONCERT HALL
MON 23 OCT
20/09 Cardiff Tramshed 30/09 BIRMINGHAM 02 ACADEMY BRISTOL THU 12 OCT LEICESTER
Sticks & Stones / Not Without A Fight STICKS & STONES / SELF TITLED COLSTON HALL LEEDS FIRST DIRECT ARENA DE MONTFORT HALL
21/09 Oxford O2 Academy 02/10 LEEDS 02 ACADEMY TUE 03 OCT SAT 14 OCT TUE 24 OCT
Sticks & Stones / Self Titled STICKS & STONES / CATALYST PLYMOUTH PAVILIONS GLASGOW
THE SSE HYDRO PORTSMOUTH
22/09 Norwich UEA 03/10 NOTTINGHAM ROCK CITY WED 04 OCT
SUN 15 OCT
GUILDHALL
STICKS & STONES / CATALYST STICKS & STONES / SELF TITLED CAMBRIDGE
CORN EXCHANGE LIVERPOOL ECHO ARENA THU 26 OCT
23/09 London O2 Forum
STICKS & STONES / CATALYST 05/10 BRISTOL 02 ACADEMY MON 16 OCT GUILDFORD G LIVE
FRI 06 OCT
25/09 Portsmouth Pyramids STICKS & STONES / CATALYST
NEWCASTLE GRIMSBY AUDITORIUM FRI 27 OCT
Sticks & Stones / Not Without A Fight 06/10
sold out LONDON O2 FORUM CITY HALL WED 18 OCT BRIGHTON CENTRE
27/09 GLASGOW O2 ABC STICKS & STONES / SELF TITLED SAT 07 OCT IPSWICH REGENT SAT 28 OCT
STICKS & STONES / CATALYST 07/10
sold out LONDON ELECTRIC BALLROOM MANCHESTER THU 19 OCT LONDON
28/09 NEWCASTLE 02 ACADEMY CATALYST / NOT WITHOUT A FIGHT O2 APOLLO OXFORD NEW THEATRE EVENTIM APOLLO
Sticks & Stones / Self titled
08/10
sold out LONDON UNDERWORLD
29/09 MANCHESTER ACADEMY NOTHING GOLD CAN STAY / COMING HOME GIGSANDTOURS.COM TICKETMASTER.CO.UK
STICKS & STONES / CATALYST 0844 811 0051 0844 826 2826
VIP PACKAGES AVAILABLE FROM SJM-VIP.COM
TICKETS: GIGSANDTOURS.COM / TICKETMASTER.CO.UK
AN SJM CONCERTS, TRIPLE G, PVC, DHp & UEA PRESENTATION BY ARRANGEMENT WITH ITB PRESENTED BY SJM CONCERTS, LIVE NATION & AEG LIVE BY ARRANGEMENT WITH UNITED TALENT AGENCY

TICKETS ON SALE NOW

AN SJM CONCERTS, DF & MDDN PRESENTATION BY ARRANGEMENT WITH UNITED TALENT AGENCY

PLUS

MILK TEETH • NOTHING, NOWHERE

MON 27 NOV SOUTHAMPTON 02 GUILDHALL


TUE 28
SO LD OU T NOV NOTTINGHAM ROCK CITY
THU 30 NOV GLASGOW BARROWLAND
FRI 01 DEC BIRMINGHAM 02 ACADEMY
SAT 02
SO LD OU T DEC MANCHESTER ACADEMY
SUN 03 DEC LONDON 02 ACADEMY BRIXTON
GOODCHARLOTTE.COM
Upfront

Things
7KH6WDUVKLSĦDQGWKHVKHQDQLJDQV accessed via a comple system of guest
WKHUHLQERWKUHDODQGLPDJLQHGĦVWLOO lists, wristbands and laminate passes
represents everything tremendous that even immediate blood relatives

you’ve always DERXWWKHH[FHVVHVRI¶VURFN%XW


seeing as how this brand of decadence
IZZY must obey.

wondered went out with Quaaludes, is it actually STRADLIN I WA S DɱRUGHGDEULHIZKLUOLQWKLV

WAS ONCE
necessary for bands to still tour by VIP ionosphere when I joined Iron
private jet? 0DLGHQIRUDFRXSOHRIOHJVĦ&RVWD
about... 7KHUHLVĦDQGDOZD\VZDVĦVROLG
ARRESTED FOR Rica to Colombia, then on to Brazil

DO BANDS
¿QDQFLDOVHQVHEHKLQGJRLQJSULYDWH ĦRIWKHLU6RPHZKHUH%DFN,Q
with the aeronautical side of touring. URINATING Time tour. For these shows, singer

IN THE GALLEY
Metallica, for instance, will set up base Bruce Dickinson was undertaking pilot
LQRQHμKXE¶FLW\DQGÀ\WRYHQXHV duties aboard Ed Force One, the band’s
within range, only moving HQ when
absolutely necessary. That means less ON A FLIGHT. Boeing 757. Travelling with their road
FUHZĪVDWDSDUWIURPWKHEDQGīDQG

REALLY NEED
IDɷQJDURXQGZLWKKRWHOVDQGDJUHDWHU equipment, Maiden had created a
number of concerts within the time touring operation that was entirely
available. So more money. VHOIĥFRQWDLQHGIRUPD[LPXPHɷFLHQF\
Way before Led Zeppelin, the Dave Emblazoned with the band’s logo and
&ODUN)LYHZHUHWKH¿UVW%ULWLVKJURXS imagery, the aircraft caused a stir with

PRIVATE
WRUHDOLVHWKHHFRQRPLFEHQH¿WVRI the hundreds of people waiting for a
having their own plane, known as the glimpse of their heroes when we
DC5, which they hired from the touched down at Bogota’s El Dorado
5RFNHIHOOHUVLQWKHHDUO\¶V7KHUH airport. On the inside the plane was
have since been some notably less comfortable but by no means opulent.

JETS?
KDUGĥQRVHGXVHUVRIWKHMHWDVSHUVRQDO Given manager Rod Smallwood’s
FKDULRW'RQ+HQOH\ZRXOGÀ\LQ6WHYLH UHSXWDWLRQIRUEHLQJH[WUDRUGLQDULO\
Nicks to visit him while the Eagles and frugal, it was a pleasant surprise to
Fleetwood Mac were both on tour ¿QGWKDWGULQNVZHUHDYDLODEOHZLWKRXW
under a policy the couple dubbed money changing hands.
“Love ’em and Lear ’em”. So does anyone really need to tour
by private jet? Well, given that rock
OTHER FACTORS play their part advocates a philosophy of total
too. Disconcertingly for a highly freedom, the problem with commercial
High-flier Ben Mitchell discovers
VXFFHVVIXOEDQGRQDVFKHGXOHGÀLJKW DLUWUDYHOLVWKDWLWRɱHUVWKHOHDVW
that luxury air travel is about there is no special treatment beyond liberal environment imaginable. Little
far more than tour logistics and WKHXVXDOSHUNVRI¿UVWĥFODVVWUDYHO<HV wonder, then, that once in transit,
unlimited complimentary scones. the stewardess will happily slip the EDQGVVRRIWHQ¿QGWKHPVHOYHV
GUXPPHUDQH[WUDPLQLDWXUHRI squaring up against that oldest of
Going To
Calvados and bag of pretzels but this enemies The Man.
O N J U LY 24, 1973, ahead of playing California?:
FRXUWHV\ZLOODOVREHH[WHQGHGWRDQ\ Led Zep with their Particularly egregious incidents
a show at the Three Rivers Stadium in Tom, Dick and Harry who’s coughed big boys’ toy. include Guns N’Roses guitarist Izzy
Pittsburgh, the members of Led up for a seat at the front. Stradlin being arrested
Zeppelin posed for photographer Bob Having totally nailed the for urinating in the galley
Gruen on the tarmac at New Jersey’s keyboard parts on Mr. RQDÀLJKWWR/RV
Teterboro Airport. Though there is Roboto holds no value Angeles, and Liam
nothing remarkable about the band’s here. Gallagher receiving a life
DSSHDUDQFHĪEDUULQJWKHRSHQVKLUW To the cabin crew, EDQIURP&DWKD\3DFL¿F
I L L U S T R AT I O N : PA N I K

PLFURĥSDXQFKORRNVSRUWHGE\-RKQ famous musicians are no for becoming unruly after


3DXO-RQHVīWKLVLVZLWKRXWGRXEWWKH better than the other he didn’t receive a
most famous picture ever taken of the passengers and will be complimentary scone.
quartet. It is the backdrop that catches seated among same. Such Only in the private jet
WKHH\HĦDOHDVHG%RHLQJZLWKWKH egalitarianism holds can these nonconformist
group’s name stencilled above the door. further horrors, such as a creative types casually
This is The Starship, a customised fan having the temerity relieve themselves and
aircraft equipped with bar, electric to attempt polite gorge delicious baked
PHOTO: WENN

organ and shower room. Other clients conversation or ask to goods without censure.
RIWKLVÀ\LQJIXQKRXVHLQFOXGHG$OLFH borrow a pen. It’s all Plus, you get to have your
Cooper, Elton John, The Rolling entirely unacceptable to band’s name painted on
Stones and Peter Frampton. Though it the sort of individuals the fuselage. Just like Led
was scrapped for parts 35 years ago, who are typically Zeppelin did.

34 PLANET ROCK
Upfront
MY GUIDE TO LIFE

MICHAEL SCHENKER
Follow your dreams
T H E M A D A X E M A N O N T U R N I N G D O W N O Z Z Y, M A K I N G H I S B R O T H E R C R Y
AND FINDING PEACE OF MIND. HERE ARE HIS ESSENTIAL LIFE LESSONS…

I always knew I had to go to England


Be your own boss
$IWHU,SOD\HGRQLovedrive I had
Don’t waste a single day
,UHDOLVHGLQWKHHDUO\¶VWKDWLI,
WRIXO¿OP\GHVWLQ\:KHQ6FRUSLRQV 5XGROIRQWKHWHOHSKRQHFU\LQJDQG GHYRWHVRPHWLPHHYHU\GD\WRWKH
ZHUHWRXULQJLonesome CrowLQ
*HUPDQ\WKHDXGLHQFHKDGQRFOXH
I ENDED UP EHJJLQJPHWRVWD\LQWKHEDQG%XW,
KDGWRJHWDZD\DQGGRP\RZQWKLQJ
WZRWKLQJV,YDOXHPRVWWKHQ,ZRXOG
PRYHIRUZDUGLQDYHU\FRQVLVWHQW
ZKDW,ZDVGRLQJDQG,NQHZ,KDGWR WITH THREE ,FRXOGQ¶WKDYHIXO¿OOHGP\RZQ ZD\7KDWPDGHPHSURJUHVVRQDGDLO\
EDVLV$IWHUWKDW\RXFDQGRZKDWHYHU
HOUSES, LAND
JRZKHUHWKLVPXVLFFDPHIURP,VDLG YLVLRQKDG,DFFHSWHGWKDWRɱHURU
WRP\EURWKHUĬ6FRUSLRQV¶UK\WKP WKHLQYLWHVIURP2]]\2VERXUQHRU \RXZDQWWRGREHFDXVH\RX¶YHWDNHQ

IN HAWAII
JXLWDULVW5XGROI6FKHQNHUĭ³,IDQ 'HHS3XUSOHRU:KLWHVQDNHRU3KLO FDUHRIWKHLPSRUWDQWWKLQJV
(QJOLVKEDQGDVNVPHWRMRLQ,ZLOOGR /\QRWW,WZDVIXQWREHIUHH7KRVH
LWLPPHGLDWHO\´,GLGQ¶WMRLQ8)2
EHFDXVHWKH\ZHUH8)2,MRLQHG AND MY OWN ZHUHP\8QLYHUVLW\RI/LIH\HDUV Don’t compete, just enjoy
Ĭ0HWDOOLFDJXLWDULVWĭ.LUN+DPPHWW
WKHPEHFDXVHWKH\ZHUH(QJOLVK LABEL… Ignore the rules of the game
:LWK8)2,KDGLWDOODQGWKHQWKH
RQFHDVNHGPH³+RZGLG\RXFRPH
XSZLWKDOOWKRVHLGHDV"´DQG,VDLG³,
Success is the enemy of freedom 8QLYHUVHVSRNHDQGVDLG³2. GRQ¶WNQRZ,MXVWKDGIXQ´:KHQ,
:KHQLights OutEHFDPHDKLWĬLQ 0LFKDHOQRZ\RXNQRZZKDWLW¶VOLNH ZDV,VWRSSHGOLVWHQLQJWRPXVLF
ĭ,JRWVFDUHG,IHOWOLNH³2K WREHXSWKHUHZKDWQRZ"´,GLGQ¶W ĦP\LQWHUHVWZDVWRFUHDWHQRW
VKLWQRZLW¶VH[SHFWHGRIPHWRFRPH UXQIRUWKHPRQH\RUWKHVXFFHVVRU FRQVXPH,QHYHUVDZP\VHOILQ
XSZLWKWKHJRRGV´7KDW¶VZKHQWKH WKHIDVWODQH,FKRVHIUHHGRP,KDYH FRPSHWLWLRQZLWKDQ\RQH<HW,
IXQVWRSSHG7KHHQGFDPHZKHQZH DUHSXWDWLRQIRUEHLQJGLɷFXOWEXW SUREDEO\KDYHPRUHSODWLQXPDOEXPV
ZHUHPL[LQJĬOLYHDOEXPĭ LW¶VMXVWWKDWWKHPXVLFLQGXVWU\ WKDQDQ\RQHDVP\SOD\LQJVW\OHLVRQ
Strangers In The Night:HZHUH GRHVQ¶WNQRZZKDWWRGRZLWKSHRSOH VRPDQ\RWKHUJXLWDULVW¶VUHFRUGV
SLFNLQJWKHEHVWSHUIRUPDQFHVIURP ZKRZRQ¶WSOD\WKHLUJDPHV
WZRGLɱHUHQWFRQFHUWVEXWZKHQLW Acknowledge your Creator
FDPHWR5RFN%RWWRPWKH\FKRVHWKH Crisis can be a great teacher ,EHOLHYHLQD&UHDWRU,SRSSHGRXW
,KDGDPRPHQWRIFODULW\LQWKHHDUO\ RQWKLVSODQHWDQGRQHGD\,¶OOKDYHWR

PHOTO: ROSS HALFIN


YHUVLRQ,GLGQ¶WOLNHHYHQWKRXJKLW
ZDVP\VRQJ,WKRXJKW³7KHVH ¶V,ZDVLQDOLPRDQGWKHGULYHU JRZLWKWKDWGD\SUREDEO\QRWEHLQJ
SHRSOHGRQ¶WJLYHDVKLWDERXWPH´6R VDLGWRPH³0LFKDHOGR\RXNQRZ RIP\FKRRVLQJ,DOZD\VKDGWKHLGHD
3KLO0RJJĬ8)2IURQWPDQĭSXQFKHG WKDW\RX¶UHEHLQJULSSHGRɱOHIW WKDWWKHUHPXVWEHVRPHWKLQJEH\RQG
PHDQGLWZDVWLPHWRJR DQGULJKW"´$QGKHZDVULJKW6R
,GLVFRQQHFWHGIURPHYHU\ERG\ Live your own life
Fame is a fool’s game ,ZURWHWKHThank YouDOEXPĬLQ 7KH¿UVWVRQJ,HYHUZURWHDOWKRXJK
3OD\LQJJXLWDUIRUPHZDVDOZD\VSXUH ĭZKLFKZDVDFRXVWLF LWZDVFUHGLWHGWRDOOWKH6FRUSLRQV
MR\5XGROIKRZHYHUDOZD\VZDQWHGWR LQVWUXPHQWDOVWRVD\WKDQN ZDV,Q6HDUFK2I7KH3HDFH2I0LQG
I N T E RV I E W : PAU L B R A N N I G A N

EHULFKDQGIDPRXVĦKH¶VDOZD\VEHHQ \RXWRP\IDQV0\PRWLYDĥ DQGDOOWKHVH\HDUVODWHU,FDQVHHWKDW


DEXVLQHVVPDQLQPXVLFLDQ¶VFORWKLQJ WLRQZDVWRVHOOHQRXJKVR WKDWLVZKDW,¿QDOO\IRXQG$VPXFK
7KH8QLYHUVHRUGHUVWKLQJV,GRQ¶W WKDW,¶GKDYHDURRIRYHU DV,FDQJLYHDGYLFHHYHU\RQHKDVWR
WKLQNLW¶VDFRLQFLGHQFHWKDWRQFH, P\KHDGEXWLWPDGHPH ¿QGWKHLURZQZD\LQOLIH<RXFDQ¶W
VWHSSHGDZD\IURP8)2DQGWKDW DULFKPDQ,HQGHGXS WHOOVRPHRQHZKDWVDOWWDVWHVOLNH
XQOHVV\RXKDYHWDVWHGVDOW\RXUVHOI
URFNVWDUOLIH,ZURWHWKHLovedrive ZLWKWKUHHKRXVHVODQG
DOEXPIRU6FRUSLRQVDQGVHQW LQ+DZDLLDUHFRUGLQJ
M ICHAE L SCH E N KE R FEST
KLPRQKLVZD\GRZQWKHSDWK,KDG VWXGLRDQGP\RZQ
tours the UK in November.
DEDQGRQHG,¶PQRWVXUHKH¶VHYHU ODEHOMXVWIURPWKDW See www.michaelschenkerhimself.com
EHHQWUXO\KDSS\VLQFH RQHDOEXP
Some neck:
36 PLANET ROCK Schenker today.
Don’t mention the war:
Schenker at manager
Peter Mensch’s Earl’s
Court home, 1980.
Upfront
Back in Black: Glenn
Hughes (left) and Joe
Bonamassa.
Born Again
ON PLANET ROCK
Listen in for the story behind
Black Country Communion’s
Lazarus-style return.

F E W WO U L D have predicted the return


of Black Country Communion in 2017. After
UHOHDVLQJWKUHHZHOOĥUHFHLYHGDOEXPVWKH/$
VXSHUJURXSĦYRFDOLVWEDVVLVW*OHQQ+XJKHV
JXLWDULVW-RH%RQDPDVVDNH\ERDUGLVW'HUHN
6KHULQLDQDQGGUXPPHU-DVRQ%RQKDPĦIHOO
DSDUWLQZLWK+XJKHVDFFXVLQJ%RQDPDVVD
RIQRWEHLQJIXOO\FRPPLWWHGWRWKHSURMHFW
$V+XJKHVWHOOV3ODQHW5RFN¶V/L]%DUQHVLQ
D%&&VSHFLDOWREHEURDGFDVWLQ6HSWHPEHUD
rapprochement with the man he calls “the
JUHDWHVWJXLWDULVWRIKLVJHQHUDWLRQ´EHJDQODVW
year after Bonamassa phoned to congratulate
+XJKHVRQKLVLQGXFWLRQĪZLWK'HHS3XUSOHī
LQWRWKH5RFN¶Q¶5ROO
+DOORI)DPH
“I BELIEVE IN The two men got
KARMA AND WRJHWKHUDW+XJKHV¶
FATE. THIS IS /$KRPHLQ2FWREHU
A BAND THAT and wrote 18 songs in
11 days in the “magic
WAS MEANT
URRP´ZKHUH%&&¶V
TO BE.”
VHOIĥWLWOHGDOEXPZDV
created in 2010.
³,NQHZE\VRQJQXPEHUWKUHHWKDWZHZHUH
RQWRVRPHWKLQJ´VD\V+XJKHV7KHJURXS¶V
IRXUWKDOEXPBCCIVZDVUHFRUGHGE\.HYLQ
6KLUOH\DW/$¶V&DYH6WXGLRVLQ'HFHPEHUDQG
+XJKHVGHFODUHVKLPVHOI³YHU\H[FLWHG´ZLWK
WKHUHVXOWVĪVHHUHYLHZSDJHī
³,EHOLHYHLQNDUPDDQGIDWH´KHVD\V³7KLV
LVDEDQGWKDWZDVPHDQWWREH
7XQHLQWR3ODQHW5RFN5DGLRLQ6HSWHPEHU
to hear more…

Listen to the B L AC K C O U N T RY C O M M U N I O N
special on P L A N E T R O C K Radio in September.
CHRISTIE GOODWIN, PETER NOBLE

PLANET ROCK 39
Close to the edge:
Rick Wakeman,
April 9, 1975.
THE
PLANET
ROCK
INTERVIEW
HE’S RECORDED OVER 100 SOLO ALBUMS AND
HAS A CV FEATURING EVERYONE FROM YES
TO DAVID BOWIE AND BL ACK SABBATH. YET
PROG WIZARD RICK WAKEMAN ’S APPETITE
FOR BOTH MISCHIEF AND MUSIC ENDURES…
I N T E R V I E W BY MIKE BARNES. P O R T R A I T BY MICHAEL PUTLAND

R ICHAR D
CH R ISTOPH E R
WAKE MAN
BOR N
May 18, 1949
London
OCCU PATION
Keyboardist
songwriter
TV/radio presenter
author
YEAR S ACTIVE
1969-present
ASSOCIATE D ACTS
Yes, Strawbs
David Bowie
Black Sabbath
GETTY

PLANET ROCK 41
NINE
Synths and
legends:
(clockwise from
top left) Rick with
Strawbs, 1970;
O’CLOCK IN THE MORNING DOES SEEM AN You worked as a
recording Fragile
unusually early time to interview a rock musician, but then session player from with Yes, 1971;
1969. What was it like ’74’s Journey To
Rick Wakeman is an extremely busy man. He has just got
working in the world The Centre Of
back from his Piano Portraits tour of Italy and is due to go The Earth; Life On
of the stars?
out on the road again in a couple of weeks, this time for Mars; Wakeman’s
I suppose the people
almost two months in North America with Yes Featuring English Rock
who were big stars were Ensemble; circa
Jon Anderson, Trevor Rabin, Rick Wakeman.
your Cilla Blacks and ’72; Rick with
“It’s unbelievable,” he says of his punishing schedule. people who’d had hits, keys, 1984; as Thor
“I’m going to bed later and later, and getting up earlier and and they were always in Ken Russell’s
earlier, just to get things done. I’m not complaining, but really nice. There was an Lisztomania, 1975.
I thought that as you got older things quietened down.” element of doing your
As if to prove his point, 30 minutes into our interview job, but you always wanted to impress because that’s
Wakeman has to excuse himself to open up his Norfolk how you got your next job. People like David Bowie,
studio, as engineer Erik Jordan arrives to help record some I’d worked with him since Space Oddity, which was
radio idents for America. his first hit, so I was watching him become huge.
%DFNLQWKH¶VμNH\ERDUGZL]DUG¶ZDVDWHUPUHVHUYHGIRUSURJUHVVLYHURFN¶V¿QHVWDQGPRVW So you weren’t starstruck?
ÀDPER\DQWLYRU\WLFNOHUVEXW5LFN:DNHPDQUHOLVKHGORRNLQJWKHSDUWWRRVRPHWLPHVZHDULQJ I never went into a session thinking, “Oh my God, I’m
DSRLQWHGKDWWRDFFRPSDQ\KLVWUDGHPDUNFDSH$VZHOODVKLVRQĥRɱSHULRGVLQSURJRYHUORUGV going to meet so and so”, because I’d known a lot of
Yes, his baroque playing has graced a staggering 100 solo albums, ranging from the proggest these people before they had become stars, like
of the prog, to Christian albums and ambient music. Nobody can ever accuse this giant of the Marc Bolan. So there was an element of growing up
keyboards of being a slacker. with them. But I think the one thing I learnt is that if
:DNHPDQ LV DOVR D ZHOOĥNQRZQ SURIHVVLRQDO UDFRQWHXU ZKRVH GUROO ZLW DQG IXQG RI VWRULHV you contributed to whatever they were doing, and did
what they were after and more, you were treated
have featured on radio and TV, most notably BBC2’s Grumpy Old Men, though he’s also
almost as an equal.
appeared on Countdown, Antiques Inspectors and more. He is also the author of three entertainĥ
LQJERRNVĦDQDXWRELRJUDSK\DQGWZRIXUWKHUPHPRLUV How did David Bowie’s Space Oddity session
During our interview, he’s characteristically aware of life’s absurdities and potential for come about?
humour, but he is also a thoughtful conversationalist. At the start he notes that I could probably I’d done a session in 1969 for Tony Visconti with a
¿QGDOOWKHQHFHVVDU\LQIRUPDWLRQRQKLVZRQGHUIXOO\GHWDLOHGZHEVLWHEXW³SHUKDSVZHPLJKWJHW band called Junior’s Eyes, who had made a fabulous
album called Battersea Power Station – which is well
LQWRDUHDVWKDWFRXOGDGGWRLWDOO´&OHDUO\DPDQZKRHQMR\VDFKDWDVVRRQDVWKH¿UVWTXHVWLRQ
worth a listen – and the studio had a mellotron that
is asked he is engaged and completely focused. had just arrived and everybody was having a night-
mare trying to get it in tune. I played around with it for
about an hour and found a crafty way of keeping it
What music heard when you were young has although we had a good guitarist, Alan Leander. It in tune. I was working at the Top Rank Ballroom at
had the biggest impact on you? was all 12-bar blues, Chuck Berry, Bo Diddley and Reading in a big 17-piece soul band, and at
It would be the music that my dad played to me on that kind of thing – anything that had three chords, rehearsal I got a call from Tony. He said, “I’m in the
the piano. He used to have a concert party with my basically. We only had one amp, a Vortexion, and studio with David Bowie, we’re recording a piece,
mum and a couple of uncles and aunts. They all there was only one input that worked. It we’ve got a mellotron, no one can keep
played in our tiny front room and I thought that was was Alan’s amp and so he was the only it in tune, can you get up here quick?”
magic. As I got a bit older my father took me to one who was heard. The drummer had a
How did it get from there to
concerts. When I was eight years old, he took me to Gigster drum kit that he bought from
playing piano on Hunky Dory?
see Lonnie Donegan. Skiffle influenced so many Woolworths for 40 quid, but his main
rock musicians who lived through that era. I’d love to asset was that he owned a Bedford van. I drove from Reading to London, went
see it come back. Maybe I should form a skiffle band. I remember the piano at Neasden was a into Trident studios and did the
semitone flat. They were all playing in E, mellotron parts on Space Oddity, and
You took organ lessons in 1962 and taught at
I was playing in E flat, but it didn’t really afterwards David said, “Tony tells me
a Sunday school in 1967, so I assume the
matter because you couldn’t hear me RONNIE SMITH that you play a mean piano, would you
church was a big influence.
anyway. The Ronnie Smith Big like to do some piano stuff with me?” I
With church music I think it was the big sounds that Band were the resident said, “Yeah I’d love to.” We did Wild Eyed
affected prog rock keyboard players like me – we What did the Neasden Mental dance band at the Top Boy From Freecloud and Memory Of A
liked the pomp and the grandeur. The Sunday school Rehabilitation Club do, exactly? Hat in Littlehampton
Free Festival a few weeks later, among
teaching was hilarious. “Taught” is the wrong word. I from 1952 and at
It was a social club for kids with Down’s other things. Space Oddity was a big hit
had the nine-to-12-year-olds and I was only 17. The Watford’s Top Rank
syndrome. When you look back, thank and David called me and said, “I want to
book that you were supposed to teach them from Ballroom in the 1960s.
goodness that things have changed, as Wakeman was sacked play some you some new songs”, and it
was just rubbish, really naff, so I ignored it totally. We
Down’s syndrome kids tended to be twice: first for not was Hunky Dory.
used to have chats instead, so I’d often get bollocked
locked away. I actually learnt so much taking dance music
by the superintendent. I used to pick them up in my In 1970 you joined the Strawbs.
from these kids and I had great fun with seriously, then later for
ALAMY, GETTY, REX

Vauxhall Victor Estate. They were all crammed in the What did you learn from that
them. I was only young myself and they asking for a pay raise.
back, and if it was a nice day we’d go up the park – experience?
you wouldn’t be able to do it these days. were absolutely brilliant. Next year I’m
going to bring the Atlantic Blues back to life, with a I learnt a lot from the Strawbs. One thing about that
Your first group, Atlantic Blues, had a band called the Earl Grey Band who do a lot of fan- sort of folk and how we turned it into folk rock was
residency at Neasden Mental Rehabilitation tastic rock’n’roll stuff. We are going to do a concert how important melody was and how a lot of Dave
Club. Can you set the scene? and recording specifically for Down’s syndrome. Cousins’ songs were telling stories to music, which
I remember it really well. I was 13 or 14 and, to put it So Atlantic Blues will finally, after its last official I really liked. The Man Who Called Himself Jesus is
bluntly, we were pretty bad. Very bad, actually, performance in around 1964, be reborn in 2018. a poetic work of art. I was with them for a year

42 PLANET ROCK
and three months, although I had worked with covered everything, and see it in the UK, I just think it

“DAVID BOWIE SAID,


them doing sessions for a year before. But it seemed would be tremendous. Yes, I’m proud to be in it, but to
much longer as we did two albums [1970’s Just A put it bluntly it’s the American Hall Of Fame.

‘I HEAR YOU PLAY


Collection Of Antiques And Curios and ’71’s From
Back in the ’70s you were friends with Keith
The Witchwood] and toured all over the place, and
Emerson. As well as the camaraderie, was

A MEAN PIANO’…”
changed it from an all-acoustic folk band into one of
there any rivalry between you?
the first folk rock bands.
No. The music press used to make it out as rivalry,
You were asked to join both Yes and Bowie’s which we loved because it just meant that we got
Spiders From Mars on the same day in 1971. more press, and often they just used to write total
You have said that Life On Mars is the great- crap. Keith would phone me and say, “Have you seen
est song on which you ever had the privilege Close To The Edge was created, I say have a listen to what they have just written?” We were so different in
to play. Given that, have you ever had regrets Fragile because that will give you most of the clues. terms of playing. Keith was very jazz influenced and
about joining Yes? that was one of his great loves. I’m not a jazzer what-
There is the infamous story of you eating a
None whatsoever. David said later, “You made abso- curry on-stage with Yes and you were sacked soever. I was more classical and more into a mixture
lutely the right choice.” If I’d joined Spiders From Mars from The Ronnie Smith Band in 1968 for not of keyboards; Keith was very much organ, piano and
I’d have been playing David’s music, which I love, but taking the music seriously enough. You also synth, which he did brilliantly. He had a unique style.
there’d be a ceiling of how much I could contribute, mimed playing the organ with a paint roller He once said, “The perfect keyboard player is Rick’s
whereas if you are part of a band, there is no ceiling. with The Strawbs on Top Of The Pops in 1971 right hand and my left hand.”
playing Hangman And The Papist. Would you Your first solo album was The Six Wives Of
What was the band dynamic when you joined
say there is some kind of a pattern there? Henry VIII in 1973. How did you arrive at that
Yes? Was it an open democracy?
Oh yes. I always went down that kind of route. I got concept?
Yes was one of those bands, and always will be,
sacked twice from Ronnie Smith’s band, once for I love storytelling. When my father took me to see
where different people will be in charge at different
climbing over his [Hammond] B3 organ, which is his Peter And The Wolf, I thought, “Here’s a story set to
times. The secret is, if someone is in charge because
pride and joy. The thing is, I take my music very music – how wonderful is that?” And that’s all I’ve
they can make it happen better than anybody else,
seriously, but when things start getting overall too ever wanted to do. I have a great love of history and
you let them get on with it. Occasionally, there were
serious I tend to go, “OK, time to be irreverent.” It’s read a lot about the wives. Somebody said to me,
two or three people at the same time who thought
called reality. When someone says, “I’ve got some- “We don’t get this. What is it? Is this bit when Cather-
they could do the same job, and that just ended in a
thing unbelievable here”, or a lyricist says the work ine Howard was young and is this the bit where she
row. But that’s what happens in all bands, really. Yes
they’ve done is the 21st century equivalent of got bumped off?” I said, “No, think surrealistically.
was democratic, but if it had been a government Shakespeare, out comes the paint roller. Think Dali, think Picasso, think cubism. Because
there would have been a lot more resignations.
Was playing on Sabbath Bloody Sabbath basically what I did is what these guys do.”
Speaking of which, you left on a couple during the sessions for Yes’s Tales From So the storytelling is conventional?
of occasions. Topographic Oceans at Willesden’s Morgan
It was never meant to be a depiction of their lives, but
Five times I left! Someone said it was bit like Richard Studios in 1973 a way of getting back to
every single bit of that album came from thoughts
Burton and Elizabeth Taylor – couldn’t live with them, reality?
of one of the wives, and sometimes for no apparent
couldn’t live without them. That’s fair. I Oh, it was. Playing on Sabbath Bloody reason. With Jane Seymour, it had to be a church
think the healthy thing for bands is if Sabbath and being with the guys was organ – I couldn’t get a church organ out of my head.
people go away and get experience brilliant for me. That was the period It would never have worked on something else.
working with other people and come when Yes was thinking that it was
back with new and fresh ideas. And I divine, almost, and it needed divine Your Art In Music Trilogy is being reissued.
think that a band that doesn’t change intervention. And that, for me, was going Can you give us some background on that?
their line-up whatsoever can get stale. over the road to Studio 4 and being with It was done in 1999 and it came about because I’d
There are a few exceptions to the rule, Sabbath. That was sanity. I loved them recorded the Aspirant… series (Suntrilogy 1-3,
SABBATH
bands like Zeppelin and The Who, BLOODY to bits and still do. 1991), which was meditational music and there was
although obviously, through deaths, they SABBATH an element of scientific writing in that. I made friends
had to move over to different areas. But Drinking pals with How does ...Topographic Oceans with a professor called Cary Cooper who is an
by choice, I think it’s healthy for people Sabbath, Wakeman sound to you today? American psychologist at Manchester University. He
to come and go. agreed to provide It was an important part of Yes’s history believed that there is a musical formula that has
Mini-Moog parts and there are some very good tunes on specific effects on people. I wasn’t 100 per cent
Fragile was the first Yes LP on on Sabbra Cadabra
it, but for me there is also a lot of pad- certain, but then lullabies send people to sleep and
which you played and was the in exchange for
beer while Yes ding. We were trying to make the pieces big triumphant drums and trumpets sent people into
group’s breakthrough album. Now
and Sabbath were fit one side and that’s a mistake. Before war. You have bagpipes to frighten the English, you
it seems a little overshadowed by
recording at Morgan that, a piece of music had always ended have all sorts of instruments and sounds and music
Close To The Edge. How do you
Studios in Willesden. up as long as it ended up as. “How long to do specific things.
rate it with hindsight?
is that? Six minutes? That’s OK.” We
In a strange way you are absolutely right. Fragile was Was the reaction what you expected?
didn’t try to add another 12. That was the problem –
the perfect forerunner to Close To The Edge. It taught we started to fit the format. But I can look back on it I put together some music and produced this series,
us a lot about each other, how we could work togeth- now with a smile. which we never advertised, but it sold 400,000
er, how we could play together and how we could copies by word-of-mouth. They were bought by
actually make something like Close To The Edge. We Yes have recently been inducted into the hospitals, they were used in hospices, by stressed
needed to learn about how we could put the music Rock’n’Roll Hall of Fame. How important is business men. I wanted to do some more, so I did the
together before we could get on to what was an epic. that to you? Art In Music Trilogy and The Natural World Trilogy. It
Fragile has some great tracks on it, like Roundabout, It’s important if you live in America. I don’t think wasn’t meant to be as scientific as the Aspirant…
which was a massive hit in America. South Side Of anyone else in the world gives a monkey’s toss, to be series but something that would put you in a relaxed
The Sky is another. If anybody wants to know how honest. I would love to see a Music Hall of Fame that mood for anything that you wanted to do.

44 PLANET ROCK
OUT THERE 6
RICK WAKEMAN
WHITE ROCK
(A&M, 1977)
Commissioned to accompany a documen-
tary of the 1976 Innsbruck Winter Olympics,
this lyrical set features Wakeman with
just drummer Tony Fernandez and a choir
for company. A recurrent theme is woven
Eight albums to investigate from Rick Wakeman’s prodigious catalogue.
through a series of appropriately chilly
atmospheric pieces and high-velocity
synth-slaloms.

7
RICK WAKEMAN
1984
(Charisma, 1981)
Wakeman meets Orwell with lyrics by
Tim Rice, a band and orchestra, and vocal
guest appearances by Jon Anderson,
Steve Harley and Chaka Khan. It feels
like the West End musical that never was.
On songs like Robot Man the slightly
alienating gloss of the ’80s production
feels oddly apt.

8
RICK WAKEMAN
PIANO PORTRAITS
Rick Wakeman (UMG, 2017)
performs on-stage
at an outdoor festival Inspired by the reaction to his solo ver-
in Lisbon, Portugal, sion of David Bowie’s Life On Mars on a
July 19, 1981. 2016 Radio 2 tribute, these
fantasias on favourites
from Debussy to Lennon

1
of six pithy, melodic & McCartney take us full
STRAWBS
cameos played with circle from 1970’s Tem-
JUST A COLLECTION wit and brio captured perament Of Mind, with
OF ANTIQUES AND the public’s imagina- a series of harmonically
CURIOS tion and ended up inventive and exquisitely
(A&M, 1970) going platinum. played variations.

4
Recorded live, this album broke the
Strawbs into the Top 30. In his first ‘proper’ RICK
band, the young Wakeman’s organ, harp- WAKEMAN
sichord and celeste enhances the baroque JOURNEY TO
folk atmosphere, while his solo piano fan-
THE CENTRE
tasia–cum-medley, Temperament Of Mind,
marked him out as a star-in-waiting.
OF THE EARTH
(A&M, 1974)

2
YES One of the most lavish prog
rock concept albums, this live
CLOSE TO THE EDGE
recording, like an adven-
(Atlantic, 1972)
ture film in sound, featured
This is where it all clicked for Yes, with
a prototype version of the
three long-form songs full of colour,
English Rock Ensemble, the “A band that
melody and inventive playing. Wakeman
London Symphony Orchestra, a choir and doesn’t change
only plays a couple of solos, concentrating gets stale”:
actor David Hemmings as narrator. It gave
instead on harmony and colouration, and solo Wakeman,
Wakeman his first solo Number 1.
making particularly striking contributions March 1976.

5
on church organ and mellotron. YES

3
GOING FOR THE ONE
RICK WAKEMAN (Atlantic, 1977)
THE SIX WIVES Released at the height of punk, this
OF HENRY VIII album was Yes’s most direct
(A&M, 1973)
statement to date and features
Wakeman’s debut solo some of Wakeman’s most
album was viewed warily inspired playing, from the
by A&M, who couldn’t ecstatic high synths on the
see how an album of title track to his towering
GETTY

keyboard-based instru- ecclesiastical organ and


mentals could break choral arrangement on the
even. But this collection 16-minute Awaken.
The caped crusader:
Wakeman in his
mid-’70s pomp, and
(opposite page) today.
That’s interesting because it seems the Are you surprised at its success?
polar opposite of much of your other music,

“IN SOUTH AMERICA


It’s done unbelievably well. I’ve been doing up to
which definitely does demand attention. Was
1,500-seater theatres and they’ve all been selling
it as satisfying to make?

THEY WRITE IN THE CONTRACT,


out. Gosh, if we all knew the rules of what was going
Oh yeah, [like] anything you do, if the end result is to work… I was very pleased with the album. It wasn’t

‘YOU WILL WEAR A CAPE.’


what you were aiming for and turned out better than flung together, Erik [Jordan] and I really did spend a
you hoped it would. Everybody’s music collection is a lot of time and care on it. I’m thrilled it’s done so well

IT’S A DEAL BREAKER!”


real mixture and you should be able to pick off the and it’s really nice when people come up say how
shelf whatever music you want, to suit whatever it is much they’ve enjoyed it – it’s lovely.
you are aiming to do at the time.
Were there any particular criteria you used to
Do you always like to have a concept or choose the material for the album?
theme before you start to compose?
Rock Radio from 2005-’10 – and as an Yeah, melody. Didn’t care whether it was five years
Oh yes, I’m not very good at writing and then thinking, old or 500 years old, it had to have a melody,
author. How did that side of it all start?
“What can I use this for?” It probably has happened, because that’s how you can do variations. If the
but it will be literally a handful of bits over the years. Danny Baker had a show called Danny Baker After
melodies aren’t strong, then it’s hopeless. Compos-
I always like to have a reason. That’s really important All that moved me into TV and radio. It was the Num-
ers throughout the centuries have always done
because that helps produce the adrenalin flow to ber 1 Saturday evening chat show, it was huge. I’d
variations on other composers’ work. But they have
achieve what you are after. been trying to get on chat shows and various things
always picked music that has strong melodies.
for radio. I had an agent and they’d all failed – it was
Do you ever regret the capes and the grand hopeless. When I arrived at the studio, they said, What happened to Bohemian Rhapsody?
conceptual gestures like King Arthur? “You’re only on for two minutes, he’s just going to ask That was mooted to be one of the tracks on
No, I’ve worn capes since about 1971 and when I go you about what it’s like touring these days.” I thought, the album.
to countries in South America they write in the “Ah, boring!” I’d just got back from Russia where I’d It was. I’m a huge Queen fan and I really wanted to do
contract, “You will wear a cape”, and it’s a deal break- been arrested for stealing a KGB uniform and I just a little trilogy on Bohemian Rhapsody, but it just didn’t
er! It’s a bit like an actor. David Bowie walked on wearing it. Danny went for it work, no matter how hard I tried. Then you can go
took it to another extreme, not only did and we did about a 20-minute spot. to the other extreme and you can take pieces like
he have costumes, but he created Stairway To Heaven. I love that tune but I thought it
different characters. It’s all part of feel- So you overran by 18 minutes?
was never going to work and it works a treat. There
ing the part. And there are two Rick I came off and the producer came up to
are no rules and regulations.
Wakemans – the on-stage and the off-. me afterwards and I went, “Sorry, really
And the on-stage one wears a cape. sorry, I know that was very unprofes- What other specific plans do you have for
Except when I’m doing the piano shows, sional and out of order.” She said, “Well, the future?
when it doesn’t work. MY LABRADOR you have given me a problem because I was asked to do Piano Portraits Two but I’m not
EATS POO I want to keep it all but I’m going to have
Given your love of storytelling going to do it as I think it would detract from Piano
An audio book of My to ditch two of the other people who
and big productions, if you had Portraits, and that route is called the bank-raid route.
Labrador Eats Poo, a
were on.” They put it on and the follow- If your sole purpose is to make money, it’s a bit of a
been born a couple of hundred collection of “whimsical
ing day my agent’s phone went nuts. worry. I have got plans to do more stuff of that classi-
years earlier, might you have been verses”, narrated by
poet Charles Garland, I was invited on almost everything that cal variation nature, but I’ve got to get this year out of
an opera composer?
with musical inserts by moved. the way first. We’ve got the Anderson Rabin and
That’s a good question. Yes, I certainly Wakeman, is available Wakeman tour of the US, then back for the 30
would have got into the realms of Was your Grumpy Old Rick
now from Wakeman’s additional Piano Portraits shows and I finish on
operas and ballets, which I love dearly. own HaGaTaS persona ever in danger of over-
shadowing the music?
Christmas Eve, so I’m not even thinking of anything
Depends who your employer was, publishing company. until the beginning of the year.
because back in baroque times you Well, Grumpy Old Men certainly was
were either employed by the church and wrote shed- massive and enabled me to do the books [Grumpy You are very busy right now. You’ve had a
loads of church music like Vivaldi, or later on, with the Old Rockstar and Further Adventures Of A Grumpy number of heart attacks and double pneu-
likes of Mozart, you worked for kings and lords. Old Rockstar] as well. It projected me into the realms monia in the past, so do you ever worry
of after-dinner speaking. I’d always play the piano if about how your workload might affect
On your website you invite fans to vote for your health?
there was one there, and some people would come
their favourite albums of yours. Are there any
up to me and say, “Oh, I didn’t know that you Yeah, I really do. Which is why on May
that you particularly like but feel have been
played piano.” That’s fine, it doesn’t worry me. 18, 2019 I’ll be 70, and things will total-
overlooked?
There probably was a time when I was ly wind down. That’s the date that I
I did an album called Seven Wonders Of The World better known for doing the TV than picked and I will stick to it. I have 15 dif-
[1995], which I really like and it disappeared without the music, but things go up and ferent projects I want to do in my life-
trace. It had a launch where the record company down in peaks and troughs, time, and rather than spend a day on
hung it out of the window, saying, “Here it is”, then and in the last few years, them here and there, you have to do it in
brought it back in again. I also did an album with an particularly with Piano two- or three-month blocks. I’ll pick
opera singer, Ramon Remedios, called A Suite Of Portraits, the peaks and chose. I will still do concerts,
Gods [1988]. I just love it. When I look back and think have gone very much but the big tours will have gone.
of the sounds that we created and what we did with on the musical side.
ALAMY, GETTY

the instruments that were around at the time, I think


Piano Portraits R I C K WA K E M A N ’ s
it’s a remarkable little album. I love it to bits. I hate
reached Number Piano Portraits
compilations but I would like to make a compilation,
6 in the album UK Tour resumes on
The Ones That I Think Got Away.
chart, your high- October 23 and runs
You’ve had a long career in the media on TV est chart placing through to November 27.
and on radio – including a stint for Planet since 1975. another

PLANET ROCK 47
THE LONG GOODBYE TOUR

P LU S D
L BAN
O R IG IN A W IT H
P L U S S P E C I A L G U E STS M IN T IT H ,
I S E
N E A L S M WAY &
UNA
D E N N IS D L B R U C E !
M IC H A E
NOVEMBER 2017
F R I DAY 17
BIRMINGHAM
BARCLAYCARD ARENA
SATU R DAY 18
MANCHESTER ARENA
PLUS VERY SPECIAL GUESTS
M O N DAY 20
CARDIFF MOTORPOINT ARENA
W E D N E S DAY 22
GLASGOW THE SSE HYDRO NOVEMBER 2017
TH U R S DAY 23
S AT 1 1 L E E D S F I R S T D I R E C T A R E N A
SUN 12 GLASGOW THE SSE HYDRO
LONDON THE O2 T U E 1 4 B I R M I N G H A M B A R C L AY C A R D A R E N A
AEGPRESENTS.CO.UK | AXS.COM | TICKETMASTER.CO.UK WED 15 MANCHESTER ARENA
NEW ALBUM
THU 16 LONDON THE SSE ARENA WEMBLEY
DEEP-PURPLE.COM AXS.COM AEGPRESENTS.CO.UK
A E G P R E S E N TS
I N AS S O C I AT I O N W I T H U TA OUT NOW
NEW ALBUM ‘PARANORMAL’ OUT NOW ON EARMUSIC
INCLUDES ‘PARANOIAC PERSONALITY” 2CD/2LP/BOX SET/DIGITAL
ALICECOOPER.COMftx
A E G P R E S E N T S I N A S S O C I AT I O N W I T H U N I T E D TA L E N T A G E N C Y

SOULFIRE
TOUR 2017
NOVEMBER
04 LONDON ROUNDHOUSE 12 GLASGOW O2 ACADEMY
06 BRISTOL O2 ACADEMY 14 LIVERPOOL O2 ACADEMY
08 LEEDS O2 ACADEMY 16 NEWCASTLE O2 ACADEMY
10 BIRMINGHAM O2 ACADEMY
AEGPRESENTS.CO.UK AXS.COM TICKETMASTER.COM
AEG Presents in association with United Talent Agency
AEG Presents, DHP, DF Concerts & PVC in association with X-Ray

plus guests
Photo: Simon Emmett

THE EVIL SPIRITS TOUR 2018


JANUARY
NOVEMBER
THU 23 SOUTHAMPTON O2 GUILDHALL SUN 03 NORWICH UEA 26 NEWCASTLE O2 ACADEMY 06 FOLKESTONE LEAS CLIFF HALL
FRI 24 MANCHESTER ACADEMY TUE 05 GUILDFORD G LIVE 27 DUNDEE CAIRD HALL 07 SOUTHEND CLIFFS PAVILION
SAT 25 BLACKBURN KING GEORGES HALL WED 06 MARGATE WINTER GARDENS 28 GLASGOW O2 ACADEMY 09 CARDIFF GREAT HALL
MON 27 LEEDS O2 ACADEMY THU 07 SOUTHEND CLIFFS PAVILION 30 LEEDS O2 ACADEMY 10 BRISTOL O2 ACADEMY
TUE 28 NEWCASTLE O2 ACADEMY SAT 09 BIRMINGHAM O2 ACADEMY 31 MANCHESTER ACADEMY 1 11 BOURNEMOUTH O2 ACADEMY
WED 29 GLASGOW O2 ACADEMY SUN 10 LONDON EVENTIM APOLLO FEBRUARY 13 SOUTHAMPTON O2 GUILDHALL
DECEMBER MON 11 BRIGHTON DOME 01 BIRMINGHAM O2 ACADEMY
FRI 01 STOKE-ON-TRENT VICTORIA HALL WED 13 CARDIFF ST DAVID’S HALL 14 BEXHILL DE LA WARR PAVILION
03 LEICESTER O2 ACADEMY
SAT 02 NOTTINGHAM ROCK CITY THU 14 BRISTOL COLSTON HALL 04 NOTTINGHAM ROCK CITY 17 LONDON O2 FORUM
AXS.COM THEDARKNESSLIVE.COM
AEGPRESENTS.CO.UK • AXS.COM • TICKETMASTER.CO.UK
NEW ALBUM ‘PINEWOOD SMILE ’ OUT 6 OCTOBER 2017 AEG PRESENTS IN ASSOCIATION WITH X-RAY
 thedarknessofficial t thedarkness  theactualdarkness
Runnin’ Wild: Airbourne
frontman Joel O’Keeffe
meets his public.
50 PLANET ROCK
HIGH
ON THE ROAD

VOLTAGE
Even war cannot halt A I R B O U R N E
on their mission to take over the world,
one stage at a time. As the Aussie hard
rockers park their tour bus on the shores
of France’s beautiful Lac du Bourget,
they insist, “There is no plan B…”
WORDS

IAN WINWOOD
PHOTOGRAPHY

PA U L H A R R I E S

PLANET ROCK 51
M OT H E R R U S S I A was
throwing her weight
around when Aussie
quartet Airbourne
landed in Crimea. It was August 18, 2014 when
they set foot in the Federation’s disputed
southern territory at precisely the wrong time
and in exactly the wrong place. In the country
to perform at that year’s Kubana festival,
an event somewhat inconvenienced by the
outbreak of war, the group found themselves
at a small airport just miles from Russia’s
border with Ukraine, which Vladimir Putin’s
armed forces were attempting to annex.
“When we arrived the promoter grabbed
us, told us to stand under the sign above the
entrance to the airport and gave us a copy of
WKDWGD\¶VSDSHUWRKROG´VD\V-RHO2¶.HHɱH
Airbourne’s singer and lead guitarist. “We
were asking, What do you need that for? And
he explained that it was so people would
know that we were actually in the country
and were going to play the festival because
everyone else had cancelled.
“For some reason,” he adds, “no one
wanted to come to a war zone.”
In order to play the festival, Airbourne
¿UVWKDGWRWUDYHODORQJXQSDYHGURDGVDWWZR
in the morning, as lorries without headlights
hurtled toward them at full speed. Their hotel
looked like a bomb had hit it, which indeed it
might have done, and featured as part of its
adornments a dead dog outside the entrance.
*XQ¿UH FRXOG EH KHDUG LQ WKH GLVWDQFH7KH
band were warned not to venture too far from
the building lest they encounter a local
motorcycle gang who could be relied on to
kill them.
Airbourne, a group who could scarcely be
more robustly Australian if they were fronted
by Sir Les Patterson, responded to these
unpromising conditions in a manner that says
much about their attitude to everything:
they set up a PA through which they
played AC/DC and Rose Tattoo at
VNXOOĥFRQFDYLQJYROXPHDQGGUDQNYRGND
with the locals until the sun clocked in on
a brand new day.
“I don’t think there is any gig that we
wouldn’t agree to play,” says drummer
5\DQ 2¶.HHɱH -RHO¶V EURWKHU 7KH SDLU
DUH$LUERXUQH¶VDOSKDPDOHVĦWKHLQHYLWDĥ
ble comparison being with ’DC’s
0DOFROPDQG$QJXV<RXQJĦWKHPDMRULW\
shareholders to the silent partnership of
bassist Justin Street and new guitarist
Harri Harrison.
“We’ve been through enough in our
younger years to have developed a very
thick skin,” the drummer adds.
The undeniable parallels between
Airbourne and AC/DC are more fundaĥ
mental than the fact that the younger

52 PLANET ROCK
band play a brand of unreconstructed
rock’n’roll, which, were it any more meat and
potatoes, would turn into a shepherd’s pie. As
with their famous forebears, the group made
their bones in Australian towns one might
GHVFULEHDVEHLQJRQHĥKRUVHGĦKDGWKHORFDOV
not eaten it.
Formed in Warrnambool in 2003,
Airbourne rehearsed in a condemned hotel
with asbestos in its walls and which, it later
turned out, was being prevented from sliding
GRZQWKHFOLɱĥHGJHRQZKLFKLWVWRRGRQO\E\
the weight of its windows. They played their
earliest gigs at the Criterion Hotel, a place
frequented by locals that had been barred
from all the other pubs in town; most had
prison tattoos and criminal records. The band
drove for 24 hours in a van to perform in the
kind of dives where bringing down the house
equated to be being allowed to live.
“The crowds we played to in those days
were the toughest of the toughest,” recalls
-RHO 2¶.HHɱH ³%DFN WKHQ ZH RQO\ NQHZ WKH
songs that we’d written, we didn’t know any
FRYHUVDSDUWIURPPD\EHĬ$&'&¶Vĭ717VR
we had to play them and have the audience
accept them and us. We’d load up our
Marshall stacks, pack ourselves into our

“WE’D BE MET AT THE VENUE


BY SOME GUY WITH JAIL
TATTOOS WHO’D SAY, ‘I
BETTER F**KING

LIKE IT.’”
JOEL O KEEFFE

station wagon and then arrive at the venue


and be met by some guy with missing teeth
and jail tattoos who’d say, ‘If you’re gonna
Point of entry: (main pic) make a heap of fucking noise I better fucking
Joel gives the Musilac
like it.’ These were the kind of people that
crowd a rock’n’roll
education; (below, wanted a good Saturday night, and if they
from left) Airrbourne’s didn’t get it there was gonna be trouble.”
Crimean War poster, Ryan
O’Keeffe, the Musilac O DAY, JOEL DQG 5\DQ 2¶.HHɱH
setlist, Justin Street.
sit on a leather sofa in an

T DLUĥFRQGLWLRQHG GUHVVLQJ URRP


LQWKHEHDWL¿FVSDWRZQRI$L[ĥ
OHVĥ%DLQV LQ VRXWKHDVWHUQ
France. The drummer has biceps that look
like Californian redwoods; his brother is a
mass of split ends and sinew. They dive into
each other’s sentences as if they were the
ZRUVWUDSDFWRIDOOWLPH%RWKORRNOLNHWKH\
PAUL HARRIES

FRXOGKDQGOHWKHPVHOYHVLQD¿JKW
They are here on this Thursday afternoon
in order to play a late evening slot at the
Musilac Music Festival, on a bill from which
they stand out, as Ryan deftly puts it,

PLANET ROCK 53
Smirk on the water:
Airbourne prepare
for take-off.

DV \DFKWV ERE DURXQG RQ LWV I R B O U R N E A R E DPDFKLQHEXLOW


VXUIDFH 7KH $XVWUDOLDQ RXWĥ IRU WKH URDG $VN ZKDW 5\DQ
EDFNLWDLQ¶W
5\DQ 2¶.HHɱH RɱHUV D
IUDQN DVVHVVPHQW RI WKH
A 2¶.HHɱHZRXOGEHGRLQJZHUH
KHQRWDPHPEHURI$LUERXUQH
DQGKLVDQVZHUFRPHVZLWKWKH
³OLNH D GRJ¶V EDOOV´ 7KH OLQHĥXS IRU WKLV FLUFXPVWDQFHV LQ ZKLFK KLV EDQG ¿QG WKHPĥ NLQG RI VROHPQLW\ RQH PLJKW DVVRFLDWH ZLWK
IRXUĥQLJKW HYHQW FOXVWHUHG DURXQG %DVWLOOH VHOYHV ³,Q *ODGLDWRU WKHUH¶V D OLQH WKDW VD\V DMXGJHKDQGLQJGRZQDGHDWKSHQDOW\
'D\KDVEHHQFRPSLOHGHLWKHUZLWKUHIUHVKLQJ WKDW LI \RX FDQ ZLQ WKH FURZG \RX FDQ ZLQ ³,¶G NLOO P\VHOI´ WKH GUXPPHU VD\V ³,I
RSHQĥPLQGHGQHVVRUOHVVFKDULWDEO\ZLWKWKH 5RPH´KHVD\V³,W¶VVRPHWKLQJWKDW¶VVWXFNLQ VRPHRQH ZDV JRLQJ WR WDNH WKLV DZD\ IURP
NLQG RI WLQ HDU RQH PLJKW DVVRFLDWH ZLWK D RXUPLQGVVLQFHZHZHUHNLGV6RWRGD\ZH¶UH PH,¶GFRPPLWVXLFLGH´
FKDUDFWHU IURP 7KH :L]DUG 2I 2] (LWKHU GRLQJWKLVIHVWLYDODQGLI\RXORRNDWWKHOLQHĥ %XWLIWKLVLVDEDQGZHGGHGWRWKHURDGE\
ZD\RYHUWKHQH[WKRXUVSHRSOHZLOO XS\RX¶OOVHHWKDWZH¶UHGLɱHUHQWIURPWKHUHVW FKRLFH WKHLUV LV DOVR D PDUULDJH RI QHFHVVLW\
EHDUZLWQHVVWRVHWVIURP6WLQJ7H[DV-XVWLFH RIWKHEDQGVRQWKHELOO:HGRQ¶WPLQGWKDWDW $LUERXUQHSRVVHVVQHLWKHUDSRWWRSLVVLQQRU
-DPLURTXDL DQG 6RXWK $IULFDQ KLSĥKRS FUHZ DOO¶FRVLWWKURZVXVLQDWWKHGHHSHQG:H¶YH D ZLQGRZ WR WKURZ LW RXW RI /DVW \HDU¶V
'LH$QWZRRUG SOXV D EHY\ RI )UHQFK EDQGV JRWWRSXOORXWHYHU\WULFNLQWKHERRNEXWWKH Breakin’ Outta Hell DOEXP WKHLU IRXUWK FRVW
XQIDPLOLDUWRDQ(QJOLVKOLVWHQHU¶VHDU VDWLVIDFWLRQIURPKDYLQJGRQHWKDWLVJUHDW IJ WR UHFRUG PRQH\ WKH\ DUH XQOLNHO\
,QFRQWUDVWWRDQ\IHVWLYDODQ\ZKHUHLQWKH ³(YHU\ VKRZ LV D EDWWOH WKDW ZH QHHG WR WRVHHDJDLQ7KHTXDUWHWZLOOVHHPLQJO\SOD\
ZRUOG WKH RQĥVLWH VWDɱ DUH GLVFRQFHUWLQJO\ ZLQ:KHQZH¿QLVKRXU DQ\ZKHUHĦWZRGD\VDIWHU
KHOSIXO$JORZLQVXQOLJKWWKHEDFNVWDJHDUHD VHW LI ZH GRQ¶W KDYH WKLV LQWHUYLHZ DW WKH %HHU
LV D SODFH RI FXVKLRQHG JDUGHQ IXUQLWXUH DQG KDQGV LQ WKH DLU DOO WKH $QG )ORZHUV IHVWLYDO LQ
JHQHUDOFDOPEODFNĥDQGĥZKLWHSULQWVRISUHYLĥ ZD\WRWKHKRWGRJVWDOOV 6ORYHQLD WKH $XVWUDOLDQV
RXV0XVLODFKHDGOLQHUVĦ,JJ\3RS==7RS¶V DW WKH EDFN WKHQ ZH ZLOO VKDUH D ELOO ZLWK
%LOO\)*LEERQV0DWW%HOODP\IURP0XVHĦ WKLQNZH¶YHIDLOHG´ IRUPHU 3DJH  PRGHO
DGRUQ WKH RXWVLGH ZDOOV RI WKH WZRĥVWRUH\ :KDWLV\RXUVXFFHVV WXUQHG VLQJHU 6DPDQWKD
PAUL HARRIES

VWUXFWXUHV WKDW FRPSULVH WKLV WHPSRUDU\ UDWHDVNV3ODQHW5RFN" )R[ Ħ LQ VORWV WKDW SD\
YLOODJH,QWKH9,3DUHDJXHVWVDUHLQYLWHGWR +HUH 5\DQ 2¶.HHɱH EHWZHHQ IJ DQG
GLQHRQOREVWHUDQGFKDPSDJQH7KHYHUWLJLĥ DQVZHUVZLWKRXWDEOLQN IJRIZKLFKWKHIRXU
QRXVSHDNVRI0RQW5HYDUGIUDPHRQHVLGHRI ZLWKRXW D VPLOH ³2QH PHPEHUV ZLOO VKDUH OHVV
WKHVLWH/DFGX%RXUJHWZLQNVLQWKHVXQOLJKW KXQGUHGSHUFHQW´ WKDQSHUFHQW

54 PLANET ROCK
“EVERY SHOW IS A BATTLE
THAT WE NEED TO WIN.
Out of this, rent is paid on properties in mainland Europeans who for an hour are fully
Melbourne in which they rarely live, not to committed to the music to which these men

SO FAR OUR SUCCESS RATE


mention the costs accrued recording an have dedicated their lives.
album which by the standards of the day for a $V XQUH¿QHG DV FUXGH RLO WKLV HYHQLQJ¶V

HAS BEEN 100’ PER CENT.”


band this size are astronomical. ĥVRQJ VHW IHDWXUHV O\ULFV WKDW HPSOR\ WKH
“All the way up to our third album, we words ‘rock’n’roll’ and ‘rock’ no fewer than 51
ZHUHLQGHEW´VD\V-RHO2¶.HHɱH³:HRZHG R YA N O K E E F F E
times. In addition, at one point the band
a shitload of money.” swerve into a few bars of AC/DC’s Let There
How much? Be Rock, as if we hadn’t already got the point.
“Millions.” lakefront apartments and classic and grand Although clearly not to the taste of this
Millions? French architecture, representatives of the HYHQLQJ¶V GD\ĥWULSSHUV IRU PDQ\ RWKHUV KHUH
“Yeah, at least one or two million. And it ZRUNLQJĥFODVVVHHPWKLQRQWKHJURXQGWRR Airbourne’s undeniable energy and propulsive
was fucking ridiculous because in a band No one seems to be wearing one of the band’s WKUXVW DPRXQW WR PRUH WKDQ D PHUH DPXVHĥ
you’re constantly spending money. You’re 7ĥVKLUWVDQGLWLVKDUGWRSLFWXUHDQ\RIWKH bouche on the festival’s opening night.
always trying to pay it back but you’re always SUHWW\ \RXQJ WKLQJV KHUH WRQLJKW ZDLVWĥGHHS Having sweated more than any other act
spending. Even today we probably earn just in mud at Download. on today’s bill, by late evening the Australians
DERYH WKH PLQLPXP ZDJH:H¶G PDNH PRUH The space reserved for people who wish DUHDOUHDG\RQWKHLUZD\WRWKHQH[WWRZQWKH
money if we were doing a paper round.” to eat, drink and take in the balmy summer QH[WFRXQWU\6RRQWKHEUHDWKĥKDOWLQJEHDXW\
“The record industry was going OK until evening air is far larger than the area allocated RI$L[ĥOHVĥ%DLQVZLOOEHEHKLQGWKHP
DERXW ´ VD\V 5\DQ 2¶.HHɱH ³:H for those who wish to watch a band. As such, “In 20 years’ time we’ll still be a touring
recorded Runnin’ WildĬWKHEDQG¶VGHEXW FRQYHUWV WR $LUERXUQH¶V FDXVH DUH IDU RXWĥ URFN EDQG´ VD\V -RHO 2¶ .HHɱH LQ SDUWLQJ
DOEXPĭ GXULQJ WKDW WLPH DW ZKLFK SRLQW WKH numbered by those who care not a jot whethĥ ³7KH RQO\ GLɱHUHQFH EHLQJ WKDW LQ 
industry took a huge dive. The span of our er the group lives or dies by a ratio of at least we’ll be headlining this place.”
career has taken place during the worst two to one.
monetary crash in the history of the industry This, though, should not detract from the
A I R B O U R N E play Portsmouth Pyramids on
ZHZRUNLQ:H¶YHPDQDJHGWRQHJRWLDWHWKH sight that greets the Australians from their
September 27, then tour the UK from November
money to make records the way we want to YDQWDJHSRLQWRQĥVWDJH$VWKHVXQWXFNVLWVHOI 10. For more info, visit www.planetrock.com.
with the realisation that we’re not going to in for the night, in front of them are 20,000
get anything back.”
So, like a cartoon character that will
SOXQJHWRHDUWKIURPWKHFOLɱRYHUZKLFKKH
has just stepped only if he stops running and
looks down, Airbourne are a machine of
perpetual motion. The days when they once
travelled for 32 straight hours in a van from
6HDWWOH:DVKLQJWRQWR$XVWLQ7H[DVIRUDJLJ
at the South By Southwest music convention
attended by just 30 people may be behind
them but, were they to return, one senses that
Airbourne would be entirely undaunted.
“For us, there is no plan B,” says the
drummer. “This is all there is.”
“People see us and sense that we’re a
ZRUNLQJĥFODVV EDQG´ VD\V WKH VLQJHU ³2XU
DXGLHQFHLVPDGHXSRIZRUNLQJĥFODVVSHRSOH
They look at us and think to themselves,
μ)XFN , FRXOG GR WKDW¶ :H¶UH QRW WKH
JUHDWHVWĥORRNLQJ EXQFK WKDW \RX¶OO HYHU VHH
RQĥVWDJHZH¶UHQRWWKHEHVWPXVLFLDQVLQWKH
world, and it’s not like we’re playing the most
technically advanced music you’ll ever hear
either. But the emotional punch is what we’ve
got. That’s the thing that sets us apart.”

on one of the
L A I L I N G AWAY
Musilac Music Festival’s two

F main stages, tonight Airbourne


fail to get everyone from the
safety barriers to the hot dog
stands at the back raising their hands and Iron Fists:
clapping in unison. For one thing, there are no Harrison, O’Keeffe,
hot dog stands; instead, there are a vast array O’Keeffe, Street.
of stalls selling artisanal dishes. In a town of

PLANET ROCK 55
Class act:
Alice Cooper
(clockwise
from top) Neal
Smith, Michael
Bruce, Glen
Buxton, Alice
Cooper, Dennis
Dunaway.
I L L U S T R AT I O N : P E T E R C ROW T H E R ; P H O T O : G E T T Y

PLANET ROCK
57
“IN ARIZONA, YOU COULDN’T GO OUT IF
E C E M B E R 1 9 7 2 . At the studios of BBC Televiĥ
sion Centre in White City, west London, the

YOU HAD LONG HAIR. TWO OF MY FRIENDS


Top Of The Pops Christmas Special is underĥ
way. The show’s scattershot bill this evening reĥ
ÀHFWV D GHFDGH WKDW FXOWXUDOO\ KDVQ¶W TXLWH
found its groove yet, in much the same way as the ’60s didn’t really get
started until the inaugural peal of harmonica that opened The Beatles’
Please Please Me back in March ’63.
GOT BEATEN TO DEATH BY COWBOYS.”
Gary Glitter, Slade and Marc Bolan’s T.Rex have all made appearĥ
ALICE COOPER
ances on tonight’s show, proof that glam rock is in the ascendancy. But
the lion’s share of music is the kind of novelty tat that might prove EHWZHHQ %HWWH 'DYLV LQ :KDWHYHU +DSSHQHG 7R %DE\ -DQH" DQG D
EDɹLQJ WR D PRGHUQ DXGLHQFH %HQQ\ +LOO¶V FKDUWĥWRSSHU (UQLH Ī7KH particularly gnarly Manson Family member.
)DVWHVW0LONPDQ,Q7KH:HVWī3DQ¶V3HRSOHHYRNLQJWKHLQFRQVRODEOH 2YHU D VWDFFDWR ULɱ KH¶OO ODWHU DFFXUDWHO\ GHVFULEH DV ³EUDWW\´
longing of Nilsson’s Without You by dressing like garlic bulbs and ĥ\HDUĥROG 9LQFHQW )XUQLHU Ħ QRZ EHWWHU NQRZQ DV URFN VWDU $OLFH
VSLQQLQJ DURXQG DQG WKH EHZLOGHULQJ VXEĥRRPSDK ERRJLH KRQN RI &RRSHUDOVRWKHQDPHRIKLVEDQGĦSURFHHGVWRZLHOGDUHGEDOORRQ
Lieutenant Pigeon’s Mouldy Old Dough. with unlikely menace, thrust a fencer’s rapier down the lens of a BBC
$VWKHVDFFKDULQHVWUDLQVRIWRRWKVRPHSUHĥWHHQKHDUWWKURE'RQQ\ 79 FDPHUD DQG IROORZLQJ D SDUWLFXODUO\ ¿HU\ WZLQĥJXLWDU IUHDNRXW
Osmond’s Puppy Love fade away, however, the camera cuts to four courtesy of sidemen Glen Buxton and Michael Bruce, grab an angelic
VXUO\ ORQJĥKDLUHG $PHULFDQV JXVVLHG XS LQ VWDFNĥKHHOHG ERRWV DQG pubescent audience member by her hair and pretend to hang her, all
VKLQ\VLONSOD\VXLWVGUL]]OHGOLEHUDOO\ZLWKVHTXLQV7KH\DUHOHGE\ the while singing of a student uprising that makes the climax of
what appears to be a wizened crone in ripped black leather Lindsay Anderson’s 1968 movie If…. look tame.
pants, black strangler’s gloves, a black piratical blouse cut ³6FKRRO¶V«2XW«)RU«(YHU´$OLFHVQDUOVDFFRPSDĥ
RSHQ WR KLV QDYHO ODQN EODFN KDLU DQG EODFN PDNHĥXS QLHGE\DQRɱĥVFUHHQFKLOGUHQ¶VFKRLU7KHQDVKHGUDJV
staining his eyes and cheeks so he resembles a cross WKH EODGH RI KLV VZRUG DFURVV KLV QHFN ³6FKRRO¶V«
%HHQEORZQ«7RSLHFHV´
All across the UK, viewers’ grumpy dads are
choking on their turkey leftovers, while Mary
Alice inspires Whitehouse and her moral majority race to their
moral panic on the desks to pen letters of complaint. But nothing can
Top Of The Pops
stop these lurid collegiate arsonists, with their props,
Christmas Special,
December 1972. WKHLUPDNHĥXSDQGWKHLUEDGĥDVVWXQHV(DUOLHUWKDW\HDU
School’s Out topped the UK charts, with the School’s Out
album reaching Number 2 in the US. Unlikely as it seems,
Alice Cooper is about to become one of the world’s greatest
rock’n’roll stars, and then nobody will be safe.
/HDVWRIDOO9LQFHQW)XUQLHUKLPVHOI

L I C E C O O P E R ’s ‘overnight success’ was a good eight

A years in the making. The group started life as The


(DUZLJV D %HDWOHVĥLQÀXHQFHG JDUDJH HQVHPEOH WKH
ĥ\HDUĥROG)XUQLHUIRUPHGLQZLWKIHOORZSXSLOVĦ
LQFOXGLQJ *OHQ %X[WRQ ĪJXLWDUī DQG 'HQQLV 'XQDZD\
ĪEDVVīĦWRFRPSHWHLQWKHDQQXDOWDOHQWVKRZDWWKHLUKLJKVFKRROLQ
3KRHQL[$UL]RQD6RRQLQDWUDQVIRUPDWLRQWKDWZRXOGIUDQNO\EDɹH
most entomologists, 7KH (DUZLJV EHFDPH 7KH 6SLGHUV DQG EHJDQ
playing local bars, with future Alice Cooper drummer Neal Smith and
UK\WKPJXLWDULVW0LFKDHO%UXFHODWHUMRLQLQJWKHOLQHĥXS1RQHRIWKH
TXLQWHWZDVDQDWLYH3KRHQLFLDQĦ)XUQLHUZDVERUQLQ'HWURLWZKLOH
his bandmates originated from Ohio, Oregon and Kansas. There were
other reasons why they found themselves outsiders in Phoenix, too.
³,Q$UL]RQD\RXFRXOGQ¶WJRRXWLI\RXKDGORQJKDLU´VD\V$OLFH
WRGD\³$QGZHKDGKDLUWKDWMXVWWRXFKHGRXUFROODUV,KDGWZRIULHQGV
who got beaten to death by cowboys. The local cowboys were like the
ZRUVWJDQJ\RXHYHUVDZ´
7KH FRZER\V ZHUHQ¶W WKH RQO\ SUHGDWRUV LQ WRZQ KRZHYHU Ħ WKH
JURXS DOVR KDG WR IDFH Rɱ KRUGHV RI OHDWKHU MDFNHWĥFODG JUHDVHUV DQG
0H[LFDQJDQJV³2QHWLPHZHSOD\HG7XFVRQDQGWKH0H[LFDQVZHUH
GETTY, ALAMY

on one side of the room and the greasers on the other side, and were
¿JKWLQJHDFKRWKHURYHUZKRJRWWRNLOOXV´ODXJKV$OLFH³*OHQZDVD
WRWDOJUHDVHUĦZHDULQJDYHVWFLJDUHWWHLQKLVPRXWKSOD\LQJKLVJXLWDU
A greaser girl came up and asked him to play Louie Louie, and he
tapped cigarette ash into her cleavage. And the greasers were all, like,
μ7KLVJX\¶V2.ĦWKDW¶VWKHNLQGRIWKLQJZH¶GGR¶

58 PLANET ROCK
Children of the evolution: (above
from left) The Earwigs in 1965;
The Nazz in 1967; Alice Cooper
with mentor Frank Zappa; (main
pic) the band photographed for
1969’s Pretties For You.

“After the show, the promoter told us the gangs were waiting their wing when we arrived,” remembers Alice. “They were the weirdĥ
outside to jump us on our way to our cars. So, he smashed up a est thing in LA, and maybe they recognised we were the next weirdest.
barstool, handed a leg to each of us and said, ‘Are you ready?’ We weren’t just another band, we had something else going on, we
We’d carry knives, because when drunk cowboys jumped out ZHUH μDUW\¶´ /$¶V ZHLUGRĥLQĥFKLHI )UDQN =DSSD DOVR JURNNHG $OLFH
of their cars to beat you up, you needed something to defend &RRSHUĦUHQDPHGRQHODVWWLPHDIWHUGLVFRYHULQJ7RGG5XQGJUHQDOVR
\RXUVHOIZLWK:HZHUH¿YHJX\VZKRZHUHQ¶WDIUDLGWR¿JKW KDG D EDQG FDOOHG 1D]] DQG E\ QRZ D FURVVĥGUHVVLQJ GUXJĥGDEEOLQJ
ĦZHGLGQ¶WwantWR¿JKWEXWLIZHKDGWR«%HLQJLQDEDQG FDEDO6LJQLQJWKHPWRKLVODEHO6WUDLJKW=DSSDSURGXFHGWZRDOEXPV
was a very dangerous pastime in Arizona.” IRU WKH ÀHGJOLQJ EDQG ¶V Pretties For You DQG ¶V Easy Action,
1RWWKDW7KH6SLGHUVĦQRZUHQDPHG7KH1D]]ĦIRXQG ERWKRIZKLFKIDLOHGWR¿QGDQDXGLHQFH
much more love after they relocated to Los Angeles. At the “We were raw as hell then, just vicious,” remembers Alice. “Everyĥ
height of the hippy era, their gonzoid garage noise left most one just seemed to be saying, ‘Could you guys please leave LA?’ So we
of the peace’n’love set nonplussed. “The Doors took us under did. We went to Detroit, and people there totally got us.”

PLANET ROCK 59
Public animal: Alice
Cooper (opposite
page) at the centre

“THE DOORS TOOK US UNDER THEIR WING.


of his own universe
GXQGXQ'(5GXQGXQGHU'(5'(555¶Ħ
c.1972 and (below)
this bratty thing. That was just him, sticking School’s Out’s

THEY WERE THE WEIRDEST THING IN LA,


it to The Man. infamous inner-
³7KHULɱLQVSLUHGWKHZKROHEUDWWLQHVVRI sleeve panties.
the song. The lyrics, meanwhile, were written

AND WE WERE THE NEXT WEIRDEST.” LQ WKH YRLFH RI D %RZHU\ %R\ DOO PHDQ DQG
ZLVHJX\ĥHVTXH $QG ZKHQ WKDW FKRUXV DUULYHG , NQHZ WKLV ZDV DQ
DQWKHP(YHU\NLGLQWKHZRUOGLVJRLQJWREHVLQJLQJWKLV7KDWPLJKW¶YH
ALICE COOPER
been the only song I ever wrote where I was pretty sure it was going to
EH D KLW:LWK DOO WKH WRXFKHV %RE SXW WR LW DQG WKH DWWLWXGH RI WKH
It wasn’t just the change in scenery that changed things for the VRQJ,IHOWOLNH,IWKDW¶VQRWDKLW,GRQ¶WEHORQJLQWKLVEXVLQHVV´
band. Arriving in Detroit they found a local scene dominated by kinĥ 0RVWLQVSLUHGDPRQJWKHWRXFKHV(]ULQDGGHGWRWKHSURGXFWLRQ
dred spirits, most notably The Stooges and the MC5. They also found was the presence of a choir of snotty schoolkids singing the backing
a man who would help them translate their sound from the stage to the YRFDOVDWULFN(]ULQZRXOGUHSHDWZKLOHUHFRUGLQJThe Wall with Pink
VWXGLRĦ%RE(]ULQWKHQZRUNLQJIRU-DFN5LFKDUGVRQWKH&DQDGLDQ )OR\GVHYHQ\HDUVODWHU³(]ULQVDLGμ:HJRWWDKDYHNLGVĦUHDONLGVĦRQ
producer who had made stars of Winnipeg rockers The Guess Who. WKHWUDFNVLQJLQJ1RPRUHSHQFLOVQRPRUHVFKRROERRNVǦ$QG\RX
³2XU PDQDJHU 6KHS *RUGRQ ZDQWHG -DFN WR SURGXFH XV´ VD\V hear ’em laughin’ and screamin’, like it’s the last day of school. The song
$OLFH³-DFNZDQWHGQRWKLQJWRGRZLWKXVVRKHVHQW%REWRVHHXVDW ZDV KDUGĥDVV LW ZDVQ¶W ZLPS\ %XW LW UHDOO\ LV MR\IXO :H DFWXDOO\
0D[¶V.DQVDV&LW\WRJHWULGRIXV%XW%REORYHGXV+HVDZD FDSWXUHGWKDWIHHOLQJRIWKHODVWWKUHHPLQXWHVRIVFKRRO´
IXWXUHLQXV´ For the rest of the album, the band expanded upon their
(]ULQ SDUHG EDFN WKH JURXS¶V ZLOGQHVV DQG LOOĥ %RZHU\ĥ%R\VĥEORZĥXSĥWKHĥVFKRRO FRQFHSW DQG WDSSHG
conceived virtuoso ambitions. “We wanted to be The LQWRDQRWKHUNH\HDUO\LQÀXHQFHWKDWWKHEDQGVKDUHGĦ
<DUGELUGV´ VD\V $OLFH ³EXW %RE VDLG μ1R GXPE LW ¶VELJĥVFUHHQDGDSWDWLRQRI:HVW6LGH6WRU\3URRI
GRZQ¶´ 6FXOSWLQJ WKH JURXS¶V ¿UVW 7RS  VLQJOH indeed, that Alice Cooper were a pretty cultured
(LJKWHHQIURPDFKDRWLFVWXGLRMDP(]ULQSURGXFHG bunch of guys, on the quiet.
WZRDOEXPVIRUWKHJURXSLQĦLove It To Death ³:KHQZHVWDUWHGSOD\LQJDV7KH(DUZLJVZHGLG
ĪZKLFKSHDNHGDW1XPEHULQWKH86DOEXPVFKDUWī WKH VDPH WKLQJ DOO \RXQJ EDQGV GR Ħ SOD\ RWKHU
and KillerĪ1XPEHUī:KLOH(]ULQFOHDUO\JRWWKH SHRSOH¶V PXVLF IRU IRXU KRXUV D QLJKW´ VD\V $OLFH
band to channel their raw energy, adding structure to ³7KH%HDWOHV7KH<DUGELUGV7KH.LQNV7KH:KR´
their music, his production nous also allowed them to %XW$OLFH&RRSHU¶VLQVSLUDWLRQVZHQWEH\RQGWKHFUHDP
retain their outré sense of self. It was this combination of RIWKH%ULWLVKLQYDVLRQ³:KHQZHVWDUWHGZULWLQJRXURZQ
D QHZ VRXQG DV ZHOO DV WKHLU RULJLQDO ÀDPER\DQFH DQG VWXɱZHWRRNHYHU\WKLQJZHNQHZDQGWKUHZLQVRPHRWKHU
KRUURUĥLQVSLUHG VKWLFN WKDW DOORZHG WKH EDQG WR DWWUDFW D QHZ VWXɱDOLWWOH6WRFNKDXVHQDOLWWOH-RKQ%DUU\DQGDZKROHORW
audience, most of whom were weirdos. of West Side Story. In our early shows we’d play out Sharks
The mainstream, however, still eluded Alice’s eldritch grasp. YV-HWVJDQJ¿JKWVZLWKUHDOVZLWFKEODGHVDQGWKHUHDOEORRG
³:HGLGQ¶WUHDOO\DSSHDOWRWKHμQRUPDO¶NLGVWKH&URVE\6WLOOV  RQĥVWDJHXVHGWREXPDOOWKHKLSSLHVRXW:HZHUHPRUHWKDQ
1DVK IDQV´$OLFH DGPLWV ³:H DSSHDOHG WR WKH RXWVLGHUV$QG LW DOLWWOH%URDGZD\
turned out there were a lot of outsiders. They chose us. I was their ³6RZHDOOORYHG:HVW6LGH6WRU\:HLGHQWL¿HGZLWKWKH
OHDGHUDQGWKH\ZHUHRXUJDQJ´ gangs, we all wanted to be in the ShDUNVRUWKH-HWV$QGWKH
Soon, that gang would swell with hundreds of thousands of PXVLF ZDV VR XS VR LQĥ\RXUĥIDFH:H ZDQWHG WR WDS LQWR WKDW
new pledgers, as Alice and his band chanced upon a message evĥ JLYHHYHU\VRQJWKLVUHDOO\VQHHULQJμSXQN¶DWWLWXGHDERXWOLIH6R
ery kid could identify with. \RX¶YH JRW ĬVHFRQG WUDFN RQ School’s Outĭ /XQH\7XQH DQG LW¶V DOO
μ6OLSSHGLQWRP\MHDQVIHHOLQJKDUGORRNLQ¶PHDQ«¶´
C H O O L’ S O U T began with a moment of 0HDQZKLOH *XWWHU &DW 9V 7KH -HWV PDGH WKH :HVW 6LGH 6WRU\

S LQVSLUDWLRQDQLQWUDĥEDQGFKDWGXULQJDEUHDN
LQ MDPPLQJ DQG Ħ DV ZLWK DOO ZRQGHUIXO URFN
VRQJVĦZLWKDULɱ
“To us, rock’n’roll was about tapping into
connection even more explicit, its carnal feline metaphors giving way
WR D JOHHIXO YDPS RQ WKH 6WHSKHQ 6RQGKHLP/HRQDUG %HUQVWHLQ -HWV
battle hymn. Cooper chews the scenery throughout, his performance
campy as hell, but the band leave you in no uncertainty that every
ZKDWZHZHUHOLNHDVNLGV´VD\V$OLFH³:KDWGRHVHYHU\NLG one of them knows how to wield a musical switchblade, bassist
hate more than everything else? School! And what was the Dennis Dunaway in particular.
greatest moment of the year? The last three minutes of the last ³0DQWKDWEDVVOLQHZDVJUHDW´PDUYHOVWKH&RRSORVW
day of school! You couldn’t wait for that bell to hit three o’clock, LQWKHPHPRU\RIFXWWLQJWKHWUDFNDW1HZ<RUN¶V5Hĥ
because then you would be free. I said, We’ve got to capture that cord Plant. “Dennis was a lead bassist, he didn’t
ODVWWKUHHPLQXWHVRIWKHODVWGD\RIVFKRRORQWDSHĦWKDWMR\ SOD\ OLNH DQ\RQH HOVH +H ORYHG 3DXO 6DPĥ
³*OHQ%X[WRQZDVWKHELJJHVW%RZHU\%R\RIDOOWLPH´FRQWLQXHV ZHOOĥ6PLWK RI7KH<DUGELUGV DQG WKDW ZDV
PHOTOSHOT, ALAMY

$OLFH UHIHUHQFLQJ WKH MXYHQLOH 1HZ<RUN VWUHHW WRXJKV his launching point, but he went from
ZKR VWDUUHG LQ PRYLHV LQ WKH ¶V DQG ¶V ³+H there and created his own world. Pretty
FRXOGQ¶WZDLWWRJHWDZD\ZLWKVRPHWKLQJ+HZDV VRRQ ZH ZHUH DOO IROORZLQJ KLP (]ULQ
WKH$PHULFDQ .HLWK 5LFKDUGV Ħ WKHUH ZDV DOĥ VDLG μ'HQQLV KDV ZULWWHQ WKLV JUHDW
ways two illegal things in his pockets at any bassline and I pretty much think the
one time, either a switchblade, or a joint, or whole song needs to be built around
DSLOO«DWUXHMXYHQLOHGHOLQTXHQW+HFDPH WKDW¶6RWKDW¶VZKDWZHGLG´
XSZLWKWKLVJXLWDUOLQHĦμ'XQGXQ'(5 Public Animal #9, meanwhile,

60 PLANET ROCK
Pout and about:
Alice at his most
smooth and
seductive.

GHOLYHUHG RQ WKH %RZHU\ %R\ ZDQQDEHĥJDQJVWHU YLEH in W\SHDQGLWORRNHGEULOOLDQW:HJUDɷWLHGWKHGHVNRXUVHOYHV


MORE E\WKHZD\FKLVHOOHGRXUQDPHVLQWRLWDQGHYHU\WKLQJ´
excelsisVXQJLQWKHYRLFHRIDKLJKVFKRROEDGDVVEHLQJGUDJJHG
SCHOOL!
WRGHWHQWLRQDQGVZDJJHULQJLWRXWOLNHD-LPP\&DJQH\FKDUĥ $VIRUWKHLQIDPRXVLQQHUVOHHYHWKDWZDVDQRWKHU$OLFH
Tune in to
DFWHUWUXGJLQJWRWKHHOHFWULFFKDLU³,¶POLNHDOLIHULQDVWDWH PLANET ROCK
RULJLQDO ³,I \RX ZHUH  \HDUV ROG DQG \RX FRXOG RSHQ \RXU
SHQLWHQWLDU\´$OLFHVLQJVWKRXJKLQUHDOLW\WKHFKDUDFWHULVQR PLAYS IT IN FULL GHVNDQGSURGXFHDSDLURIJLUO¶VSDQWLHV\RXZHUHWKHPDQ
3XEOLF(QHP\MXVWDYHU\QDXJKW\ER\6DYHIRUWKHZRQĥ every Monday at ĪLaughsī'LGQ¶WKDYHWRH[SODLQLW<RXUIULHQGVZRXOGEHOLNH
11pm when we
GHUIXOO\ RYHUEORZQ LQVWUXPHQWDO μXQGHUWXUH¶ *UDQG )LQDOH bring you a classic
μ,QFUHGLEOH:KDWGLG\RXGR"¶$QGWKH\ZHUHSUREDEO\\RXU
WKHVHWFRQFOXGHGZLWK$OPD0DWHU$OLFHPXVLQJ³+RZGR album every week, VLVWHU¶VSDQWLHVRU\RXUPRP¶VRU\RXERXJKWWKHP\RXUVHOI
\RXOLNHWKDWWKH\¿QDOO\OHWPHRXWRIVFKRRO«´KLVEUDYDGR broadcast in all its IURPDVWRUHEXW\RXVWLOOJRWWKHNXGRV6R,VDLG3DFNDJH
glory, played sans
OHDNLQJ DZD\ DV KH UHDOLVHV KH¶V DFWXDOO\ ELGGLQJ IDUHZHOO WR WKH UHFRUG LQ D SDLU RI SDQWLHV ,W ZDV VR RXWUDJHRXV7KDW
interruption.
WKHEHVWGD\VRIKLVOLIH³,WKDVWKLVUHDOPHODQFKRO\IHHOLQJ´ PDGHeverybodyPDGĦWKHFKXUFKHVWKHWHDFKHUVHYHU\ERG\
JULQV$OLFH³7KLVμ'RQ¶WIRUJHWWKH&RRS2KMHH]«¶IHHOLQJ %XW HYHU\ NLG ZDV OLNH μ<HVVVVV¶ $QG HYHU\ SDUHQW ZHQW
REX, THEORIGINALGLENBUXTON.COM
³7KH ZKROH DOEXP WDSSHG LQWR RXU \RXWK RXU ZDQWLQJ WR EH LQ μ:KDW¶VWKLV"7KHUH¶VSDQWLHVRQP\NLG¶VEHGURRPÀRRU""¶´
JDQJV´KHFRQWLQXHV³*DQJVEDFNWKHQZHUHQ¶WOLNHWKH\DUHQRZWKH\ *UHDW ULɱV NLOOHU SHUIRUPDQFHV DQG D VOHHYH JXDUDQWHHG WR PDNH
ZHUHQ¶WLQYROYHGLQFULPHQHFHVVDULO\ĦWKH\ZRUHEODFNOHDWKHUMDFNHWV SDUHQWV DQG WHDFKHUV PDG $OLFH &RRSHU KDG MXVW KDSSHQHG XSRQ D
FDUULHG VZLWFKEODGHV DQG GURYH KRW FDUV , WKLQN RXU IDQV ZHUH IRUPXODWKDWFRXOGQ¶WIDLO
EHJLQQLQJ WR JHW FXULRXV DERXW ZKR ZH UHDOO\ ZHUH Ħ ZH KDG DOO WKLV
KRUURUĥPRYLHVWDJHGUHVVLQJ,ZDVKDQJLQJP\VHOIRQĥVWDJHHYHU\QLJKW H E F I R S T  VLJQ WKH VRQJ KDG WRXFKHG D QHUYH ZDV WKH
,VHHPHGLQVDQH%XWKHUHZHZHUHRɱHULQJDJOLPSVHLQWRRXUEDFNĥ
JURXQGV:H ZHUHQ¶W MXVW DERXW VFLĥ¿ VWXɱ:H ZHUH IURP ELJ FLWLHV
WRXJKFLWLHV:HSDUHGLWDOOGRZQWRDSUHWW\VOLFNSDFNDJH´
7KHSDFNDJHLWVHOIPHDQZKLOHZDVDQRWKHUVWURNHRIJHQLXVIURP
T QHZV IURP WKH 8. WKDW 6FKRRO¶V 2XW¶V KDG JRQH WR
1XPEHU³7KDWZDVWKHZHHNLWFDPHRXW´UHPHPEHUV
$OLFHRIKLVVLJQDWXUHVRQJ¶VURFNHWĥVKLSULGHWRWKHWRS
³:HXVHGWRORRNDWWKHFKDUWVDQGWKLQN:HGRQ¶W¿WLQ
WKH &RRS GHVLJQHG WR ORRN OLNH D VFKRRO GHVN WKH JDWHIROG VOHHYH KHUHDWDOO:KHQ(LJKWHHQZDVDKLWZHVDLG:HOOWKDW¶VDÀXNHDQG
RSHQHGWRUHYHDOFRQWHQWV\RXPLJKWH[SHFWRIDQ\KLJKVFKRROWURXEOHĥ ZHFDQZDONDZD\IURPWKLVNQRZLQJZHKDGDKLW<RXQHYHUH[SHFWWR
PDNHUDFDWDSXOWDVZLWFKEODGHDSLQĥXSRIWKHJURXS³:HZHUHDUWV KDYHDQRWKHURQH7KHQDOORIDVXGGHQ6FKRRO¶V2XWZDVDKLW´
PDMRUVZHKDGDYLVLRQμ,W¶VDGHVN¶:HIRXQGWKLVFRPSDQ\WKDWKDG 5HOHDVHG RQ $SULO   6FKRRO¶V 2XW EHFDPH DQ LQVWDQW
WKHVDPHVHQVHRIKXPRXUDVXVĦWKH\GHVLJQHGLWEURXJKWLQDSURWRĥ SKHQRPHQRQ DQG UHPDLQV$OLFH¶V VLJQDWXUH DQWKHP LQ D GLVFRJUDSK\

62 PLANET ROCK
“WE LOVED WEST SIDE STORY. WE
SDFNHGWRWKHJLOOVZLWKURFN¶Q¶UROOEULOOLDQFH,WVVDOHVĦDORQJZLWKWKDW
RI LWV SDUHQW DOEXP ZKLFK ZHQW7RS  DFURVV WKH JOREH Ħ VHQW WKH

IDENTIFIED WITH GANGS. WE WANTED TO


JURXSLQWRDQHZVWUDWDRIIDPHDQGVXFFHVV³$QGZHGLGQ¶WNQRZKRZ
WRKDQGOHLW´VD\V$OLFH³7KHUH¶VQRSDPSKOHWWKDWWHOOV\RXKRZ\RX
KDQGOHLW\RXMXVWKDYHWRZRUNLWRXW´
7KH PDWHULDO FKDQJHV ZHUH LPPHGLDWH ³:H ZHUH VWD\LQJ LQ RXU
RZQURRPVDWKRWHOVQRZUDWKHUWKDQVKDULQJPRWHOURRPVDQGÀ\LQJ
RQDLUSODQHVLQVWHDGRIGULYLQJWRJLJV$QGKRQHVWO\ZHGLGQ¶WNQRZ
GIVE EVERY SONG A ‘PUNK’ ATTITUDE.”
ZKDWWRGRZLWKWKHPRQH\:HGLGQ¶WKDYHWLPHWRVSHQGLWEHFDXVHZH
ALICE COOPER
ZHUH DOZD\V RQ WRXU DQG LI ZH ZHUHQ¶W RQ WRXU ZH ZHUH PDNLQJ D DERUQĥDJDLQ&KULVWLDQZKRVWLOOWRXUVDVRIWHQDVKHFDQ)XUQLHUKDV
UHFRUG:HKDGQRVRFLDOOLIHDWDOOQRERG\ZDVPDUULHGHYHU\ERG\ZDV VWUXFNDPXFKKHDOWKLHUEDODQFHEHWZHHQKLVUHDOOLIHDQGWKDWRIKLV
MXVWOLYLQJRQWKHURDG,GLGQ¶WHYHQKDYHDQDGGUHVV7KDWZHQWRQIRU DOWHU HJR 7KH UHFHQW UHOHDVH RI KLV WK VWXGLR DOEXP Paranormal
VHYHQHLJKW\HDUV´ SURYHVKHVWLOOKDVDORWRIPXVLFOHIWLQKLP%XWIRUDOOWKHSHUVRQDO
$VDFHUWDLQSDLURI¿FWLRQDO$OLFH&RRSHUIDQVZRXOGODWHUGHVFULEH WRUPHQWWKDWIROORZHGSchool’s OutKHUHJUHWVQRWKLQJ
LW OLIH IRU $OLFH DQG KLV EDQGPDWHV GXULQJ WKLV HUD ZDV YHU\ PXFK  ³<RX QHYHU NQRZ LI RU ZKHQ \RX¶UH JRLQJ WR JHW μWKDW VRQJ¶´ KH
³3DUW\7LPH([FHOOHQW´ DGGV ³,W GRHVQ¶W PDWWHU KRZ PDQ\ JUHDW VRQJV WKH\ ZURWH DIWHU 0\
³1RZ VXGGHQO\ ZH ZHUH FRQQHFWHG WR WKLV XSSHU HFKHORQ RI *HQHUDWLRQ ZKHQ , WKLQN RI 7KH :KR , WKLQN DERXW WKDW VRQJ
URFN¶Q¶UROOJURXSV´KHVD\V³:H¶GJHWWRWKHKRWHODQGVHHWKH)DFHV 6DWLVIDFWLRQZDVWKHVRQJWKDWPDGHWKH6WRQHVWKDWZDVWKHLUVLJQDĥ
WKHUH DQG JR )UDWHUQLW\ 3DUW\ %HFDXVH \RX ZHUH DOO LQ D IUDWHUQLW\ WXUH6FKRRO¶V2XWZLOODOZD\VEHWKHVLJQDWXUHVRQJIRU$OLFH&RRSHU
WRJHWKHUĦDQ\ERG\ZKRZDVLQDEDQGZDVDEURWKHUEHFDXVH\RX¶GDOO $QG HYHU\ 0D\ LW EHFRPHV WKH PRVWĥSOD\HG VRQJ LQ WKH FRXQWU\
SOD\HGLQWKHVDPHJLJV\RX¶GDOOVWD\HGDWWKHVDPHKRWHOVVOHSWZLWK EHFDXVHHYHU\VFKRROSOD\VLWRYHUWKHORXGVSHDNHU
WKHVDPHJLUOV«´ ³,W GRHVQ¶W PDWWHU LI ZH¶UH SOD\LQJ 3HUX RU -DSDQ WKH VRQJ LV WKH
7KLVQHZIRXQGVHQVHRINLQVKLSZLWKKLVKHURHVVRRQVDZ&RRSHU DQWKHPIRUHYHU\VFKRRONLGLQWKHDXGLHQFH´&RRSHUFRQFOXGHV³DQG
LQDXJXUDWHKLVRZQFHOHEULW\GULQNLQJFOXEWKH+ROO\ZRRG9DPSLUHV HYHU\SHUVRQZKRUHPHPEHUVZKDWWKRVHODVWWKUHHPLQXWHVRIWKH
FOLQNLQJ JODVVHV ZLWK URFN¶V$ĥ/LVW ³, FRXOG VLW ZLWK D -RKQ /HQQRQ VFKRRO\HDUIHOWOLNH´
D+DUU\1LOVVRQD.HLWK0RRQDQG,KDGDORWLQFRPPRQZLWKHYHU\ĥ
ERG\,PHDQ-RKQZDVD%HDWOHVRKHZDVUR\DOW\EXWKHQHYHUDFWHG
Listen to Nights With A L I C E COOPE R every weeknight on
OLNHUR\DOW\KHZDVMXVWRQHRIWKHJX\VZKRZDVDOVRD%HDWOH´
P L A N E T R O C K R A D I O 0RQGD\QLJKWVDWSP 7XHVGD\Ħ)ULGD\SP
7KLVUROOHUFRDVWHURIVXFFHVVVHQW)XUQLHUDORQJDSDWKWKDWHQGHGLQ
Alice’s new album, PA R A N O R M A L , is out now via earMusic.
UHKDE LQ WKH HDUO\ ¶V DIWHU KH DOPRVW GLHG RI OLYHU FLUUKRVLV 1RZ

“THEY WERE
“[Alice manager] Shep Gordon written a hit, get down here.’ I that lasted four or five years. collaborators. On Paranormal,
came to Toronto to see my boss, heard this wonderful Glen Buxton Instead, School’s Out has created that meant guitarists Tommy
Jack Richardson. Shep wanted guitar riff, and it took us a day to a career that’s lasted 50 years Henriksen and Tommy Denander,

LIKE A
Jack to produce Alice, but Jack knock it into shape. We recorded “Our way of working hasn’t and little-known guys like [U2’s]
took one look at the press the album at the Record Plant, changed at all – we have a Larry Mullen Jr (laughs). And we
photographs and was horrified. this community of crazy New York common language and a mutual had the original Alice Cooper
Jack sent me to NYC to turn them artists, on the bleeding edge of understanding of the character of band play with us again, and that

HIERONYMUS
down. I went to see Alice play rock recording art. We had Alice Cooper. The difference now was magical.”
Max’s Kansas City, and it was like special filters on voices, a whole is that we cast a very wide net for As told to Stevie Chick
a Hieronymus Bosch painting – orchestra, and five

BOSCH
everyone was entangled, wearing stage brats singing on
black spandex, jet-black hair and the title track. I met
fingernails and lipstick. And Alice the stage mothers in Buxton and
looked like a ghoul – pasty white the hallway, and when

PAINTING”
Cooper
skin, blood-red gums, black these women saw the with
spider-eyes. It was an insane crazy people walking producer
show – props, sets, lights, a big around they were Bob Ezrin.
on-stage pillow fight. I LOVED it. petrified for their kids.
Producer Bob Ezrin “I got back to Toronto and Then Alice came out
convinced Jack this was a cultural and scared the shit
recalls a fateful trip to movement we were seeing the out of the mums, but
NYC, reconstructing the nascence of. He said, ‘Fine, but the kids loved him –
group’s songs and you gotta produce ’em.’ They lived he was like their
on a farm in Pontiac, Michigan birthday party clown.
petrified “stage brat” where we started deconstructing “School’s Out
parents in the studio. their songs and then reconstruct- established Alice as a
ing them, until they were legitimate mainstream artist –
recording-ready. The first song before then, this was a glam rock
was I’m Eighteen, eight-and-a-half act, boys in make-up, an oddity.
minutes long when they played it People presumed they would be
to me. We tightened it up to single gone in moments. Instead, they
length, got the bass and drums to came back with an anthem which
play together and the guitars out will live forever. That was the
of the way of the vocals, and it turning point – if we’d kept making
sounded like a real record. albums like Love It To Death,
“With School’s Out, Shep maybe his career would’ve been
called me and said, ‘I think they’ve more Ramones-like, a gimmick
I
T SAYS something about the fecundity of
the early ’90s rock scene that in the
spring of 1992 Soundgarden were only
the sixth hottest band in the world. The
quartet’s third album, %DGPRWRUÀQJHU,
had been released the previous autumn
to both critical applause and the kind of
commercial impact that today would see
WKH 6HDWWOH RXW¿W FURZQHG DV WKH 1HZ
.LQJV2I5RFN%XWLQDWZRĥPRQWKVSDQ
DV VLJQL¿FDQW DV DQ\ LQ WKH UHFHQW KLVWRU\ RI
music, August and September 1991 had also
VHHQWKHUHOHDVHRI0HWDOOLFD¶VVHOIĥWLWOHG¿IWK
DOEXP Īμ7KH %ODFN $OEXP¶ī *XQV 1¶5RVHV¶
8VH <RXU ,OOXVLRQ , and ,,, Red Hot Chili
Peppers’ %ORRG 6XJDU 6H[ 0DJLN, plus Pearl
Jam’s 7HQDQG1LUYDQD¶V1HYHUPLQG. So Soundĥ
garden’s moment would have to wait.
,W ZDV 1LUYDQD¶V 1HYHUPLQG that threw
into confusion everything played with a loud,
distorted guitar. But as established British
rock magazines struggled to strike a balance
EHWZHHQWKHLUORQJĥVWDQGLQJFRYHUDJHRIVD\
Iron Maiden and Bon Jovi with this new
LPSRVVLEOHĥWRĥLJQRUHDHVWKHWLFELUWKHGLQWKH
3DFL¿F1RUWKZHVW6RXQGJDUGHQDUULYHGZLWK
both a classic rock groove as standard
issue, and the kind of street cred which in
1992 was reckoned by many to be as importĥ
ant as the music they were playing.
,W ZDV WKH\ ZKR ZHUH WKH ¿UVW 6HDWWOH
band of the day to sign with a major label
Ī$ 0ī D GHFLVLRQ WKDW ZRXOG HPSRZHU
1LUYDQDWRIRUJHWKHLURZQGHDOZLWK*HɱHQ
It was also SounGJDUGHQZKRZHUHWKH¿UVWRQ
their block to hear one of their own songs
played on FM radio, as singer Chris Cornell
did while driving down a highway in Los
$QJHOHV ZKHQ WKH LQÀXHQWLDO VWDWLRQ .524
aired Hands All Over from the group’s second
TONY MOTTRAM

album /RXGHU7KDQ/RYH, released in 1989.


Long story short, come the spring of 1992
tickets for the band’s show at the Camden
Underworld were so hot that it was advisable
WREULQJD¿UHH[WLQJXLVKHUWRWKHER[RɷFH
when picking them up.

66 PLANET ROCK
Gardeners’ world:
(from left) Kim Thayil,
Matt Cameron, Chris
Cornell, Ben Shepherd.
Shock and awe:
Chris Cornell and Ben
Shepherd feel the heat.

Quite how this writer got his hands In a club which combines an enviable
on one, I really have no idea.
On March 12, 1992 I had been a music “DESPITE TEMPERATURES UHSXWDWLRQ DV WKH YHQXH LQ ZKLFK PDQ\
RYHUVHDV URFN OHJHQGV PDGH WKHLU %ULWLVK
journalist for just one month. I wrote for the
smallest, most dysfunctional and surely most HOTTER THAN A PIZZA OVEN, GHEXWZLWKDQDUFKLWHFWXUDOEULHIRISURYLGLQJ
PD[LPXP LQFRQYHQLHQFH IRU DQ\RQH KROGLQJ
¿QDQFLDOO\LPSHULOHGWLWOHLQWKHURFNFDQRQ
,ZDV\HDUVROGDQGVRHDJHUWRSOHDVHWKDW CHRIS CORNELL BROKE THE DWLFNHW6RXQGJDUGHQ¶VĥVRQJSHUIRUPDQFH
ZDV D SHDFK )DQV PD\ KDYH KDG WR FRQWRUW
, HDUQHG P\VHOI WKH WKDQNIXOO\ VKRUWĥOLYHG
QLFNQDPH RI μ%DOGULFN¶ , ZURWH IRU WKH HABIT OF A LIFETIME BY NOT WKHLUQHFNVWRVHHSDVWWZRVXSSRUWFROXPQV
that stood right in front of the stage, but a set
monthly magazine for 11 months, during
ZKLFK WLPH WKUHH LVVXHV ZHUH SXEOLVKHG , REMOVING HIS SHIRT.” list that featured %DGPRWRUÀQJHU¶VPRVWFKRLFH
PRPHQWV LQFOXGLQJ 6HDUFKLQJ :LWK 0\
ZURWH VHYHUDO WKRXVDQGV SRXQGV¶ ZRUWK RI *RRG (\H &ORVHG 'UDZLQJ )OLHV DQG -HVXV
ZRUNIRUZKLFK,ZDVSDLGDWRWDORIVHYHQW\ $QGZKDWDSODFHWRVWDUW,Q6RXQGĥ &KULVW 3RVH EDFNĥFDWDORJXH EDQJHUV VXFK DV
quid. Less than a nobody, I was nothing. JDUGHQ¶V PXVLF ZDV D WKURE RI DQJXLVK DQG %LJ'XPE6H[DQG+DQGV$OO2YHUDQGDUDZ
%XW,GLGKDYHDWLFNHWIRU6RXQGJDUGHQ doubt, but the band themselves were not FRYHU YHUVLRQ RI %ODFN 6DEEDWK¶V ,QWR 7KH
RQĥVWDJH DW WKH VPDOOHVW YHQXH WKH\ KDYH without a sense of humour. Introducing the 9RLGĦDWLG\UHPLQGHURIWKHEDQG¶VRULJLQDO
SOD\HGLQWKHFDSLWDOEHIRUHRUVLQFH7KHJLJ VLQJOH 2XWVKLQHG QHZO\ DQ 079 VWDSOH PLVVLRQ WR VRXQG OLNH 6DEEDWK ³ZLWKRXW WKH
ZRXOG VHH WKH QRZ FODVVLF OLQHĥXS RI &KULV &KULV &RUQHOO WROG WKH  SHRSOH VWDQGLQJ SDUWV WKDW VXFN´ Ħ SURYLGHG DQ DXUDO DVVDXOW
&RUQHOOJXLWDULVW.LP7KD\LOGUXPPHU0DWW EHIRUH KLP WKDW ³WKLV QH[W VRQJ LV FDOOHG that amounted to battery. It was an assured
&DPHURQ DQG QHZ EDVVLVW %HQ 6KHSKHUG 6PHOOV /LNH7HHQ 6SLULW« QDK MXVW NLGGLQJ´ SHUIRUPDQFH WKDW IXOO\ MXVWL¿HG LWV DXWKRUV¶
VWDQGLQJWRJHWKHURQD(XURSHDQVWDJHIRUWKH 7KLV OLQH PD\ RQO\ TXDOLI\ DV D JDJ LQ DQ SRVLWLRQ DPRQJ WKH VWDQGDUGĥEHDUHUV RI WKH
YHU\¿UVWWLPH7KLVVKRZZDVH[FOXVLYHLQWKH HSLVRGHRI0UV%URZQ¶V%R\VEXWVWLOOĪ7KH PRVWVLJQL¿FDQWJXLWDUPRYHPHQWVLQFHSXQN
VHQVHWKDWLWGHOLEHUDWHO\H[FOXGHGPRVWRIWKH EDQGGLGPXFKEHWWHURQWKHWRXULQVXSSRUW 'HVSLWHWHPSHUDWXUHVHTXLYDOHQWWRWKRVHRID
SHRSOHZKRZRXOG¶YHOLNHGWRKDYHEHHQWKHUH of Louder Than Love ZKHUH LQ UHVSRQVH WR SL]]D RYHQ WKLV ZDV URFN sans FKHHVH &KULV
DQμXQGHUĥVHOO¶WHDVHUGDWHLQDQWLFLSDWLRQRIDQ DFFXVDWLRQVRIVH[LVPLQWKHVRQJ%LJ'XPE &RUQHOOHYHQEURNHWKHKDELWRIDFDUHHUE\not
$SULODSSHDUDQFHDWWKHĥFDSDFLW\7RZQ 6H[WKH\ZRXOGUHJXODUO\SOD\6SLQDO7DS¶V%LJ UHPRYLQJKLVVKLUW&RQWUDU\EXJJHU
TONY MOTTRAM

&RXQWU\&OXEDPLOHIXUWKHUXSWKHURDGLQ %RWWRPī $W WKH HQG RI WKH VHW D IHZ OLQHV /LNH VR PDQ\ 6HDWWOH DOXPQL WKH QDPH
.HQWLVK7RZQDWWKHHQGRIDQLPPLQHQWVL[ĥ IURP 3HDUO -DP¶V VHHPLQJO\ XELTXLWRXV$OLYH 6RXQGJDUGHQLVWRGD\FORDNHGLQWUDJHG\%XW
ZHHN(XURSHDQWRXU,QWKHPLQGRIDJUHHQ ZHUH DOVR LQVHUWHG LQWR 6ODYHV  %XOOGR]HUV DW WKLV PRVW LQWLPDWH RI HDUO\ DSSHDUDQFHV
LPSUHVVLRQDEOHPXVLFMRXUQDOLVWKDUGO\ZRUWK LWVFUHDWRUV¶PRVWLQWHQVHVRQJDVDQRGWRD WKH VLJKW ZDV RI D EDQG DSSURDFKLQJ WKHLU
WKHQDPHWKLVZDVDJLJIRUWKHDJHVP\¿UVW PXVLFDO FRPPXQLW\ LQWHQW XSRQ FKDQJLQJ ¿QHVWKRXUVDQGGRLQJVRQRWMXVWZLWKDQ
WDVWHRI7KH%LJ7LPH ERWKWKHIDFHDQGFRQVFLHQFHRIPRGHUQURFN LQWHQVHSDVVLRQEXWDOVRZLWKIXQ

68 PLANET ROCK
Academy Events present

ACADEMY EVENTS & TIDAL CONCERTS PRESENT

PLUS SUPPORT FROM

FEATURING 3 CLASSIC MSG VOCALISTS:


GARY BARDEN I GRAHAM BONNET I ROBIN McAULEY
CHRIS GLEN (BASS) I TED McKENNA (DRUMS) I STEVE MANN (GUITAR/KEYS)
NOVEMBER 2017
02 LONDON O2 SHEPHERDS BUSH EMPIRE
03 SHEFFIELD O2 ACADEMY NEW ALBUM OUT NOW
04 MANCHESTER O2 RITZ AVAILABLE ON
2CD, 2CD + DVD COMBO,

05 HULL CITY HALL


2 LP, DVD, BLU-RAY, DIGITAL

MICHAELSCHENKERHIMSELF.COM

Academy Events, DHP, VMS Live & Friends, By Arrangement With The Fresh Start Agency Presents

PRESENTS

With Very Special Guests

02/10 Bilston, The Robin 2 07/10 London, Boston Music Rooms


03/10 Nottingham, Rescue Rooms 08/10 Manchester, Club Academy
05/10 Sheffield, Local Authority 09/10 Newcastle, The Cluny
At The Corporation 10/10 Glasgow, O2 ABC2
06/10 Norwich, The Waterfront

ACADEMY EVENTS & VMS LIVE by arrangement with IAA and ITB present
02 DUBLIN ACADEMY
03 BELFAST LIMELIGHT
05 GLASGOW O2 ABC
06 INVERNESS IRON WORKS
07 NEWCASTLE O2 ACADEMY
09 SHEFFIELD CORPORATION ‘Coming Under Heavy fire’ Tour 2017
10 HARD ROCK HELL FESTIVAL Wednesday November 8th - WULFRUN HALL, WOLVERHAMPTON
12 HULL WELLY Thursday November 9th - QUEEN’S HALL, EDINBURGH
14 MANCHESTER ACADEMY 2 Friday November 10th - PARR HALL, WARRINGTON
PLUS SPECIAL GUESTS
15 CARDIFF Sunday November 12th - UNIVERSITY OF HULL, HULL
CARDIFF UNI Y PLAS Tuesday November 14th - EMPIRE, MIDDLESBROUGH
16 LIVERPOOL HANGAR 34 Wednesday November 15th - O2 ACADEMY, SHEFFIELD
17 COVENTRY KASBAH Thursday November 16th - O2 ACADEMY, LEICESTER
AND MORE TO BE ANNOUNCED
19 NORWICH WATERFRONT Saturday November 18th - THE JUNCTION, CAMBRIDGE
20 BRISTOL O2 ACADEMY Sunday November 19th - PYRAMIDS, PORTSMOUTH
NATIONAL TO UR 21 BRIGHTON CONCORDE 2 For ticket info go to www.blackstarriders.com
MAR CH 2 01 8 22 NOTTINGHAM ROCK CITY PRESENTED BY WCH Concerts, triple G, the gig cartel, vms live and academy events BY ARRANGEMENT WITH APA & SIREN ARTIST MANAGEment

TICKETMASTER.CO.UK & ALL USUAL AGENTS


THE CULT HEROES

EVERYONE THOUGHT DIAMOND HEAD


WERE GOING TO BE SUPERSTARS,
THE NWOBHM’S OWN LED ZEPPELIN.
E V E R Y O N E WA S W R O N G . B U T, A S
G U I TA R I S T B R I A N TAT L E R E X P L A I N S
T O P A U L E L L I O T T, E N C O U R A G E D B Y
S U P E R - FA N S M E T A L L I C A T H E I R S T O R Y
I S FA R F R O M O V E R . PORTRAIT BY ROSS HALFIN

70
70 PLANET ROCK
Diamond geezers:
(from left) Colin
Kimberley, Duncan
Scott, Sean Harris,
Brian Tatler.
I I N J U LY 1 9 8 1 
D ĥ\HDUĥROG KHDGĥ
EDQJHUWUDYHOOHGIURP/RV$QJHOHVWR
/RQGRQRQDSLOJULPDJH/DUV8OULFK
DSURPLVLQJWHQQLVSOD\HUDQGQRYLFH
GUXPPHU ZDV LQ WKUDOO WR WKH 1HZ
:DYH 2I %ULWLVK +HDY\ 0HWDO D JUDVVURRWV
VFHQH VSHDUKHDGHG E\ ,URQ 0DLGHQ 'HI
/HSSDUG DQG 6D[RQ 7KH 1:2%+0
EDQG WKDW 8OULFK ZRUVKLSSHG DERYH DOO
RWKHUV ZDV 'LDPRQG +HDG D IRXUĥ
SLHFH IURP WKH 0LGODQGV WRZQ RI
6WRXUEULGJHZKRLQDQLQWHUYLHZZLWK
6RXQGV PDJD]LQH KDG UDWKHU EROGO\
SURFODLPHG WKHPVHOYHV ³WKH QDWXUDO
VXFFHVVRUVWR=HSSHOLQ´
,W ZDV DW /RQGRQ
V:RROZLFK 2GHRQ
WKDWWKH\RXQJ'DQH¿UVWVDZKLVKHURHVLQ
WKHÀHVK+HZRXOGODWHUGHVFULEHWKHQLJKW
DV ³WUXH KHDY\ PHWDO KHDYHQ´ $IWHU WKH
VKRZWKHWHHQDJHUVFKPRR]HGKLVZD\EDFNĥ
VWDJHDQGEHIULHQGHGWKHEDQGĦVRPXFKVR
WKDWKHHQGHGXSVOHHSLQJWKDWQLJKWDWWKH
KRXVHLQ6WRXUEULGJHZKHUH'LDPRQG+HDG
JXLWDULVW%ULDQ7DWOHUWKHQVWLOOOLYHGZLWK
KLVSDUHQWV8OULFKKXQJDURXQGWKDWZKROH
VXPPHUDQGDIWHUKHUHWXUQHGWR&DOLIRUQLD
KH NHSW LQ WRXFK ZLWK7DWOHU ,Q ODWH  KH
ZURWHWRKLVIULHQGWRVD\WKDWKHKDGIRUPHG
KLVRZQEDQGQDPHG0HWDOOLFD
'LDPRQG +HDG FRXOG DQG VKRXOG KDYH
EHHQDVELJDV,URQ0DLGHQ'HI/HSSDUGDQG
0HWDOOLFD,QVWHDGWKHLUVLVDVWRU\RIDEDQG
WKDWKDGLWDOODQGWKHQEOHZLW Head boys: an
³:HPDGHVRPHEDGGHFLVLRQV´VD\V%ULDQ early DH photo
session, circa ’77.
7DWOHUEOXQWO\

R IAN TAT L E R  ZDV ERUQ DQG


UDLVHG LQ :ROODVWRQ D YLOODJH

B MXVWRXWVLGH6WRXUEULGJHDQGLW
ZDVKHUHLQWKDWKHIRUPHG
'LDPRQG +HDG ZLWK 'XQFDQ
6FRWWDVFKRROIULHQGZKRSOD\HGGUXPV7KH
EDQG ZDV QDPHG DIWHU D  VROR DOEXP E\
5R[\ 0XVLF¶V 3KLO 0DQ]DQHUD DQG LQÀXHQFHG
E\ WKH KRO\ WULQLW\ RI KHDY\ URFN Ħ =HSSHOLQ
6DEEDWK DQG 'HHS 3XUSOH 7KH OLQHĥXS ZDV
FRPSOHWHG E\ WZR RWKHU ORFDO ER\V Ħ VLQJHU
6HDQ+DUULVZKRKDGNQRZQ%ULDQVLQFHWKH\
ZHUH¿YHDQGEDVVLVW&ROLQ.LPEHUOH\
RO S S H A L F I N , B R I A N TAT L E R

7DWOHUDQG+DUULVZHUHWKHEDQG¶VOHDGHUV
DQG VRQJZULWHUV 7DWOHU¶V IDYRXULWH JXLWDULVW
ZDV-LPP\3DJH+DUULVFRXOGZDLOOLNH5REHUW
3ODQW%XWLWZDVLQUHIHUHQFHWR%ODFN6DEEDWK
WKDWWKH\FUHDWHGWKHVRQJIRUZKLFK'LDPRQG
+HDGZRXOGEHEHVWUHPHPEHUHGĦ$P,(YLO"
$V7DWOHUUHFDOOV³,ORYHG6DEEDWK¶V6\PSWRP
2I7KH8QLYHUVHDQGP\JRDOZDVWRKDYHD
ULɱHYHQKHDYLHUWKDQWKDW´$GGHGKHDYLQHVV
FDPHIURPDQLQWUROLIWHGIURP*XVWDY+ROVW¶V
0DUV7KH%ULQJHU2I:DU

72 PLANET ROCK
“NOT MANY BANDS GET
T O T H E T O P. T A L E N T
IS NOT ENOUGH.”
B R I A N T AT L E R

This epic showed ambition, but for the 'HVSLWHWKLVOLPLWHGUHDFKLightning To The


ĥ\HDUĥROG7DWOHUHPXODWLQJ=HSSHOLQ6DEEDWK NationsZDVRQHRIWKHGH¿QLQJDOEXPVRIWKH
DQG3XUSOHVHHPHGDQLPSRVVLEOHGUHDP 1:2%+0HUD,QZLWKWKHPRYHPHQW
³,WKRXJKW,KDGWREHDEULOOLDQWJXLWDULVW DW LWV SHDN GHEXW DOEXPV DUULYHG IURP NH\
OLNH 5LWFKLH %ODFNPRUH´ KH VD\V ³,¶G KDYH WR EDQGV LQFOXGLQJ /HSSDUG 0DLGHQ $QJHO
SUDFWLVHLQP\EHGURRPIRU\HDUV´$QGWKHQ :LWFK DQG *LUOVFKRRO 2QO\ 0DLGHQ¶V ZDV DV
SXQNURFNKDSSHQHG³6HHLQJWKH6H[3LVWROVRQ JUHDWDV'LDPRQG+HDG¶V6RXQGV¶1:2%+0
79 SOD\LQJ WKUHH FKRUGV ZDV D OLJKWEXOE H[SHUW *HRɱ %DUWRQ IDPRXVO\ VWDWHG ³7KHUH
PRPHQW,GLGQ¶WZDQWWRSOD\SXQNURFNEXW, DUH PRUH JRRG ULɱV LQ \RXU DYHUDJH VLQJOH
WKRXJKW/HW¶VJR,WVSXUUHGXVLQWRDFWLRQ´ 'LDPRQG+HDGVRQJWKDQWKHUHDUHLQWKH¿UVW
Kimberley, Harris, IRXU %ODFN 6DEEDWK DOEXPV´ +LV 6RXQGV
In this moment, Diamond Head were not
Tatler and Scott as
they appeared on DORQH $FURVV WKH 8. RWKHU \RXQJ PHWDO FROOHDJXH 3DXO 6XWHU H[SUHVVHG D FRPPRQO\
the inner sleeve of EDQGV LQVSLUHG E\ SXQN¶V ',< HWKRV ZHUH KHOG LQGXVWU\ RSLQLRQ ZKHQ KH VDLG ³7KH\¶UH
1982's Borrowed FXWWLQJGHPRVDQGVHOIĥ¿QDQFHGVLQJOHVSOD\ĥ JRLQJWREHVWDUV´
Time album. LQJ LQ SXEV DQG FOXEV DQG ¿QGLQJ (YHQWXDOO\ WKH EDQG JRW WKHLU PDMRU ODEHO
DFKDPSLRQLQ6RXQGV%\WKH FRQWUDFW ZLWK 0&$ $W WKH FRPSDQ\¶V
1HZ:DYH2I%ULWLVK+HDY\0HWDO LQVLVWHQFHWKHEDQG¶VVHFRQGDOEXPBorrowed
ZDV LQ IXOO VZLQJ 'LDPRQG +HDG TimeIHDWXUHGQHZYHUVLRQVRI$P,(YLO"DQG
ZHUHLQWKHULJKWSODFHDWWKHULJKW /LJKWQLQJ7R7KH1DWLRQVSOXVLQ&DOO0HD
WLPH :KDW WKH\ ODFNHG KRZHYHU VRQJWKDWZDVZULWWHQWRRUGHUDV³WKHVLQJOH´
ZDV WKH KHDY\ZHLJKW PDQDJHPHQW LQWKHVW\OHRIHDUO\)RUHLJQHU0RVWLPSUHVVLYH
WKDW 'HI /HSSDUG KDG LQ 3HWHU RI DOO ZDV WKH DOEXP¶V RSHQLQJ WUDFN ,Q7KH
0HQVFK DQG &OLɱ %XUQVWHLQ Ħ D +HDW2I7KH1LJKWZLWKHFKRHVRI=HSSHOLQLQ
WHDPZKRVHRWKHUFOLHQWVLQFOXGHG LWVPHDVXUHGSRZHU0&$¶VLQYHVWPHQWLQWKH
$&'& Ħ RU ZKLFK ,URQ 0DLGHQ EDQGZDVHYLGHQWLQWKHDOEXP¶VODYLVKJDWHIROG
HQMR\HG LQ WKH XQFRPSURPLVLQJ VOHHYH ZLWK IDQWDV\ DUWZRUN E\ 5RGQH\ 0DWĥ
5RG6PDOOZRRG WKHZV:KHQ Borrowed Time HQWHUHG WKH 8.
Instead, Diamond Head were FKDUW DW 1XPEHU  LQ 0DUFK  LW ZDV
PDQDJHG E\ /LQGD +DUULV 6HDQ¶V 7DWOHUUHFDOOV³DIDQWDVWLFPRPHQWIRUXV´
PXP DQG KHU SDUWQHU 5HJ )HOORZV ZKR (YHQVR'LDPRQG+HDGZHUHDWWKLVSRLQW
Lightning
conductor:
KHOSHGEDQNUROOWKHEDQGZLWKSUR¿WVIURPKLV DOUHDG\SOD\LQJFDWFKĥXSWRWKH1:2%+0¶V
Sean Harris FDUGERDUG ER[ EXVLQHVV $V /HSSDUG DQG WZROHDGLQJEDQGV'HI/HSSDUGKDGVWDUWHGWR
on-stage. 0DLGHQVLJQHGWRPDMRUODEHOV'LDPRQG+HDG PDNH ZDYHV LQ $PHULFD ZLWK WKHLU VHFRQG
PLVVHGRXW³:HKDG6RXQGVUDYLQJDERXWWKH DOEXP High’n’Dry DQG ,URQ 0DLGHQ KDG
EDQG´ 7DWOHU VD\V ³, ZRQGHUHG +RZ FRPH DKXJHKLWZLWKWKHLUWKLUG/3The Number Of
UHFRUG FRPSDQLHV DUHQ¶W NQRFNLQJ RQ WKH The Beast UHOHDVHG WKDW VDPH PRQWK 7KHUH
GRRU",WZDVH[WUHPHO\IUXVWUDWLQJ´ ZDVQREDFNLQJIURP0&$IRU'LDPRQG+HDG
7KHLUDQVZHUZDVWRPDNHDVHOIĥ¿QDQFHG WRWRXULQ$PHULFDRUHYHQLQ(XURSH,QVWHDG
DOEXP RQ WKHLU RZQ ODEHO +DSS\ )DFH ,WV DIWHU D ĥGDWH %ULWLVK WKHDWUH WRXU DQG DQ
VHYHQ WUDFNV Ħ $P , (YLO" ,W¶V (OHFWULF DSSHDUDQFHDWWKH5HDGLQJ)HVWLYDOLQ$XJXVW
+HOSOHVV7KH3ULQFH6XFNLQJ0\/RYH6ZHHW  WKH EDQG EHJDQ ZRUN RQ D QHZ DOEXP
$QG ,QQRFHQW DQG WKH H[SORVLYH WLWOH WUDFN 7KH LQWHQWLRQ 7DWOHU VD\V ZDV WR ³SXVK WKH
/LJKWQLQJ7R7KH1DWLRQVĦZHUHUHFRUGHGLQ ERXQGDULHV´ ,Q GRLQJ VR WKH\ RSHQHG XS
DZHHNDW:RUFHVWHU¶V2OG6PLWK\VWXGLRV7KH D3DQGRUD¶VER[
LQWLDOSUHVVLQJRIFRSLHVKDGSXUHZKLWH 7KH TXDUWHW ZHUH IDVW RXWJURZLQJ WKHLU
VOHHYHVZLWKQREDQGQDPHRUWLWOHSULQWHG KHDY\ PHWDO URRWV $V 7DWOHU H[SODLQV ³:H
KHQFH LWV DOWHUQDWLYH QDPH μ7KH :KLWH ORYHG7KH3ROLFH8¶VWarDQG6LRX[VLH$QG
$OEXP¶ 7KLV DQG DQRWKHU WKRXVDQG ZHUH 7KH%DQVKHHV:HWULHGWRSXOOLQHYHU\WKLQJ
VROGDWJLJVDQGYLDPDLORUGHU ZHFRXOG´

PLANET ROCK 73
Brian Tatler (second
from right) on-stage
with Metallica in
San Francisco, JXLWDULVW5RELQ*HRUJHWRIRUPDGXRQDPHG
December 5, 2011. Notorious. A debut album was recorded at
KXJH H[SHQVH ZLWK +DUULV GRLQJ D 5REHUW
3ODQWĥPHHWVĥ%LOO\ 6TXLHU VKWLFN RQ WKH SDLU¶V
promotional single The Swalk. But a stinging
UHYLHZ LQ .HUUDQJ Ħ LQ ZKLFK MRXUQDOLVW -RQ
Hotten goaded, “Never in a million years,
ER\V´ĦSURYHGSUHVFLHQW7KH
album was deleted three weeks

Crown
DIWHU LWV UHOHDVH LQ  ³$
complete disaster,” Tatler says.
There was, however, a plan

Jewels
Five more
%IRUERWKPHQĦUHWXUQLQJWR
the mothership. Interest in
Diamond Head had grown
since their split, largely due to
Metallica-endorsed the patronage of their biggest
NWOBHM bands. fan. At Metallica’s earliest club
shows in California, they would
Holocaust play as many as four songs
Metallica
covered the
from Lightning To The Nations,
Edinburgh neglecting to mention to their
band’s The audience that these tracks had
Small Hours been authored by a band on
on 1987’s
$5.98 EP: Garage Days
the other side of the Atlantic.
They were also reaching for the kind WKH¿UVWYLQ\OFRSLHVRI Re-Revisted. But as his group developed
of sophistication that Def Leppard would Canterbury unplayable, making into the biggest heavy metal
achieve with visionary producer ‘Mutt’ Lange it jump all the way through. All Sweet Savage act on the planet, Lars Ulrich
on 1983’s Pyromania album. As their producer, but a handful of copies were A take on was voluble in acknowledging
the Belfast
Diamond Head had Mike Shipley, who had returned to retailers, and in the debt Metallica owed to his
band’s
served as engineer on Pyromania, but the way 6HSWHPEHUĦMXVWDPRQWK Killing Time old pals.
WKDW KH DQG /DQJH ZRUNHG ZLWK /HSSDUG Ħ after Diamond Head played to appeared as 0HWDOOLFD ¿UVW FRYHUHG
³SHUIHFWLRQPRGH´DV7DWOHUFDOOVLWĦZDVIRU DQ DXGLHQFH RI  DV WKH the B-side Diamond Head on vinyl in
Diamond Head a major problem. During the RSHQLQJDFWDWWKH0RQVWHUV2I of The Four Horsemen’s
1984, recording a version of
1991 single The Unforgiven.
recording, both Colin Kimberley and Duncan 5RFN IHVWLYDO DW 'RQLQJWRQ $P , (YLO" IRU WKH ÀLSVLGH RI
Scott departed. 3DUN Ħ Canterbury limped into Saxon their Creeping Death single,
³&ROLQTXLWDQGZH¿UHG'XQFDQ´7DWOHU WKH8.FKDUWDW1XPEHU Metallica’s then dipped back into their
says with a heavy sigh. “It was terrible. We By the end of 1983, as Lars second gig catalogue when including a
should never have done it. We were under Ulrich’s Metallica were helping came as
raw take on Helpless as the
support to
pressure. Debts were mounting. But we lost revolutionise heavy music with Saxon at OHDG WUDFN RQ ¶V IJ (3
something when Colin and Duncan went. The their debut album Kill ’Em All, LA’s Whisky *DUDJH 'D\V 5Hĥ5HYLVLWHG
band fell apart after that.” Diamond Head had been A Go-Go on March 27, 1982. The following year, they took
The album, titled Canterbury ZDV ¿QDOO\ dropped by MCA. The quartet In 2011, Biff Byford sang RQ7KH3ULQFHDVWKH%ĥVLGHRI
Motorcycle Man on-stage
completed with bassist Merv Goldsworthy recorded demos for a possible during the quartet's 30th
+DUYHVWHU 2I 6RUURZ :LWK D
ĪODWHURI$25EDQG)0īDQGGUXPPHU5REELH fourth album, tentatively titled birthday celebrations. new generation of metal fans
)UDQFH 7KH UHFRUGLQJ EXGJHW FDPH LQ DW D )OLJKW (DVW DQG IHDWXULQJ D exploring their history, it made
KHIW\ ĸ 2Q D SXUHO\ DUWLVWLF OHYHO LW beautiful song, Today, that Blitzkrieg sense for Tatler and Harris to
was a triumph, a classy hard rock album both VRXQGHG OLNH 8 %XW DPRQJ Originally a place their band back into the
B-side for
modern and classic. To The Devil His Due had the big labels there were no the Geordie
present tense.
the pomp and majesty of Zeppelin’s Kashmir. takers. In early 1985, Diamond band of the $Q DOEXP EHJXQ LQ 
The title track had shades of early Queen. And Head quietly disbanded. same name, was eventually completed in
if there was one song that should have made “I felt that Sean was aiming Blitzkrieg 1993, with Tatler and Harris
was recorded by Metallica
stars of Diamond Head it was Makin’ Music, a to go solo,” Tatler explains. backed by new drummer Karl
as a B-side for 1984’s
euphoric anthem that sounded like the future “Also, we needed a break from Creeping Death single. Wilcox and bassist Pete
of rock. each other.” 9XFNRYLF ĪZKR ZHQW RQ WR
“It was a bold and adventurous album,” ,QWKHODWH¶V%ULDQ7DWOHU Iron Maiden IURQWWKHEDQG&RORXUV5HGī
Tatler says. “We probably tried too hard. Too resurfaced with a new group, Metallica Titled Death And Progress, it
covered
much too soon.” 5DGLR0RVFRZEXWIDLOHGWRJHW had all the hallmarks of classic
GETTY

Maiden’s
But the music was not the problem. That a record deal. Sean Harris, Remember 'LDPRQG+HDGĦSRZHUJUHDW
came with a manufacturing fault that rendered meanwhile, teamed up with Tomorrow PHORGLHVULɱVDSOHQW\
for Kerrang!
magazine’s Maiden Heaven
74 PLANET ROCK tribute album in 2008.
“M Y M E TA L L I C A R OYA LT I E S
It also featured guest appearances from MEAN I OWN A HOUSE AND
two big names. Megadeth’s Dave Mustaine, a
Diamond Head fan since his time in Metallica, D O N ’ T H AV E T O W O R K . ”
played on Truckin’, while Black Sabbath’s Tony
,RPPL FRĥZURWH DQG SOD\HG RQ 6WDUFURVVHG
B R I A N T AT L E R
Ī/RYHUV 2I 7KH 1LJKWī :KHQ /DUV 8OULFK
invited the band to open Metallica’s huge
RSHQĥDLUJLJDW0LOWRQ.H\QHV1DWLRQDO%RZO
on June 5, 1993, it appeared that Diamond
Head’s second act would have a triumphant
OR B R I A N TAT L E R , Diamond
opening. In reality, Tatler recalls, “it turned ,QDQRWKHU0LGODQGVĥEDVHGYRFDOLVW
into a nightmare”. 1LFN7DUWJRWWKHJLJ7KHQHZĥORRN'LDPRQG Head is now, more than ever, a
7KH EDQG ZDV XQGHUĥUHKHDUVHG IRU ZKDW
ZDV WR EH WKHLU ELJJHVWĥHYHU JLJ7DWOHU WKHQ
+HDGWRXUHGZLWK0HJDGHWKDQG7KLQ/L]]\
DQG UHFRUGHG WZR VROLG DOEXPV Ħ All Will Be
F labour of love. “I do it because I
want to,” he says, “not because
I have to. The Metallica royalĥ
VXɱHULQJIURPDERXWRIVKLQJOHVFRXOGEDUHO\ Revealed Īī DQG What’s In Your Head?
PRYH DERXW RQĥVWDJH$QG KDYLQJ FKRVHQ WR Īī,Q7DUWOHIWWKHEDQGE\PXWXDO WLHVKDYHPDGHDKXJHGLɱHUHQFHWRPHDQGP\
EHJLQWKHLUVHWZLWK$P,(YLO"ĦWKH'LDPRQG consent, and was replaced by Swedish singer OLIHVW\OH%X\LQJDKRXVH1RWKDYLQJWRZRUN´
Head song likely to be most familiar to the 5DVPXV%RP$QGHUVHQ7ZR\HDUVODWHUZLWK $QG LI 0HWDOOLFD KDYH DSSURSULDWHG VRPH RI
KHDGOLQHDFW
VDXGLHQFHĦWKH\EOHZLWDVWKH\ an album titled simply Diamond Head, Tatler KLV¿QHVWULɱVĦ6XFNLQJ0\/RYHLQWR6HHN 
did so many times before, when Sean Harris recaptured the spirit and energy of the early Destroy, To The Devil His Due into Sad But
appeared, to general hilarity, in a Grim Reaper GD\V WKH ROG PDVWHU VWLOO  FRQMXULQJ XS ULɱV 7UXHĦ7DWOHULVQRWDERXWWRELWHWKHKDQGWKDW
costume complete with a cardboard scythe. that Metallica would kill for. feeds. “Imitation,” he smiles, “is the sincerest
“It looked ridiculous,” Tatler groans. He “That album,” says the IRUPRIÀDWWHU\:LWKRXW0HWDOOLFD'LDPRQG
later discovered that the singer had decided guitarist, “has given us the Head would not be going now.”
before this show that he wanted out, and that FRQ¿GHQFHWRFRQWLQXH´ 1RZ7DWOHUVWLOOOLYHVLQ6WRXUEULGJHDV
the bizarre Grim Reaper act was intended to do the three other founders of Diamond Head.
be symbolic. “His message was: ‘Diamond 7DWOHU PDGH KLV SHDFH ZLWK &ROLQ .LPEHUOH\
+HDGLV¿QLVKHG,¶PPRYLQJRQ¶VD\V7DWOHU DQG 'XQFDQ 6FRWW ORQJ DJR .LPEHUOH\ QRZ
‘Death and progress.’ So that was that.” works for a water company, Scott in a factory.
$QGLWZDVIRUWKHQH[WVHYHQ\HDUV$VLGH ³:H¶UHJRRGIULHQGV´7DWOHUVD\V³$QGLWPHDQV
from royalties accrued when Metallica put a lot, after all that we went through together.”
their three Diamond Head covers and a new He also sees Sean Harris now and then.
UHFRUGLQJRI,W¶V(OHFWULFRQ¶VGarage Inc. Their last meaningful conversation was in
collection, Tatler made ends meet as a studio December 2011, at one
engineer and playing in tribute bands. But of four gigs held in
in early 2000, the release of Live In San Francisco as part
The Heat Of The Night, a concert of Metallica's 30th
recording from 1991, promptĥ ELUWKGD\ FHOHEUDWLRQV $IWHU MRLQLQJ WKHLU
ed him to call Harris, and hosts on stage for a blast through four classic
from this came another Diamond Head songs, the two men talked for
reunion, with an acoustic WKH¿UVWWLPHLQ\HDUV³:HGLGQ¶WJHWLQWRDQ\
(3OLYHGDWHVLQWKH8.DQG86 GLɱHUHQFHV´ 7DWOHU VD\V /DWHU WKDW QLJKW
and then the recording of a new album. he was told by Harris’s wife that the singer has
:LWK:LOFR[ DJDLQ RQ GUXPV DQG (GGLH ZULWWHQ HQRXJK VRQJV IRU  DOEXPV ³:K\
Moohan on bass, the band laid down some QRWUHOHDVHRQH"´KHDVNHG+HGLGQ
WUHFHLYH
VWURQJPDWHULDOĦ0HGXVD¶V*D]HKHDY\OLNHLW an answer.
ZDVLQWKHROGGD\V0XVLF%R[ZLWKDOLJKWĥ 8QGHUVWDQGDEO\ 7DWOHU KDV KLV UHJUHWV
er touch. By 2003 they had a whole about the past. Most of all, the way in which
album in the can when Harris, in typiĥ &ROLQ.LPEHUOH\DQG'XQFDQ6FRWWORVWRXWRQ
cally contrary fashion, told Tatler that it WKHLUGUHDPV$OVRKRZKLVEDQGFRQWULYHGWR
Diamond
should be released under a new name, grasp defeat from the jaws of victory. In the
Head’s last
Host, and not as Diamond Head. Tatler recalls man standing: end, though, what he takes from all his years
thinking, “This madness will pass.” It did not. Brian Tatler. LQ'LDPRQG+HDGLVDKDUGĥHDUQHGZLVGRP
$GHDOZDVRQWKHWDEOHIRUD'LDPRQG+HDG ³1RWPDQ\EDQGVJHWWRWKHWRS´KHVD\V
album, but not for Host. Take it or leave it. ³7DOHQWLVQRWHQRXJK<RXQHHGZKDW/DUVKDG
:KHQ+DUULVGXJKLVKHHOVLQ7DWOHUNQHZ WKDW ZLOO WR VXFFHHG:H MXVW GLGQ¶W KDYH
how this was going to play out. The album was enough of that in Diamond Head.”
lost, and this time it was Tatler who moved on.
DIAM ON D H EAD tour the UK
“I got fed up of waiting,” he says. “So I and Ireland from November 23.
WKRXJKW/HW¶VDXGLWLRQVRPHVLQJHUV«´

PLANET ROCK 75
MY PLANET ROCKS

Haunting blues,
VSDFHĥDJHURFN
ODVFLYLRXVKDLUPHWDO
VRQJVWKDW
UHPLQGKLPRI
KRUVHVKLW«
ONE-TIME GUITAR TEACHER
TURNED ALTER BRIDGE
VOCALIST MYLES KENNEDY
SELECTS THE SONGS
THAT ROCK HIS WORLD.

I L LU S T R AT I O N BY TIM MCDONAGH

Y L E S K E N N E DY LVLQWKHQLFHVWZD\SRVVLEOHREVHVVHGZLWKPXVLF
³,ORYHLW´KHGHFODUHVIURPKLVKRPHLQ6SRNDQH:DVKLQJWRQ+LV

M IHDUVRPHURDU KDV JUDFHG¿YH VWXGLR DOEXPVZLWK$OWHU%ULGJH DQG


WKUHH DV VLQJHUĥLQĥUHVLGHQFH IRU 6ODVK %XW WKLV ĥ\HDUĥROG IRUPHU
I N T E RV I E W : M A R K B L A K E

JXLWDU WXWRU SRSSHG KLV SHUIRUPLQJ FKHUU\ LQ D MD]]ĥIXVLRQ EDQG


FDOOHG&RVPLF'XVWEHIRUHFURVVLQJRYHUWRURFN¶VGDUNVLGH³-D]]
URFNVRXO5 %Ħ,OLVWHQHGWRLWDOO´KHH[SODLQV+LVPXVLFDOWDVWHVZHUHIRUJHGGXULQJ
DFKLOGKRRGVSHQWRQWKH.HQQHG\IDPLO\¶VIDUPLQUXUDO:DVKLQJWRQ7KHUDGLRLQKLV
GDG¶V WUXFN DQG KLV (QJOLVK WHDFKHU¶V FDVVHWWH FROOHFWLRQ ZHUH FUXFLDO 6R WRR ZDV KLV
LPDJLQDWLRQ³:HZHUHQ¶WULFKHQRXJKWRKDYHFDEOH´KHVD\V³$ORWRIWKHWLPH,QHYHU
VDZZKDWWKHVHJURXSVORRNHGOLNH,MXVWKHDUGWKHP7KHUHZDVPRUHP\VWLTXH«´

76 PLANET ROCK
LED ZEPPELIN
manure. I was trying to be as in a small theatre in Seattle. SDUHQWVFUD]\ZLWKWKDW¿UVW9DQ
cool as possible so they didn’t The house lights were still on, Halen album for the rest of the
think I was a total dork.” and out comes this guy who summer. I knew they didn’t
Going To California I thought was a tech. Then he write You Really Got Me, but

JEFF BUCKLEY
(on Led Zeppelin IV, 1971) picks up the guitar and starts their interpretation was wicked.
It was a struggle choosing playing Lover, You Should’ve Hearing that breakdown in the
between this and Whole Come Over, the lights dim and middle where David Lee Roth
Lotta Love. But I went with this Lover, You Should’ve it turns out it’s him. It had a makes all those weird noises and
because it was such an inspiraĥ SURIRXQGHɱHFWRQPHEXW grunts… I don’t know how to
Come Over
tion to me as an artist. I didn’t (on Grace, 1994)
,GRQ¶WWKLQN-HɱĬZKRGLHGLQ articulate this as an adult, but as
discover Zeppelin until a year ĭHYHUKDGDQ\LGHDKRZ a kid I remember thinking,
after getting Pyromania and Van I was washing dishes at LQÀXHQWLDOKH¶GEHFRPH´ Wow! It sounds like he’s having
Halen. I had an English teacher home one night when I sex in Outer Space.”

VAN HALEN
who was quite the rocker. She heard this voice coming from

MARVIN GAYE
VDLGμ<RX¶YHJRWWRKHDUWKLVĦ WKH79,WZDV-Hɱ%XFNOH\,
go back to the source.’ She lent dropped the plate and ran into
me her copy of Led Zeppelin IV. the other room. At the time,
Eruption/You Really
I took it home and my chores I was working in a music store
Got Me Inner City Blues
that day were cleaning out the and I’d sold enough guitar
strings to qualify for a free
(on Van Halen, 1978) (Make Me Wanna
horses. I put the cassette in my Holler)
boom box and went to work album, so I ordered Grace. ,¿UVWKHDUG
(on What’s Going On, 1971)
ĦDQGZKHQHYHU,KHDUDVRQJRɱ It came around Eruption as a kid
this record I can still smell horse Christmas ’94 and playing in my ,ZDVDQGP\¿UVW
manure. It was a big moment sounded like a backyard. It was on SURSHUJLJZDVSOD\LQJ¿YH
when I got to play with Jimmy breath of fresh the radio but it nights a week in this lounge with
Page and John Paul Jones air. I saw him sounded like it was a bass player who was a few
Ĭ.HQQHG\MDPPHGIRUDWRWDORI perform this song coming from Mars. years older than me. I’d started
¿YHGD\VZLWK/HG=HSSHOLQLQ 7KLVZDV¿YH getting into R&B and soul and
LQSODFHRI5REHUW3ODQWĭ years after it was he recommended What’s Going
I didn’t mention Going To released, but On. I bought it, and as soon as
California… or the horse Spokane, I heard Inner City Blues I was
Washington,
was slow
coming to new “DAVID LEE ROTH
things. I pleaded
with my mom to SOUNDED LIKE HE
buy me the
WAS HAVING SEX IN

REX, GETTY
cassette. So

OUTER SPACE.”
Kinky: she did and
David Lee I drove my
Roth. M Y L E S K E N N E DY
CHRIS WHITLEY
captivated. Later, my band The )DVWIRUZDUGWRDQG,PHW :KLWHVQDNH¶V+HUH,*R$JDLQĭ
0D\¿HOG)RXUGLGDFRYHURIWKH -RH(OOLRWWDQGWROGKLPWKH ,¶GQRWVHHQWKDWEHIRUH6KRXOG
VRQJĬRQWKHLUGHEXWDOEXP VWRU\DQGKHDFWXDOO\UHPHPĥ WKHUHEHPRUHOLFNLQJRIJXLWDUV"
1998’s Falloutĭ2XU$ 5PDQDW EHUHGWKHJDPH´ 0D\EHRQWKHQH[W$OWHU%ULGJH Accordingly
(SLFZDVFRQFHUQHGDERXWXV UHFRUG,¶OOVWDUWOLFNLQJPLQH´ (on Dirt Floor, 1998)

WHITESNAKE
WUHDGLQJRQVXFKVDFUHGJURXQG $EHDXWLIXOVRQJRQ

STEELY DAN
:HURFNHGLWWXUQHGLWLQWRD SRVVLEO\RQHRIP\
URFNDQWKHP´ IDYRXULWHDOEXPVRIDOOWLPH,
Still Of The Night ¿UVWKHDUG&KULV:KLWHO\LQWKH

DEF LEPPARD
(on 1987, 1987) Aja HDUO\¶V+HZDVWKHFULWLFV¶
(on Aja, 1977) GDUOLQJ,WKRXJKWKHZDVJRRG
,ORYHWKLV,W¶VsoEDGĥDVV
EXW,GLGQ¶WUHDOO\JHWLQWRKLP
,WDOVRKDVRQHRIP\ $Q\WLPH,IHHOKRPHVLFN
Photograph XQWLO¶¶,ZDVGULYLQJZLWK
IDYRXULWHURFNYRFDOVHYHU,¶YH RQWRXU,SXWWKLVRQ,W¶V
(on Pyromania, 1983) DIULHQGLQ/$DQGVKHSXWDirt
EHHQWROG'DYLG&RYHUGDOHGLG EHFRPHP\JRĥWRUHFRUG7KLVLV
FloorRQWKHFDUVWHUHR,W¶VMXVW
7KLVFDPHRXWZKHQ,ZDV LWLQRQHWDNH7KHUHDUHORWVRI DEULOOLDQWVRQJDQG,HVSHFLDOO\
KLPDQGKLVUHVRQDWRUĬJXLWDUĭ
LQVHYHQWKJUDGHĬDJHG OLWWOHLQÀHFWLRQV,GRZKLFK, ORYH6WHYH*DGG¶VGUXPVRORDW
ĦYHU\VWULSSHGGRZQĦUHFRUGHG
ĥĭ,KHDUGLWMXVWSULRUWR GLGQ¶WUHDOLVHXQWLOODWHUFDPH WKHHQG,GLVFRYHUHG6WHHO\'DQ
LQKLVGDG¶VEDUQ:LWKWKRVHROG
¿UVWKHDULQJ9DQ+DOHQ,WZDV IURP'DYLG7RPHKH¶VOLNHWKLV ZKHQ,ZDVUHDOO\\RXQJ:KHQ
'HOWDEOXHVJX\VLWZDVMXVW
RQWKHUDGLRDQGDJDLQLW FRROFRPELQDWLRQRI5REHUW ZH¿UVWPRYHGWR6SRNDQHZH
WKHPLQDURRPZLWKDJXLWDU
VRXQGHGVRIUHVKDQGQHZ0\ 3ODQWDQG3DXO5RGJHUV2I OLYHGLQDWUDLOHULQWKHZRRGVĦ
DQGWKLVZDVDPRGHUQWDNH
IDPLO\GLGQ¶WKDYH079VR, FRXUVH,DOVRUHPHPEHUVHHLQJ LWZDVWKHEHVWWLPHRIP\OLIH
RQWKDW6WULSDZD\DOOWKH
KDGQ¶WVHHQWKHYLGHRGLGQ¶W WKHYLGHRZKHUH$GULDQ9DQGHQĥ JURZLQJXS,UHPHPEHURQHGD\
SURGXFWLRQDQGLW¶VRQHPDQDQG
NQRZDQ\WKLQJDERXWWKHEDQG EHUJSOD\VJXLWDUZLWKDYLROLQ P\GDG¶VWUXFNGRRUEHLQJRSHQ
KLVJXLWDUDJDLQVWWKHZRUOG
,MXVWKHDUGWKHVRQJĦDQGORYHG ERZ7KDWWRRNEDOOVĦEXWKH DQG6WHHO\'DQSOD\LQJRQWKH
ĦDQGWKDW¶VZKDWWKLVVRQJ
LW'HI/HSSDUGSOD\HG6SRNDQH SXOOHGLWRɱ,PHW$GULDQ\HDUV UDGLR,ZDVRXWLQWKHZRRGV
DQGWKLVDOEXPLVDERXW´
WKDWVXPPHUEXWWKHJLJVROG ODWHULQ+ROODQGDQGKHZDVWKH SOD\LQJZLWKP\6WDU:DUV
RXWVRTXLFNO\,FRXOGQ¶WJHWD VZHHWHVWJX\7KRVH:KLWHVQDNH ¿JXUHVDQG,WKRXJKWLW
WLFNHW%XWRQWKHGD\RIWKH YLGHRVZHUHDOVRWKH VRXQGHGDZHVRPH7KDW Check out M Y P L A N E T R O C KS ,
where the world’s greatest artists
VKRZWKH\SOD\HGDFKDULW\JDPH ¿UVWWLPH,¶GVHHQ ZDVZKHQ,VWDUWHGWR
play the music that inspired them,
RIVRFFHUDJDLQVWDORFDOWHDPIRU VRPHRQHOLFNWKHLU IDOOIRU6WHHO\'DQ,
every Sunday at 7pm only at Planet
WKH6SRNDQHIRRGEDQN6RP\ JXLWDUĬEDVVLVW was seven, maybe Rock radio. A LT E R B R I D G E
PRPWRRNPH,WZDVDPD]LQJ 5XG\6DU]R HLJKW\HDUVROG play the UK in October. For more
WR¿QDOO\VHHWKHVHJX\VHYHQLI did it in the That’s weird, info visit planetrock.com.
WKH\ZHUHMXVWSOD\LQJIRRWEDOO YLGHRIRU ULJKW"´

’Snake
charmer:
David
Coverdale

PLANET ROCK 79
War machine: Black Sabbath
(clockwise from top) Geezer
Butler, Tony Iommi, Ozzy
Osbourne, Bill Ward.
THE COVER STORY
REX

PLANET ROCK 81
Children of the grave:
Black Sabbath at
London’s Hammersmith
Odeon, June 1978.

Outside St Giles-in-
the-Fields church
PL
in London, 1970.
TO N Y I O M M I I S F I N I S H I N G U P a quick bite to eat, washed down with PLQXWHV¶ZDONIURP9LOOD3DUNKRPHWR$VWRQ9LOOD)&LQDVWULFW,ULVK
a couple of glugs of Kronenbourg 1664. Black Sabbath’s guitar player and Catholic household. His parents, originally from Dublin, were fans of
mainstay has journeyed down from his home in the Midlands for the ¶V,ULVKVLQJHU5XE\0XUUD\KLVEURWKHUVLQWKUDOOWR(OYLV3UHVOH\(GGLH
launch of Black Sabbath’s latest reissue box set, The Ten Year War, and is &RFKUDQDQG%XGG\+ROO\ZKLOHKLVVLVWHUVIDQFLHG&OLɱ5LFKDUG*HH]HU
SUHSDULQJKLPVHOIWRUHYLVLWWKHPDNLQJRIWKHEDQG¶V¿UVWWZRDOEXPVLQ bought records by jazz trumpeter Dizzy Gillespie and the Chicago bluesĥ
particular. Both were recorded at Regent Sound Studio in nearby men, Muddy Waters’ At Newport 1960 being a favourite.
'HQPDUN6WUHHWWKH¿UVWIDPRXVO\LQWKHVSDFHRIWZRGD\V,RPPLKDV “There was always a lot of music around,” recalls Butler. “We had the
QRWEHHQEDFNWRWKHVWXGLRIRUWKHEHVWSDUWRI¿YHGHFDGHVDQGZKLOH Birmingham Odeon where big bands like The Beatles played. Midnight
the studio sign still hangs above the door, today it has been transformed City was the big soul place where Ozzy went when he was a skinhead.
LQWRDJXLWDUVKRS7KHEDVHPHQWĦWKHURRPZKHUH,RPPLIURQWPDQ Then there was the Penthouse and Mothers for rock bands. You also had
Ozzy Osbourne, bassist Geezer Butler and drummer Bill Ward ORWV RI SHRSOH SOD\LQJ PXVLF DW KRPH 7KH -DPDLFDQV IRU

“YOU F**K
¿UVWFRQJUHJDWHGWRUHFRUGEDFNLQ2FWREHUĦLVQRZDFOXE LQVWDQFH ZHUH DOZD\V SOD\LQJ UHJJDH DQG EOXH EHDW VR , XVHG
$V,RPPLSUHSDUHVWROHDYHWKHUHVWDXUDQWDQXQDVVXPLQJ to like Prince Buster as well. Then, next door to us, there was

EVERY
couple sitting at the neighbouring table get up and ask whether DQ ,QGLDQ IDPLO\ DQG WKH\ SOD\HG VLWDU PXVLF:H KDG DFFHVV
KHZLOOSRVHIRUDSKRWRJUDSKZLWKWKHP³,VDZ to everything.”
you on that tenth anniversary tour back in ’78 at
+DPPHUVPLWK2GHRQ´RɱHUVWKHFKDS³,ZDVVR GROUPIE UNTIL YOUR DICK’S -RKQ μ2]]\¶ 2VERXUQH DWWHQGHG %LUFK¿HOG
5RDG6HFRQGDU\0RGHUQZKHUH7RQ\,RPPLZDV
into you back then!” adds his wife. Ever gracious,
,RPPLREOLJHVZLWKDSKRQHVQDSDVWKHZDLWLQJ ABOUT TO FALL OFF, DRINK in the year above him. The former displayed an
aptitude for acting rather than academia, while
VWDɱORRNRQ³,VKHIDPRXV"´DVNVDZDLWUHVV³1R
but he often gets mistaken for a famous guitar player,” comes EVERY DRINK the latter applied himself and was obsessed with
music from an early age. For all four future members of Black
the reply. “Oh, OK,” she says, with a disappointed tone.
Rather than calling for a car to drive him the quarter of AND TAKE Sabbath, however, employment prospects were not so much
EOHDNĦOLNH'HWURLWSRVWĥZDU%LUPLQJKDPHQMR\HGDZHOFRPH
D PLOH WKURXJK 6RKR WR 5HJHQW 6RXQG ,RPPL SOXPSV IRU D
EVERY DRUG.
¿YHĥPLQXWH ZDON RQ ZKDW LV D ZDUP -XO\ HYHQLQJ$V ZH VWUROO
HFRQRPLFXSWXUQWKDQNVWRWKHFDUPDQXIDFWXULQJLQGXVWU\ĦDV
OLPLWHG :DUG 2VERXUQH DQG ,RPPL ĪZKRVH ,WDOLDQ SDUHQWV
SDVWWKH&UREDUĦWKHFHOHEUDWHGURFNZDWHULQJKROHĦDWRXULVWLV
RXWVLGHWKHEDUWDNLQJDSKRWRJUDSKRIKLVIULHQGV,RPPLZDONV AND WE RZQHGDVKRSRQ3DUN/DQHīDOOHQGXUHGGHDGHQGMREVĦ2]]\
IDPRXVO\DVDFDUĥKRUQWHVWHUEHIRUHWDNLQJDMRELQDQDEDWWRLU
swiftly across the shot and, as we move away from the bar, we
chuckle at the prospect of the fan having inadvertently caught DID. " “You just knew that you were most likely to end up in a
factory,” explains Geezer. “That was just the reality of the world
the moustachioed Sabs guitar player in one of his holiday snaps. ZH ZHUH OLYLQJ LQ 1RQH RI XV KDG DQ\ PRQH\7KH FRUQHU RI
³%OLPH\7KH SODFH KDV FKDQJHG D ELW´ VD\V ,RPPL DV ZH ZKHUH,OLYHGZDVVWLOODERPEVLWHZKHUHLWKDGEHHQERPEHGLQ
DUULYHDW5HJHQW6RXQG)ROORZLQJDĥPLQXWH¿OPHGLQWHUYLHZZLWK%LOO WKHZDU$OO,ZDVWKLQNLQJZDV,ZDQWWROHDYHVFKRROZKHQ,¶PDQG
Ward, where the drummer talks through chunks of Sabbath’s history, WKHQ,KDYHWRJHWWKLVMREWKDWZLOOODVWPHXQWLO,GLH,FRXOGQ¶WVWDQG
,RPPLZDONVWKURXJKWKHSDFNHGEDUZKHUHMRXUQDOLVWVPHGLDW\SHV that idea so that was driving me on.”
and fans have gathered to hear him discuss the past further. What *HH]HUVHFXUHGD¿YHĥ\HDUDSSUHQWLFHVKLSLQDQDFFRXQWDQF\¿UP
IROORZVLVDQHQWHUWDLQLQJĥPLQXWHFRQYHUVDWLRQZKHUHLQWKHJXLWDULVW ³UXQQLQJ HUUDQGV PRVWO\ , JRW WKH VDFN EHFDXVH , FRXOG QHYHU JHW WR
recalls the events that shaped the band’s most formative period, his tales ZRUNRQWLPH7KHVWUDZWKDWEURNHWKHFDPHO¶VEDFNZDVZKHQ,FDPH
ranging from skirmishes with marauding skinheads to the band’s endless in at four o’clock in the afternoon, pissed out of my brains, and we were
R O S S H A L F I N , C H R I S WA LT E R

EDWWOHZLWKWKHSUHVVDQG7KH(QGĦWKHEDQG¶V¿QDOWRXU+HGRHVVR GXHWR¿QLVKDW¿YH,GLGQ¶WWHOOP\GDGIRUPRQWKVDQGNHSWRQSUHWHQGĥ
with good grace and even better humour. Asked about a photo session LQJWKDW,ZDVJRLQJWRZRUN7KHQ,UHIXVHGWRFXWP\KDLUZKLFKPDGH
ZKLFKWKHIRXUĥSLHFHXQGHUWRRNLQDQHLJKERXULQJFKXUFKJUDYeyard in it impossible for me to get a job.”
the company of a tramp, he smiles and quips: “That was Bill!” Humour ,Q WKLV HQYLURQPHQW PXVLF RɱHUHG DQ REYLRXV HVFDSH WKRXJK DOO
has always been a huge part of the Sabbath story, forged in the deep four wannabe musicians toiled in bands that initially struggled to even
IULHQGVKLSWKDWGH¿QHGWKHLUHDUO\GD\V« PDNHLWWRWKDW¿UVWJLJ7RQ\,RPPLZDVWKHH[FHSWLRQ$\HDUROGHU
WKDQ 2]]\ ZLWK D UHSXWDWLRQ DV D ¿JKWHU WKH ĥ\HDUĥROG JXLWDULVW ZDV
S TO N I S A L A R G E LY ZRUNLQJĥFODVVDUHDRI%LUPLQJKDP'XULQJ driven enough to parlay his way into The Rockin’ Chevrolets, a beat
:RUOG:DU ,, LW VXɱHUHG HQGOHVV ERPE GDPDJH %\ WKH PLG combo with a set based on The Shadows and early rock’n’roll. Armed
’60s, it was a multicultural neighbourhood humming with a with a set of matching red lamé suits, they soon established themselves
YDULHW\ RI PXVLF 7HUHQFH μ*HH]HU¶ %XWOHU JUHZ XS MXVW ¿YH as local heroes and began gigging throughout Birmingham.

PLANET ROCK 83
In fact, both Iommi and Ward were more seasoned than their VWULQJV E\ GRZQĥWXQLQJ KLV JXLWDU WR EH DEOH WR IUHW PRUH HɱHFWLYHO\
future bandmates, serving apprenticeships in a number of other local :KLOHPRVWJXLWDULVWVRIWKHGD\XVHGĥLQFKJDXJHVWULQJVDVWKHLU
EDQGV ,Q HDUO\ ¶ WKH SDLU MRLQHG &DUOLVOH RXW¿W 0\WKRORJ\ ZKR KDG top strings, Iommi sought to further minimise the pressure on his right
attracted an ardent following and who supported fellow Brummies The KDQGE\XVLQJEDQMRVWULQJVĪDSSUR[LPDWHJDXJHī<HDUVODWHUKLV
0RYHZKHQWKH\URGHLQWRWRZQRQWKHEDFNRIWKHLUODWHVWVLQJOH)LUH GHFLVLRQWRXVHWKLQQHUVWULQJVZRXOGEHDFNQRZOHGJHGDVUHYROXWLRQDU\
%ULJDGH7KHGXR¶VWLPHLQ0\WKRORJ\ZDVFXWVKRUWKRZHYHUZKHQWKH ZLWK:HOVK FRPSDQ\ 3LFDWR SURGXFLQJ D WKLQĥJDXJH VWULQJ UDQJH ZLWK
band were busted for possession of cannabis resin in July ’68, forcing the guitarist. Technological innovations aside, Iommi also had to deal
,RPPLDQG:DUGWREHDWDKDVW\UHWUHDWEDFNWRWKHLUUHVSHFWLYHSDUHQWV¶ with the physical limitations of his injury.
KRPHV0HDQZKLOHIROORZLQJDWKUHHĥPRQWKVHQWHQFHLQ:LQVWRQ*UHHQ ³,¶GSOD\DORDGRIFKRUGVDQG,¶GKDYHWRSOD\WKH¿IWKVEHFDXVH,
3ULVRQIRU³EUHDNLQJDQGHQWHULQJDQGVWHDOLQJJRRGVWRWKHYDOXHRIĸ´ FRXOGQ¶W SOD\ IRXUWKV EHFDXVH RI P\ ¿QJHUV´ H[SODLQV ,RPPL RI KLV
WKHĥ\HDUĥROG2]]\KDGMRLQHGUK\WKPJXLWDULVW*HH]HULQWKHVKRUWĥ XQLTXHDSSURDFKWRSRZHUFKRUGV³7KDWKHOSHGPHGHYHORSDVW\OHRI
OLYHG5DUH%UHHGZKRVHSRVWĥ3LQN)OR\GDVSLUDWLRQVVDZWKHPHPSOR\D playing, bending the strings and hitting the open string at the same time
VWUREHDQGDERQJRSOD\HU2]]\KRZHYHUKDGDIXQGDPHQWDOSUREOHP MXVWWRPDNHWKHVRXQGZLGHU*HH]HUZRXOGDOVREHQGWKHVWULQJVVRZH
ZLWKWKHEDQG³%DVLFDOO\ZHZHUHVKLW´KHVWDWHVEOXQWO\ MXVWGHYHORSHGWKLVXQXVXDOSOD\LQJVW\OH´
³,WKDGQ¶WUHDOO\ZRUNHGRXWIRUDQ\RIXVLQDQ\RIWKHEDQGVZH¶G ³,MXVWEDVLFDOO\FRSLHGZKDW7RQ\ZDVSOD\LQJ´DGGV*HH]HU³%DFN
EHHQLQ´DGPLWV%XWOHU³:HGLGQ¶WVHHPWR¿WLQ´,Q$XJXVW2]]\ then, the bass player was supposed to do all these melodic runs, but I
7RQ\*HH]HUDQG%LOO¿QDOO\WKUHZLQWKHLUORWWRJHWKHU7KHEDQG¶V¿UVW GLGQ¶WNQRZKRZWRGRWKDWEHFDXVH,¶GEHHQDJXLWDULVWVRDOO,GLGZDV
UHKHDUVDO Ħ ZKLFK DOVR IHDWXUHG VOLGH JXLWDULVW -LPP\ 3KLOOLSV DQG VD[ IROORZ7RQ\¶VULɱ7KDWPDGHWKHVRXQGKHDYLHU´
SOD\HU $ODQ μ$FNHU¶ &ODUNH Ħ VDZ %XWOHU VKLIW IURP JXLWDU WR EDVV ,I%XWOHUDQG,RPPL¶VLQWHUORFNLQJVW\OHSURYLGHGWKHIRXQGDWLRQRI
³7KHUHZHUHWZRJXLWDULVWVVR,KDGWRFKDQJHLQVWUXPHQW´KHH[SODLQV WKHEDQG¶VVRXQGWKHQLQ%LOO:DUGĦDGHYRWHHRI*HQH.UXSD%XGG\
³,ERUURZHGDEDVVIURPVRPHRQHEXW,GLGQ¶WNQRZKRZWRSOD\LWDQG 5LFKDQG/RXLH%HOOVRQĦWKH\DOVRKDGDGUXPPHUZKRFRXOGJHQXLQHO\
LWRQO\KDGWKUHHVWULQJV´ VZLQJ³1RERG\SOD\HGGUXPVLQDURFNEDQGOLNH%LOOGLG´QRGV%XWOHU
³*HH]OHDUQWWRSOD\EDVVDPD]LQJO\TXLFNO\´UHFDOOV7RQ\ ³+HDGGHGDGLɱHUHQWGLPHQVLRQDQGVRGLG2]]\+HZRXOGGR

“IT WAS
³+HMXVWKDGWKLVZD\RISOD\LQJWKDW¿WWHGZKDWZHZHUHGRLQJ WKHVHULGLFXORXVWKLQJVĦOLNHSDLQWLQJKLVIDFHWRJHWDUHDFWLRQ
DQGRXUVRXQGEHJDQWRGHYHORSSUHWW\TXLFNO\´ IURPWKHFURZG$QGZH¶GDOOEHVWRQHGRXWRIRXUPLQGVVR

F**KING
-HWWLVRQLQJ3KLOOLSVDQG&ODUNHWKHIRXUĥSLHFHWUDGHGWKHLU ZH¶G¿QGLWKLODULRXV´
FOXQN\PRQLNHURI3ROND7XONIRUWKHQDPH(DUWK ³2]]\IRXQGLWKDUGWRSD\DWWHQWLRQEHFDXVH
and secured management from promoter Jim
6LPSVRQ )RUPHUO\ WKH WUXPSHW SOD\HU RI HORRIBLE. WE WERE LITERALLY KH¶G JHW ERUHG HDVLO\ DQG EXJJHU Rɱ GRZQ WKH
SXE´UHFDOOV,RPPL³6RZH¶GZRUNRXWWKHPXVLF
EHDWĥFXPĥSURJUHVVLYH W\SHV /RFRPRWLYH -LP
Simpson had opened a new club, Henry’s Blues STARVING. SOMETIMES I’D CRY DQG WKHQ KH¶G ZRUN RXW WKH PHORGLHV RQ WRS RI
what we’d done musically, along with certain lyrics.
House, which gave the band a few early gigs.
³*LJVZHUHKDUGWRFRPHE\EHFDXVHZHZHUHDEOXHVEDQGDQG BECAUSE 6RPHKRZKHDOZD\VPDQDJHGWRPDNHLWZRUN´
³(YHU\RQH NQRZV 7KH %HDWOHV ZHUH P\
SHRSOHZDQWHGVRXOPXVLF´UHFDOOV,RPPLZKRQHDUO\GHUDLOHG
(DUWK¶VFDUHHUZKHQKHMRLQHG-HWKUR7XOOEULHÀ\LQ'HFHPEHU I’D BE SO KHURHV´VD\V2]]\³,JRWP\PHORGLHVIURPWKHP
7KRVH PHORGLHV VKRRN WKH IXFNLQJ SODQHW DQG
¶³%XWZHNQHZWKDWZHKDGVRPHWKLQJXQLTXHTXLWHHDUO\RQ´
Key to the band’s emerging sound was Iommi’s distinctive
SOD\LQJ VW\OH WKDW KH¶G GHYHORSHG LQ WKH ZDNH RI D
HUNGRY.” that’s what I brought to Sabbath. I wasn’t very good
ZLWKZRUGV*HH]HUZDVWKRXJK´,QIDFW2]]\ZRXOG
ODWHU EH GLDJQRVHG ZLWK G\VOH[LD DQG DWWHQWLRQ GH¿FLW
ZHOGLQJDFFLGHQWDWWKHDJHRILQZKLFKWKHWLSV hyperactivity disorder.
RI WKH PLGGOH ¿QJHUV RI KLV ULJKW DQG IUHWWLQJ
hand were severed. Rushed to hospital with the U R N U P AT T H E S T U D I O ,
SOXJLQSOD\DQGIXFN
EODFNHQLQJ WLSV LQ D SODVWLF EDJ KH ZDV WROG Rɱ7KDW¶VZKDWZHWKRXJKW\RXKDGWRGRLQ
that restorative surgery was not an option. WKRVHGD\V´VD\V2]]\2VERXUQHUHFDOOLQJWKH
³7KH\VDLGμ:HOO\RXPLJKWDVZHOOJLYH recording of Sabbath’s debut album at Regent
up.’ It was no big deal to them as playing 6RXQG ³,Q  KRXUV LW ZDV GRQH7KHQ ZH ZHUH Rɱ WR FDWFK D IHUU\
guitar wasn’t a proper job. I, however, was EHFDXVH ZH ZHUH RQ RXU ZD\ WR 6ZLW]HUODQG WR SOD\ WKH IXFNLQJ
GHYDVWDWHG´ UHFDOOV ,RPPL ³%XW WKH +LUVFKHQ%DULQ=XULFK´
PDQDJHUZKR,ZRUNHGIRUDWWKHIDFWRU\ 7KH+LUVFKHQ%DUĦZLWKDVOLPDXGLHQFHWKDW,RPPLUHFDOOV
EURXJKWURXQGWKLV'MDQJR5HLQKDUGW FRQVLVWLQJRIDQHFFHQWULFJHQWOHPDQZKROLNHGWRVWDQGRQKLV
record and told me to listen to it. KHDGDQGDKRRNHUVWRRGDWWKHEDUĦSURYLGHGWKHÀHGJOLQJIRXUĥ
When I realised he was playing piece with the suitably unforgiving environment in which to
ZLWKWZR¿QJHUVWKDWVWDUWHGPH GHYHORS WKHLU VRXQG (TXDOO\ VLJQL¿FDQW Ħ DQG ZLWK D VRPHĥ
Rɱ,KDGDSXUSRVHWKHQ´ ZKDW PRUH DSSUHFLDWLYH DXGLHQFH Ħ ZDV WKH 6WDUĥ&OXE LQ
Inspired by the fact that +DPEXUJ 6\QRQ\PRXV ZLWK7KH %HDWOHV¶ ¶ UHVLGHQF\ LW
G E T T Y , C H R I S WA LT E R

WKH%HOJLDQMD]]JXLWDULVWKDG ZDVLQGHFOLQHZKHQ6DEEDWKSLWFKHGXSLQ$SULO¶
recovered from injuries he ³,WZDVIXFNLQJKRUULEOH:HZHUHOLWHUDOO\VWDUYLQJ6RPHĥ
KDGVXVWDLQHGDJHGLQD¿UHLQZKLFK WLPHV,¶GFU\EHFDXVH,¶GEHVRKXQJU\´ZLQFHV*HH]HU%XWOHUD
KHORVWKLVWKLUGDQGIRXUWK¿QJHUVLQ YHJHWDULDQ ZKR VWUXJJOHG ZLWK WKH *HUPDQLF PHQX ³%XW ZH
a bid to resume playing Tony created FRXOGQ¶WJHWDQ\JLJVLQ(QJODQG7KHRQHSODFHWKDWZHFRXOGJHW
DSDLURIIDOVH¿QJHUWLSVZLWKSODVĥ DUHVLGHQF\ZDVWKH6WDUĥ&OXE<RXFRXOGQ¶WDɱRUGWKH
WLF REWDLQHG IURP D )DLU\ /LTXLG Bass face: petrol to go for just one gig so you had to stay there for
bottle, later reinforcing them Geezer brings WZR RU WKUHH ZHHNV:H XVHG WR SXVK WKH YDQ DFURVV
with leather. He also loosened his the thunder at (XURSHPRVWRIWKHWLPH´
Hamburg’s Star-
Club in 1969.
84 PLANET ROCK
Early daze: Sabbath
at the outset of their
recording career.

Says as revisit the eight classic albums


made by the band’s original line-up during their first decade together.
Cue tales of hobbits, hauntings and heavy metal… WOR D S :

ULY 13, 2017. At the Gibson Guitar UK showroom in Eastcastle Street, central
London, a panel of sound experts are sat on-stage unveiling The Ten Year War – the new
limited edition Black Sabbath box set. Among them are sound engineer Andy Pearce,
A last-minute request for a (a rumination on faith which
whose job it has been to track down the tapes of the albums made by the band’s original line-up
final track to round out the appears to boast a Christian
in order to remaster them – a process he agrees is akin to, in artistic terms, restoring an Old running time on the album message), the cantering
Master. To Pearce’s left and sporting a bright Hawaiian-styled shirt sits ‘Colonel’ Tom Allom, the yielded Paranoid (see main Children Of The Grave and
engineer on Sabbath’s first three albums, and producer Rodger Bain’s most trusted associate feature). The track propelled the space-trucking Into The
during those sessions. Since he worked with Sabbath, Allom has carved out his own reputation the LP, which would sell four Void. Iommi’s talent as a
as a producer of note, most specifically thanks to his work with Judas Priest, whose latest album million copies in the US, to guitarist is also on show in
he is currently working on. Allom provides insight into the band’s most formative period, outlining the top of the UK chart. a pair of instrumental inter-
the seriousness with which the four-piece approached their music. ludes, Embryo and Orchid,
while the balladry of Solitude
As well as discussing the process that has led to the new versions of Sabbath’s first eight
reveals the band’s melodic
albums, those in attendance are given a chance to hear the high definition audio versions of the prowess. Master Of Reality is
music housed on the USB ‘cruci-stick’ that comes with the box. What becomes crushingly the sound of a band becom-
obvious during the proceedings is just how timeless the band’s first run of albums – all eight of ing increasingly comfortable
which are revisited below – actually are… in their studio surroundings.

just reading The Hobbit at 1970 to record the follow-up


the time.” N.I.B., too, boasts with producer Rodger Bain.
humble origins: “It became The cornerstone of the album
known as Nativity In Black was War Pigs which had been
but the title came from Bill in their live set for over a
Ward’s beard which looked year. Other nihilistic anthems Master
like a pen nib,” says Butler. included the frenetic Electric
Dismissed by critics – “like Funeral, the crunching Iron Of Reality
Cream, but worse,” sneered Man and the lurching Hand
(Originally on Vertigo, 1971)
Lester Bangs in Rolling Stone Of Doom, while the more
– Black Sabbath stayed in the light-hearted Fairies Wear +++++
US charts for over a year and Boots was inspired by a Sabbath’s third album starts

Black Sabbath sold a million copies. “We run-in with some skinheads with Sweet Leaf, a track
introduced by a looped,
Black Sabbath
were making dark music for following a show on the
(Originally released on Vertigo, dark days,” reflects Ozzy. South Coast (see Tony Iommi phlegmy cough cut short by
one of Tony Iommi’s most
Vol.4
1970) interview on page 93 for the (Originally on Vertigo, 1972)
trenchant riffs. To many, it
++++ gory details). “Musically, we
felt more confident,” admits is the quintessential stoner +++++
While Cream, Led Zeppelin anthem, a point borne out If booze and heavy dope use
Butler, “and we tried out dif-
and Deep Purple were in the by Sabbath’s consumption helped fuel Sabbath’s early
ferent things.” Contemplative
vanguard of the heavy music of hashish during their LPs, Vol. 4 is their cocaine
semi-acoustic Planet Caravan
emerging from the British early days. “Actually, the album. Recorded at the
typified their newfound
underground scene in the title comes from a packet of Record Plant in Los Angeles
sense of adventure: “I sang
late ’60s, no one sounded as cigarettes I’d picked up called while the quartet cheerfully
it through a Leslie speaker,”
heavy as Black Sabbath. Sweet Afton,” explains Butler. indulged in various acts
recalls Ozzy. “Then Rodger
“Everybody describes their “I didn’t know what to write of self-destruction in their
Bain used an oscillator on it –
first album as the source of about and there was this rented Bel Air mansion, Ozzy
whatever that is.”
heavy metal,” says producer slogan on the side of the wanted to call the album
Rick Rubin, “but it’s actually box that mentioned, ‘Snowblind’ after the song
pre-heavy metal because Paranoid ‘It’s the sweet leaf’, so they’d written in tribute to
it has different elements I just went from there, the band’s newfound drug of
(Originally on Vertigo, and the song started
on there: blues, jazz and choice (check out Osbourne’s
psychedelia. It has it all.” The 1970) to work on a totally less-than-subtle whisper
band’s signature tune sets +++++ different level.” after the first verse). The label
an ominous tone, followed After the quite Sweet Leaf’s heavy wouldn’t have it, changing the
by harmonica-soaked heavy unexpected success musical invective album’s name to Vol. 4, and
blues march The Wizard – of their debut, was matched Sabbath had to make do with
said to have been written Sabbath returned elsewhere – a simple credit on the sleeve:
after several LSD-inspired to London’s Regent most notably “We wish to thank the great
visions. “It wasn’t,” says main Sound Studios for a on After COKE-Cola company of
lyricist Geezer Butler. “I was five-day stint in June Forever Los Angeles”.

PLANET ROCK 85
California
screaming:
Ozzy at 1974’s
they’d effectively run out of to Criteria Studios in Miami
Cal Jam.
money. What followed was in summer ’76 to record.
a lengthy legal battle: the Meanwhile, in the UK, punk
wrangles gave the LP its title. was beginning to explode.
The band’s anger is evident “We were 26 years old and
on Sabotage, most notably everyone seemed to decide
on The Writ where Ozzy asks, we were past it!” says Geezer.
“Are you Satan? Are you “The whole thing got to us.”
man?”, quite possibly in Informed by this sense of
reference to the band’s confusion, Technical Ecstasy
former handlers. Opener Hole is the sound of Sabbath
In The Sky and the crunching trying to make a grown-up,
Symptom Of The Universe radio-friendly rock record.
illustrate that, for all their In parts, it works – most
problems, Sabbath’s power notably on It’s Alright (sung Technical Ecstasy and left
remained undimmed. by Bill Ward). If another band the band, briefly replaced
had released this album it by Dave Walker (ex-Savoy
may have been met with a Brown/Fleetwood Mac). He
modicum of acclaim, but for returned to the fold just as
diehard Sabbath fans, the the band entered Toronto’s
weight of a considerable Interchange Studios. Flatly
legacy counted against it. refusing to sing the songs the
band had been working on,
Osbourne insisted they write
new material but, out of their
minds, Sabbath struggled.
“I’d go down the studio and
Despite their spiralling tackled the band’s grow- I heard what sounded like a
addictions, musically Vol. 4 ing alcoholism. Housed in
jazz band playing. Is this real-
is another ambitious outing. a phantasmagoric sleeve,
The band’s heavy side is Sabbath Bloody Sabbath was Technical ly Black Sabbath? I’d just fuck
off,” recalls Ozzy. With time
showcased on Supernaut
and Tomorrow’s Dream, but
also the product of Clear-
well’s creepy atmosphere. Ecstasy running out, they recorded
what they could and released
the guitar intro on St. Vitus “We rehearsed in the armoury (Originally on Vertigo, 1976) this patchy 13-track LP, its
and one night I was walking
Dance possesses a jaunty,
+++ title track a clear misnomer.
Led Zeppelin-flavour, while
the evocative Laguna Sunrise
down the corridor with Ozzy
and we saw this figure in a
Beset by ongoing business
problems – “We hired lawyers
Never Say Die! “We felt lost and worthless,”
Butler later noted. Black
is a neo-classical Iommi black cloak,” recalls Iommi. (Originally on Vertigo, 1978)
to deal with our managers Sabbath’s least successful
“We followed this figure back
instrumental. The melancholy
to the armoury and there was
and they ripped us off even ++ album to date, it was released
Changes is ostensibly a love more!” spits Geezer Butler Ozzy Osbourne was vocal in September 1978. Ozzy
song, but, in the context of no one there. Whoever it was
– and increasing musical about the band’s lack of was fired by the band eight
Sabbath’s own developing had disappeared into thin
uncertainty, Sabbath headed direction in the wake of months later.
turmoil, it also feels like an air! The people that owned
ode to the end of innocence. the castle knew all about this
ghost: ‘Oh, that’s the ghost
of so-and-so.’ We were like,
What?! We spent our time
there trying to frighten each
other. In the end we were Your at-a-glance guide to Sabbath’s heavyweight mega-set The Ten Years War.
so petrified we had to drive
home every night rather than OME TWO YEARS in the making, The  The super-rare The Ten Year War
stay there!” Ten Year War is housed in a handsome brochure, reproduced from the original
box with artwork designed by Shepard publication issued around the release of the
Fairey for the band’s final run of shows earlier Never Say Die! album. It details the endless
this year. In many respects, it is the ultimate slatings received by Sabbath during their first
reissue of the band’s most significant decade – hence the box set’s name.
albums. Here is what you’ll find in the
Sabbath Bloody limited edition box:
 A hardback book, featuring
accolades from the cream of
Sabbath   Eight vinyl LPs reproduced rock royalty, coupled with
(Originally on Vertigo, 1973) in their original sleeves, official and candid iconic
pressed on 180-gram photography of the band
+++++
After an ill-fated start to the splatter-coloured vinyl – during their 1970s tours,
album in LA – where Iommi each album containing its recording sessions and pho-
developed writer’s block –
Sabbath moved to Clearwell
Sabotage  own unique colour scheme. to-shoots.

Castle in Gloucestershire, (Originally on Vertigo, 1975)  Two reproduction 7-inch  A reproduction of the Tenth
re-energising their guitarist. +++++ singles: The Japanese release of Anniversary World Tour 1978
The result was Sabbath’s Having played California Jam Evil Woman (Don’t Play Your Games Official Programme.
most ambitious effort to in front of 200,000 fans and With Me)/Black Sabbath, and the Chilean
 A reprinted tour poster from Sabbath’s
date. The title track led into a TV audience of millions on Paranoid/The Wizard, of which only 100 cop-
1972 Seattle Centre Arena show.
an expansive set as Butler’s April 6, 1974, Sabbath were ies of the original radio promo were pressed.
lyrics contemplated the now one of the biggest bands
mysteries of birth and DNA in in the world. Now managed  Crucifix shaped Black Sabbath USB The T E N Y E A R WA R box set is out
A National Acrobat and Spiral by Patrick Meehan, who had stick – aka the ‘cruci-stick’ – which can serve via BMG on September 29 and
Architect, respectively. Killing taken over from Jim Simpson, as a pendant and contains MQA high defini- available through www.tenyearwar.com
Yourself To Live, meanwhile, the quartet discovered that tion audio of the first eight Sabbath albums.

86 PLANET ROCK
,I 6DEEDWK¶V VROH PRGH RI WUDQVSRUW Ħ ,RPPL¶V EDWWHUHG ROG =HSSHOLQDQG'HHS3XUSOHKDGVHFXUHGUHFRUGGHDOV(DUWKĪZKRFKDQJHG
&RPPHUYDQĪ³,WKDGQRÀRRULQLW´UHFDOOV%XWOHUīĦZDVVRPHWKLQJRID WKHLUQDPHWR%ODFN6DEEDWKLQ6HSWHPEHU¶īVWUXJJOHGWRDWWUDFWWKH
GHDWKĥWUDSVRWRRZDVWKHLUDFFRPPRGDWLRQLQ+DPEXUJ DWWHQWLRQRIWKHIDVKLRQĥFRQVFLRXV/RQGRQĥEDVHGODEHOV
³,WZDVDQROGVWULSFOXEEXWWKH\¶GKDGD¿UHVRDOOWKHÀRRUVZHUH ³:HUHDOO\EHOLHYHGLQZKDWZHZHUHGRLQJDQGZHZHUHVWULYLQJWR
EXUQWRXW´UHFDOOV*HH]HU³,WKLQNZHZHUHRQWKHIRXUWKÀRRUDQG\RX JHWRXUPXVLFKHDUG´UHFDOOV*HH]HU³%XW,UHPHPEHUZKHQZHSOD\HG
FRXOGVHHULJKWGRZQWRWKHEDVHPHQWZKHUHDOOWKHÀDPHVKDGEHHQ VRPHGHPRVWRĬ(OWRQ-RKQ¶VSURGXFHUĭ*XV'XGJHRQDQGKHZHQWμ*R
7KH\¶GMXVWSXWWKHEHGVDURXQGWKHKROH,I\RXJRWXSDWQLJKW\RXFRXOG DZD\DQGFRPHEDFNZKHQ\RX¶YHJRWVRPHSURSHUPXVLFWRSOD\RUMXVW
HDVLO\KDYHIDOOHQGRZQWKDWIXFNLQJKROHDQGGLHG´ JLYHXS¶7KHRQO\JX\ZKRKHOSHGXVLQWKRVHHDUO\GD\VZDVĬ7HQ<HDUV
'HVSLWHWKHVHSHULOVWKHEDQG¶VVHWZDVWDNLQJVKDSHPRYLQJEH\RQG $IWHUJXLWDULVWĭ$OYLQ/HHZKRJRWXVDJLJDWWKH0DUTXHH$OYLQWKRXJKW
FRYHUVRIEOXHVFODVVLFVE\(OPRUH-DPHVĪ'XVW0\%URRPīDQG5REHUW ZH VKRXOGQ¶W FDOO RXUVHOYHV %ODFN 6DEEDWK +H VXJJHVWHG VRPHWKLQJ
-RKQVRQĪ&URVV5RDG%OXHVĦ³WKH&UHDPYHUVLRQ´īDQGWKHRGGVRXOVRQJ OLJKWHUOLNH3DSHU0RRQ´
³:HHYHQGLG(GGLH)OR\G¶V.QRFN2Q:RRG´QRGV%XWOHU³:HKDGWR
SOD\ZKDWSHRSOHZDQWHGEXWWKH¿UVWVRQJWKDWZHGLGWKDWZDVUHDOO\ T WAS A R O U N D T H I S T I M E WKDW%ODFN6DEEDWKPDGHWKHLU¿UVW
GLɱHUHQWZDV:DUQLQJE\$\QVOH\'XQEDU7KDWKDGDUHDOO\KHDY\ULɱ´ UHFRUGLQJVFRPPLWWLQJWRWDSH7KH5HEHOĦDVRQJZULWWHQE\
'UXPPHU'XQEDUKDGSOD\HGZLWK-RKQ0D\DOO¶V%OXHVEUHDNHUVDQG NH\ERDUGSOD\HU1RUPDQ+DLQHVZKRKDGEHHQLQ/RFRPRWLYH
7KH-Hɱ%HFN*URXSEHIRUHIRUPLQJ7KH$\QVOH\'XQEDU5HWDOLDWLRQ DORQJVLGHPDQDJHU6LPSVRQ$VHFRQGWUDFN6RQJ)RU-LPZDV
7KHLU¿UVWVLQJOH:DUQLQJUHOHDVHGLQZDVVQDSSHGXSE\%XWOHU DOVR UHFRUGHG GXULQJ WKDW VDPH VHVVLRQ ZKLFK DOOHJHGO\ WRRN SODFH DW
ZKRVDZWKHLUJLJDW0RWKHUVLQ%LUPLQJKDP$VRQJZKRVHO\ULFVWHOORI /RQGRQ¶V7ULGHQW6WXGLRV2IWKHIRUPHUWXQHWKHUHDUHVHYHUDOWDNHV
WKH LPSDFW RI D IDLOHG UHODWLRQVKLS LQ PHWDSK\VLFDOĥFXPĥDSRFDO\SWLF QRQHRIZKLFKKDYHHYHUEHHQFRPPHUFLDOO\UHOHDVHG%RWKVRQJVFDQEH
WHUPV:DUQLQJ¶VSHUFXVVLYHLQWUROHDGVLQWREOXHVĥVRDNHGVRORLQJRYHUD KHDUGRQOLQHDORQJVLGHDIXUWKHUEDWFKRIVRQJVLQFOXGLQJ7KRPDV-DPHV
OXUFKLQJULɱ7KHWUDFN¶VEURRGLQJDWPRVSKHUHLVRQHWKDW6DEEDWKEHJDQ DQG:KHQ,&DPH'RZQDQDFHWDWHRIZKLFKLVUHSRUWHGWRH[LVW
WRH[SDQGXSRQ $IWHU VHYHUDO DXGLWLRQV IRU DVVRUWHG ODEHOV WKH IRXUĥSLHFH ¿QDOO\
³:H DOO OLNHG WKH KHDY\ EDQGV OLNH +HQGUL[ &UHDP DQG VLJQHGDSURGXFWLRQGHDOZLWK7RQ\+DOO(QWHUSULVHVDIWHU+DOO

“WE HAD
-RKQ0D\DOODQGDOLWWOHELWRI:HVW&RDVWVWXɱ´VD\V%XWOHU WUDYHOOHGWR%LUPLQJKDPWRVHHWKHEDQGZLWKSURGXFHU5RGJHU
³%XW LW ZDV:DUQLQJ WKDW OHG XV LQWR MDPPLQJ PRUH$W WKH %DLQ+DOOWKHQOLFHQVHGWKHLUPXVLF¿UVWWR)RQWDQDĪIRUWKHLU

NO RESPECT
+LUVFKHQ%DURUWKH6WDUĥ&OXEZHKDGWRGRVL[ĥPLQXWHVVHWV GHEXW  D FRYHU RI 0LQQHDSROLV EOXHVĥURFNHUV &URZ¶V (YLO
ĬSHU QLJKWĭ VR ZKHQ ZH VWDUWHG ZLWK :DUQLQJ :RPDQ UHOHDVHG LQ -DQXDU\  DQG EDFNHG

FOR ANYTHING. MY DRINK OF


WKDWEDVLFDOO\KDGWRODVWXVIRUDQHQWLUHVHW%XW ZLWK D IRXUĥPLQXWH YHUVLRQ RI :LFNHG :RUOGī
VRQJVOLNH:DU3LJVIROORZHGIURPWKHUH´ DQG WKHQ WR 9HUWLJR IRU WKH EDQG¶V ¿UVW DOEXP

CHOICE? IT WAS YOURS AND


³0RVW RI RXU VWXɱ HYROYHG IURP MDPPLQJ %DLQ¶VLQSXWLQWRWKHDOEXPSURYHGFUXFLDO
WKHVH ULɱV ZRXOG HPHUJH IURP WKHUH´ DGGV ³5RGJHUKDGVHHQXVOLYHVRKHNQHZZKDWWR
,RPPLGHVFULELQJWKHRULJLQVRI%ODFN6DEEDWK¶V
VORZJULQGLQJDQGLQFUHDVLQJO\KHDY\VRXQG MINE. THEN H[SHFW ZKHQ ZH WXUQHG XS LQ WKH VWXGLR´ VD\V
2]]\³%DVLFDOO\ZHSOD\HGRXUOLYHVHWKHUHFRUGHGLWDQGZH
7KH¿UVWVRQJWKH\ZURWHZDV:LFNHG:RUOGDĥPLQXWH
EOXHVMDP¿QHVVHGLQUHKHDUVDOVDWDVVRUWHG$VWRQFRPPXQLW\ ANY DRUG ZHQWRQWRXU:KHQZHJRWEDFN-LP6LPSVRQFDOOHGXVDQGVDLG
μ,¶YHJRWWKHDOEXPDUWZRUN¶VRZHZHQWURXQGWRKLVKRXVH%DFN
FHQWUHV7KHNH\WUDFNLQWKHLUHDUO\UHSHUWRLUHKRZHYHUZRXOG
JLYHWKHPWKHLUQDPHDQGDUHDOVHQVHRIGLUHFWLRQ I COULD WKHQWKHELJĥVKRWWKLQJZDVWRKDYHDJDWHIROGFRYHUDQGZHKDG
RQH:HFRXOGQ¶WEHOLHYHLW7KHQZKHQZHKHDUGWKHWUDFN%ODFN
³,WZDV2]]\ZKRVWDUWHGLWDOORɱZKHQKHGLGWKHO\ULFV
for Black 6DEEDWK´VD\V*HH]HU³,WZDVDOOUHODWHGWRWKLVVWRU\ GET MY 6DEEDWK ZLWK WKH WKXQGHU DQG OLJKWQLQJ DW WKH EHJLQQLQJ WKH
HɱHFWVWKDW5RGJHU%DLQKDGSXWRQLWZHZHUHOLNH)XFNLQJKHOO
RIVHHLQJWKHGHYLO´:KLOHWKHVRQJWRRNLWVQDPHIURPWKH
HANDS ON.”
 PRYLH VWDUULQJ %RULV .DUORɱ IRU %XWOHU WKH WXQH KDG D
GHHSHUPHDQLQJ
7KDWZDVWKHLFLQJRQWKHFDNH´
8QEHNQRZQWRWKHEDQGWKHDOEXP¶VVOHHYHĦGHVLJQHGE\
.HLWK0F0LOODQĪDND.HHIīĦIHDWXUHGDIXUWKHUHPEHOOLVKPHQW
³,WRWDOO\EHOLHYHGLQWKHGHYLO´KHWROGWKLVZULWHU\HDUV LQ WKH IRUP RI DQ LQYHUWHG FURVV KRXVLQJ WKH FUHGLWV DQG
ODWHU ³, VWDUWHG UHDGLQJ ERRNV E\ $OHLVWHU &URZOH\ DQG HPSKDVLVLQJ WKH WLWOH WUDFN¶V RFFXOW LQVSLUDWLRQ ³6XGGHQO\ ZH
'HQQLV:KHDWOH\HVSHFLDOO\7KH'HYLO5LGHV2XWZKLFK KDGDOOWKHVHFUD]\SHRSOHWXUQLQJXSDWVKRZV´UHFDOOHG,RPPL\HDUV
ZDVPHDQWWREHDFDXWLRQDU\WDOHEXWZKLFKUHDGOLNHD ODWHU³,WKLQN$OH[6DQGHUVĬKLJKSULHVWRIWKH:LFFDQUHOLJLRQĭWXUQHG
KDQGERRNRQKRZWREH6DWDQLVW,¶GPRYHGLQWRWKLVÀDW XSDWDJLJRQFH,WZDVDOOTXLWHVWUDQJHUHDOO\´
DQG,¶GSDLQWHGEODFNLQYHUWHGFURVVHVHYHU\ZKHUH2]]\ 6XFK ZDV WKH QRWRULHW\ WKDW GHYHORSHG DURXQG WKH EDQG WKDW
JDYHPHWKLVWKĥFHQWXU\ERRNDERXWPDJLFWKDWKH¶G 2]]\¶VIDWKHU-DFNFUDIWHGDVLOYHUPHWDOFURVVIRUHDFKEDQGPHPEHU
VWROHQ ,¶G SXW LW LQ DQ DLULQJ FXSERDUG EHFDXVH WRZHDUWRZDUGRɱHYLOVSLULWV3URVSHFWLYHFXUVHVDQGWKHRGGSUHVV
,ZDVQ¶WVXUHDERXWLW/DWHUWKDWQLJKW,ZRNHXS EULFNEDWDVLGHWKHDOEXPEHJDQWRVHOOUHDFKLQJ1XPEHULQWKH
DQG VDZ WKLV EODFN VKDGRZ DW WKH HQG RI P\ 8.DQG1XPEHULQWKH8QLWHG6WDWHVZKHUHLWZDVUHOHDVHGRQ
EHG ,W ZDV D KRUULEOH SUHVHQFH WKDW UHDOO\ :DUQHU %URWKHUV7KLV XQH[SHFWHG EXW LQFUHDVLQJ VXFFHVV DOVR
IULJKWHQHG WKH OLIH RXW RI PH , UDQ WR WKH JDYH6DEEDWKWKHPHDQVWRLQGXOJHWKHPVHOYHV
DLULQJFXSERDUGWRWKURZWKHERRNRXWEXW
WKHERRNKDGGLVDSSHDUHG´ T WAS A B O U T the spoils of
2]]\ WUDQVODWHG *HH]HU¶V H[SHULHQFH ZDU IRU XV´ EHJLQV 2]]\
LQWR ZKDW EHFDPH WKH EDQG¶V VLJQDWXUH UHÀHFWLQJ RQ WKH SHULRG
WXQH FHPHQWLQJ WKHLU PRYH DZD\ IURP WKDWEHJDQLQWKHDIWHUPDWK
WKHLU EOXHV URRWV WRZDUGV ZKDW KH ODWHU RIWKDW¿UVWDOEXP¶VVXFFHVV³2XU¿UVWUR\DOW\DGĥ
GHVFULEHGDV³VFDU\PXVLF´6XFKZDVWKH YDQFHZDVTXLG,UHPHPEHUORRNLQJDWWKHPRQH\
GETTY

Gurning man:
LQFUHDVLQJ IHURFLW\ DQG DQJHU LQ WKHLU Ozzy Osbourne DQGWKLQNLQJ)XFNLQJKHOO,QHYHUWKRXJKW,¶GVHHWKHGD\
PXVLF WKDW ZKLOH KHDY\ DFWV OLNH /HG in typically ZKHQ,ZRXOGHDUQWKDWPXFKLQRQHJR,ZDVXVHGWR
serious mood.

PLANET ROCK 87
Charlie company:
Iommi, Ward, a
prone Osbourne
and Butler,
c.1974.

HDUQLQJĸIRUZRUNLQJLQDIDFWRU\DQGVXGGHQO\ DERXW´VD\V*HH]HU³$ORWRI$PHULFDQEDQGVZHUHVFDUHG
,WKRXJKW,ZDV5RFNHIHOOHU<RXDGGVXFFHVVRQWRSRI RIWDONLQJDERXWWKHWKLQJVWKDWZHZHUHVLQJLQJDERXW
WKDW DQG LW¶V D OLFHQFH WR GR ZKDWHYHU \RX ZDQW<RX :HGLG:DU3LJVDQGSHRSOHZRXOGEHVKRFNHGμ7KH\¶UH
IXFN HYHU\ JURXSLH XQWLO \RXU GLFN¶V DERXW WR IDOO Rɱ DFWXDOO\VLQJLQJDERXW9LHWQDP¶7KDWZDVWRWDOO\WDERR
GULQNHYHU\GULQNDQGWDNHHYHU\GUXJ$QGWKDW¶VZKDW LQ$PHULFDEXWDORWRI\RXQJNLGVUHVSRQGHGWRWKDW
ZHGLGHVSHFLDOO\ZKHQZHZHQWWR$PHULFD´ DQGWKHZRUGVSUHDG´
%ODFN 6DEEDWK¶V ¿UVW 86 WRXU EHJDQ LQ ODWH 2FWREHU ,QWKHEDQG¶VOLYHVHWVLQFHWKHLU6WDUĥ&OXEGD\V:DU
LQWKHZDNHRIWKHLUGHEXWDOEXPODXQFKHGE\:DUQHU 3LJVZDVRULJLQDOO\WLWOHG:DOSXUJLVLQUHIHUHQFHWRWKHWUDGLĥ
%URWKHUVZLWKDμSDJDQSDUDGH¶LQ6DQ)UDQFLVFRSUHVLGHGRYHU WLRQDO 0D\ 'D\ JDWKHULQJ RI ZLWFKHV +RZHYHU DZDUH RI WKH
E\$QWRQ/D9H\WKHKHDGRIWKH&KXUFK2I6DWDQ DWURFLWLHVHPHUJLQJIURPWKH9LHWQDPFRQÀLFW%XWOHUDGDSWHGWKHO\Uĥ
³:HKDGQRLGHDDERXWWKDWZKROHWKLQJEXWZHFRXOGQ¶WEHOLHYHZH LFV7KH¿QDOUHVXOWZDVLQWHQGHGDVWKHWLWOHWUDFNRIWKHEDQG¶VVHFRQG
ZHUHJRLQJWR$PHULFD´UHFDOOV2]]\³:HJRWRQDDQGZHZHUHRQ DOEXPDQGDVOHHYHĦIHDWXULQJDSLJEUDQGLVKLQJDVZRUGĦZDVFRPPLVĥ
WKHUHZLWK7UDɷFDQGLWUHDOO\IHOWOLNHZH¶GDUULYHG:HZHUHLQHFRQRP\ VLRQHG 7KHQ WKH UHFRUG FRPSDQ\ KHDUG D WXQH WKDW WKH EDQG KDG
EXWLWIHOWOLNHZHZHUHLQ¿UVWFODVVOLNHZHZHUHNLQJVRIWKHZRUOG´ ³NQRFNHGXSLQPLQXWHV´DVD¿OOHURQWKHDOEXP
³:KHQ ZH ZHQW WR $PHULFD ZH UHDOO\ GLGQ¶W KDYH D FOXH´ DJUHHV ³7KH\KHDUG3DUDQRLGDQGÀLSSHG´UHFDOOV*HH]HU³7KDWVRQJFDPH
,RPPL ³:H WRRN RXU 3$ IRU VRPH UHDVRQ DQG ZH GLGQ¶W QHHG LW:H RXWRIQRZKHUHDQG,DOZD\VWKRXJKWLWZDVWRRFRPPHUFLDOIRUXVWR
SOXJJHGLQRXUDPSVDQGWKHZKROHORWEOHZXSEHFDXVHZHGLGQ¶WNQRZ HYHQLQFOXGHLWRQWKHDOEXP:HZHUHDOODJDLQVWLW´
WKH\KDGGLɱHUHQWPDLQVHOHFWULFLW\2XU¿UVWJLJLQ1HZ<RUNZDVLQWKLV 7KHODEHOQRWRQO\LQFOXGHGWKHWXQHRQWKHDOEXPDQGLQVLVWHGLW
WLQ\FOXEFDOOHG8QJDQR¶V,WZDVDUHDOO\SR[\SODFHDQGDVWHSEDFNIRU EHFDPHWKHWLWOHWUDFNEXWDOVRUHOHDVHGLWDVDVLQJOHWUDQVIRUPLQJ%ODFN
XV:HWKRXJKW2K*RGZKDWDUHZHGRLQJKHUH"´ 6DEEDWKLQWRXQOLNHO\SRSVWDUV)RUDOOLWVSRSXODULW\KRZHYHUWKHWXQH
7KLV LQDXVSLFLRXV GHEXW DVLGH 6DEEDWK¶V LQLWLDO 86 WUHN VDZ WKHP PDVNHGDGHHSHUHPRWLRQDOTXDOLW\
VXSSRUWLQJWKHOLNHVRIWKH)DFHVDQGWKH-DPHV*DQJDQGIROORZLQJD ³,W¶V DERXW GHSUHVVLRQ EHFDXVH , GLGQ¶W UHDOO\ NQRZ WKH GLɱHUHQFH
8.KHDGOLQHWRXULQ¶UHWXUQLQJWRSOD\ZLWKWKHOLNHVRI)OHHWZRRG EHWZHHQGHSUHVVLRQDQGSDUDQRLD´H[SODLQV*HH]HU³,W¶VDGUXJWKLQJ
0DF DQG 0RXQWDLQ DV WKH IRXUĥSLHFH JUDGXDWHG WR KHDGOLQH VWDWXV ZKHQ\RX¶UHVPRNLQJDMRLQW\RXJHWWRWDOO\SDUDQRLGDERXWSHRSOH\RX
³$PHULFDUHDOO\RSHQHGRXUH\HV,WWRRNDORWIRUXVWRJHWDFFHSWHGEDFN FDQ¶WUHODWHWRSHRSOH7KHUH¶VWKDWFURVVRYHUEHWZHHQWKHSDUDQRLD\RX
KRPHEXW$PHULFDVHHPHGWRZHOFRPHXVZLWKRSHQDUPV´VD\V7RQ\ JHWZKHQ\RX¶UHVPRNLQJGRSHDQGWKHGHSUHVVLRQDIWHUZDUGV´
³,WKLQNWKH\UHVSRQGHGWRVRPHRIWKHLVVXHVWKDWZHZHUHWDONLQJ 'RSHKDGEHHQWKHEDQG¶VLQLWLDOGUXJRIFKRLFH$PHULFDKRZHYHU

88 PLANET ROCK
introduced Sabbath to other narcotic delights. “Coke was a new drug for ³$OORIDVXGGHQ,JRWKROGRIWKLVULɱDQGZHZHUHRɱDJDLQ´VD\V
us,” admits Tony. “So, we started taking that, but America changed us in Iommi, recalling the inception of Sabbath Bloody Sabbath, the track
VRPDQ\GLɱHUHQWZD\V´ WKDWZRXOGOHQGLWVQDPHWRWKHEDQG¶V¿IWKVWXGLRORQJĥSOD\HU
For Osbourne and Ward, touring meant a life of increasing excess. ³,W ZDV D GLɱHUHQW DOEXP ZLWK D QHZ VRXQG´ KH FRQWLQXHV ³:H
The pair hired a GMC mobile home to get from gig to gig, allowing H[SHULPHQWHG RQ WKDW DQG LW WXUQHG LQWR D FUHDWLYH KLJKĥSRLQW ZKLFK
them the freedom to indulge in anything they chose. WRRNXVWRDGLɱHUHQWOHYHO´
“We went too far every single fucking day,” says the singer. “In the “Sabbath Bloody Sabbath was really the album after which I should
end, Bill and I used to travel together because the other two didn’t want have said goodbye, because after that I really started unravelling,”
to be around us. They would avoid being anywhere near us. We had no admits Ozzy. “Then we ended up falling out of favour with each other.”
respect for anything. My drink of choice? It was yours and mine. Then At the heart of their initial discontent were the endless business
there was any drug I could get my hands on. ZUDQJOHVWKDWEHVHWWKHP,QIDFWWKHYROXPHRIZULWVWKDWZHUHÀ\LQJ
“When you’re in that environment, you wake up with a hangover around actually placed the band on a virtual hold, touring being curtailed
and you know what cures a hangover? Another fucking drink! Then by further papers being served. Despite this, Sabbath headlined New
\RX¶UHRɱDJDLQ%XWWKHUHDVRQ,GUDQNLQWKH¿UVWSODFHZDV <RUN¶VSUHVWLJLRXV0DGLVRQ6TXDUH*DUGHQIRUWKH¿UVWWLPHRQ

“SABBATH
'XWFK FRXUDJH EHFDXVH , ZDV DIUDLG DQG , VXɱHUHG 'HFHPEHU7ZRPRQWKVODWHUWKH\EHJDQZRUNRQWKHLU
IURP LQFUHGLEOH VWDJHĥIULJKW 7KHQ P\ GULQNLQJ HVFDSDGHV QH[WDOEXP³:HKDGQHDUO\PRQWKVRIOHJDOFDVHV´ZLQFHV

BLOODY
became monumental. Butler. Unsurprisingly, the resultant album, Sabotage, remains
“If you were working for someone and you one of Sabbath’s most acerbic outings...

SABBATH WAS THE ALBUM


 
behaved like I did then they’d say to you, ‘You’re
¿UHG¶%XW,¶PDURFN¶Q¶UROOHUVR,JHWIXFNHGXS OR O Z Z Y T H E E N D was still three
and people would go, ‘Ozzy’s out of his mind!
Looks like it’s going to be a great show tonight!’ AFTER WHICH I SHOULD DOEXPVDZD\¶VSabotageĪPDGHDV
the band’s litigation against former
That allowed it to carry on.”
)RUDOOWKHVHOIĥLQÀLFWHGGDPDJHPXVLFDOO\6DEEDWKZHUHRQ HAVE SAID PDQDJHU 3DWULFN 0HHKDQ WRRN KROGī
¶V Technical Ecstasy and the disastrous Never Say Die! ĪVHH
a roll, writing as they toured and completing enough material
for their third album, Master Of RealityĪVHHSDQHOSDJHī GOODBYE. SDJHVĥIRU,RPPL¶VWKRXJKWVRQDOOWKUHHDOEXPVī%\WKH
time Sabbath released the latter, they were really in trouble.
“The Paranoid album really crystallised our sound,” nods
%XWOHU³,I,¶PKRQHVWWKH¿UVWIRXUDOEXPVMXVWFDPHIURPQRĥ AFTER THAT ³7REHKRQHVWZHZHUHDOOORVWE\WKHQ´UHÀHFWV,RPPL
³,JRW¿UHG¿UVW´UHPHPEHUV%XWOHU³7KHQ,FDPHEDFN
where. We were on the road forever, and in two years we had
done four albums and God knows how many tours. If we I STARTED And then it was Ozzy’s turn.”
2VERXUQH¶V VDFNLQJ FDPH RQ$SULO   ZKHQ DV WKH
weren’t in the studio, then we were on the road.”
And the band’s touring requirements now revolved
around their new drug of choice. “We had a guy travelling
TO UNRAVEL.” EDQG UHWXUQHG WR /$ DQG VWUXJJOHG WR ZULWH WKH IROORZĥXS WR
Never Say Die!, his best friend Ward told him that the band he’d
OHGIRUMXVWRYHUDGHFDGHQRORQJHUUHTXLUHGKLVVHUYLFHV
around with us with a suitcase of cocaine,” explains Ozzy. “I’m ³, ZDV WHUUL¿HG DQG KXUW DW WKH WLPH´ UHFDOOV 2]]\ ³%XW
VXUH VRPH RI LW ZDV -RKQVRQ¶V DUVH SRZGHU :H ZHUH WDNLQJ VWXɱ WR ,KDGORVWLWZLWK6DEEDWKORQJEHIRUH,JRW¿UHG/RRNLQJEDFNLWZDV
pretend we felt good.” the best thing that could have happened to me and them.”
+HURLQWRRKDGHQWHUHGWKHIUDPHĪ³:HVQLɱHGLWZHQHYHUVKRW %XWZDVWKHUHDVHQVHRIXQ¿QLVKHGEXVLQHVV"³2K\HDK$QGWKDW
XS´FODUL¿HG*HH]HU\HDUVODWHUī+ROHGĥXSIRUPRVWRI-XQH¶LQD%HO lasted for a long time.”
Air mansion, Sabbath wrote Vol. 4LQDELWRIDKD]H³:HKDGORFNĥLQVDOO Ozzy’s comments are something of an understatement. It would
WKHWLPHZKHUHLWZDVMXVWXVDQGDEDJRIZKLWHSRZGHU´UHFDOOV2]]\ WDNHFORVHWR\HDUVIRUWKHEDQGWRUHXQLWH«
³7KH DOEXP FRVW IJ GROODUV WR PDNH DQG ZH VSHQW

IOMMI SPEAKS
IJRQFRFDLQH´VD\V%XWOHU³,GLGQ¶WUHDOLVHKRZQXWV TURN
THE
we’d gone untLO , ZHQW KRPH ĬWR (QJODQGĭ DQG WKH JLUO PA G E . . .
GETTY, SAM EMERSON/POLARIS/EYEVINE EYEVINE

I was with didn’t recognise me.”


Despite their increasing addictions, Sabbath’s touring
VFKHGXOHFRQWLQXHGXQDEDWHG¶VWRXUVWDUWLQJLQ-XO\SULĥ
or to Vol. 4’s release in September. “On that tour we were
absolutely, completely exhausted,” recalls Butler. “We got to
WKH+ROO\ZRRG%RZOĬRQ6HSWHPEHUĭDQG7RQ\MXVW
FROODSVHG,WZDVUHDOO\WRXFKĥDQGĥJRDWRQHSRLQWZKHWKHU
he’d survive or not because he was totally depleted. So, we
had to cancel the rest of the tour and we actually took time
RɱIRUWKH¿UVWWLPHVLQFHZHVWDUWHG7KHQZHFDPHEDFN
On-stage at
together to start on the next album, and couldn’t come up with anything.”
Madison Square
5HOLDQW RQ7RQ\¶V ULɱV WR NLFNĥVWDUW WKH FUHDWLYH SURFHVV 6DEEDWK Garden, 1975.
regrouped in LA and found their leader bereft of ideas. “I panicked
because I didn’t have a single idea about what to write,” says Tony. “It
might have been the drugs, it could have been the pressure, but either
way I felt it was my fault.”
0RYLQJ EDFN WR WKH 8. 6DEEDWK KLUHG &OHDUZHOO &DVWOH Ħ QRZ
DFRXQWU\KRXVHKRWHOWKHQDPRFNĥJRWKLFROGSLOHLQ*ORXFHVWHUVKLUH
in which the likes of Zeppelin, Purple and Mott The Hoople wrote
and recorded.
, ’s lynchpin and
riff master, looks back at the band’s early career,
their last gigs, and the forthcoming live concert
filmThe End Of The End. He also shares his vision
of a Sabbath-free future with ...
P H O T O F E AT U R E S

Portrait by

90 PLANET ROCK
CHRIS WALTER
SAYS TO N Y I O M M I ,
the day after the launch of The Ten Year War at Regent Sound Studios, as he everybody is obsessed with money. But back in
SUHSDUHVWRSURYLGHXVZLWKDQRYHUYLHZRI%ODFN6DEEDWK¶VFDUHHU¿OOLQJLQVRPHRIWKHEODQNV those days we were just in it for the music. That’s
DORQJWKHZD\$VZHOODVFRQGXFWLQJLQWHUYLHZVWRSURPRWHWKHER[VHW,RPPLKDVEHHQEXV\ all we cared about. In fact, we still do. You can’t
PL[LQJWKHDXGLRWKDWZLOOIHDWXUHRQ7KH(QG2I7KH(QGWKHFRQFHUWPRYLHPDGHE\GLUHFWRU make music if you don’t think that way. You have
'LFN&DUUXWKHUVDURXQGWKHEDQG¶V¿QDOVKRZVLQWKHLUKRPHWRZQRI%LUPLQJKDPLQ)HEUXDU\ to get the music right and nothing else matters.
of this year. Prior to travelling down to record at Regent
,QGHHG6DEEDWK¶V¿QDOWRXUZDVDELWWHUVZHHWDɱDLULWVFHOHEUDWRU\PRRGVOLJKWO\WHPSHUHG Sound, you’d done some pre-production
E\WKHDEVHQFHRIRULJLQDOGUXPPHU%LOO:DUGZKRIHOORXWRYHUWKHWHUPVKHZDVRɱHUHGDQG with Rodger Bain. What did that consist of?
WKHQREMHFWHGWRFHUWDLQFRPPHQWVPDGHE\2]]\2VERXUQHFRQFHUQLQJKLVJHQHUDOKHDOWK³, I think he popped up to see us rehearse for a
WKLQNZH¶GDOOZLVKHG%LOOKDGEHHQDEOHWRGRWKHWRXU´VDLG7RQ\GXULQJWKHLQWHUYLHZDW5HJHQW couple of days but it wasn’t anything more than
6RXQGGLVFXVVLQJWKHIUDFWXUHGUHODWLRQVKLSWKDWKDVHQGXUHGVLQFHWKHRULJLQDOIRXUPHPEHUV that. And it was a few days before we actually
RI%ODFN6DEEDWK¿UVWJRWEDFNWRJHWKHULQ came down to London. It was really just a case
)RU,RPPLWKHWRXULWVHOIZDVWLULQJDVKHFRQWLQXHGWREDWWOHWKHFDQFHUKHZDVGLDJQRVHG of getting acquainted with each other. I think it
was Rodger’s first project too so they were really
ZLWKLQZKHQKH2]]\2VERXUQHDQG*HH]HU%XWOHUEHJDQWRPDNH13WKHLU¿QDODOEXP
using it as a test for him also.
ZLWK SURGXFHU 5LFN 5XELQ 5HOHDVHG LQ -XQH  WKH DOEXP LWVHOI PHW ZLWK PL[HG UHYLHZV
WKRXJKLWFKDUWHGDW1XPEHULQERWKWKH8.DQGLQWKH866RKRZGRHV7RQ\,RPPLIHHO No one sounded like Black Sabbath at the
DERXW7KH(QG"$QGDVIDUDVWKHIXWXUHJRHVZKDWGRHVWKHJXLWDULVWLQWHQGWRGRQH[W"$OOZLOO time. Was it a particular challenge for him to
EHUHYHDOHGEXW¿UVWZHKHDGEDFNWR6DEEDWK¶VHPEU\RQLFUHFRUGLQJFDUHHU« capture your sound?
It was pretty straightforward. In terms of my
Let’s go back to the beginning. Before you The band’s initial record deal is a tangled sound, he just set up a mic in front of the cabinet
recorded the first album, didn’t you head affair. Is it true you got paid £100 each to and we just played our set. We didn’t have a load
down to London in autumn 1969 and record record the first album? of technology at the time, just eight
two tracks – The Rebel and Song For Jim It is true. We got four hundred tracks. In all honesty, other than
– at Trident Studios? quid for the band but that our playing, we didn’t have a
I don’t remember that. I thought we recorded didn’t matter because all whole lot of say in the
those songs in Birmingham at a small studio we wanted to do was matter, everything was
called Zella. It was more of a rehearsal for us, record an album. That pretty basic. But Rodger
where we played through the songs and they was just so important did capture the sound
were recorded. They were songs that were to us. Today, of and there was no
suggested to us by [then manager] Jim Simpson. course, things have fiddling or diddling
Am I a fan of those songs? Not really. totally changed and around. Geezer had
a fuzzy bass sound
and I had a fuzzy
guitar sound, and no
one moaned about it
Street fighting man: at the time. Later on,
Iommi at Regent though, producers
Sound during the would say, “You’ve got
making of Paranoid. this odd fuzzy sound that’s
Note the skinhead- too distorted.” I’d say to them,
supplied shiner.
“Listen to the band’s entire sound,
not the isolated instruments.” It was all
about the combination. That’s what our sound is:
P H O T O F E AT U R E S , RO S S H A L F I N

a combination. If you listened to what we were


doing individually it probably sounded crap but
together it really worked. It was powerful and
that’s how producers needed to listen to us, as a
whole rather than by isolating tracks. You had to
hear us as a band.
You arrived at Regent Sound on October 16,
1969. What was the first track you cut? Did
you work on the album in sequence?
I don’t remember whether we did that and
whether it was the track Black Sabbath itself.
It may well have been, though.

92 PLANET ROCK
Princes of darkness:
(clockwise from top left)
Black Sabbath backstage
at London’s Royal Albert
Hall, February 17, 1972;
Tony Iommi on-stage in
1978; Ozzy’s handwritten
lyrics for The Wizard.

You liked to get up to mischief in those Geezer had gone to ring Jim Simpson because we were earning but not seeing very much of that
days. Did anything untoward happen during there was a problem with the money from the fortune but that’s because we weren’t thinking
that first session? promoter at the end of the night – as there often about that kind of stuff. It was all about the music.
Not that much. It was really serious because we was in those days. Suddenly the phone box was
Obviously, despite the success, the press
had a few hours and we knew that time was surrounded by skinheads and when he came out,
they went for him. He ran back to the gig and criticism was harsh. The Ten Year War box
limited. We got down to it immediately and, like I
told us. The fumes rose as a result and we went set’s very title is based on that. Did that
said, it was like doing a gig. We probably did
out to confront these skinheads with a couple of criticism affect you?
Black Sabbath twice but that was good. When
hammers, a mic stand and whatever we could Well, it’s never nice. I used to read the slaggings
you play a song too much in the studio you lose
get our hands on. It ended up in a real fight. Then we’d get and I’d just think, “Why?” There was
the spirit of it. I like two or three takes otherwise
another 15 or so skinheads turned up and we one moment that really hurt and that didn’t
you just suck the life out of the music.
were a bit like, “Oh, bloody hell!” It got really actually come from the press. It came from Pink
At what point did you get to hear the whole messy then, there was quite a lot of blood Floyd’s Roger Waters. He reviewed Paranoid
of the album? everywhere. It got dispersed, but by then I’d also when it came out as a single because he was
It was kept away from us. They were mixing it got booted in the face. reviewing the singles that week for a music
and they didn’t want us around so we heard it paper. He gave it such a terrible review. I
That episode gave birth to Fairies Wear thought, “Blimey!” Hearing that from a fellow
properly when we came back [from Zurich], by
Boots which ended up on Paranoid. The musician seemed really harsh. It didn’t affect
which point it was out. I think we heard a track
album itself went to Number 1 in the UK. what happened to the single, though. It got in the
on the radio. That was quite exciting.
Was that the point when you first started to charts and, as you know, it still gets played all the
When you went back to Regent Sound to see some money? time. It’s on an advert right now and it’s on the
record Paranoid, how had the band evolved? We started to see money a little bit after that, but soundtrack to the new King Kong movie, too.
We knew what the studio was like and we’d that was really when we started touring America.
really prepared ourselves as far as the songs It was odd because we didn’t really see any In terms of the band’s trajectory, your third
physical money as such. If we wanted something, album, Master Of Reality, maintained that
were concerned. We’d found our direction and
then we’d ring the office and they’d sort it all out. momentum and it really cracked the States.
we knew what we were doing, so we had the
If we saw a car – say, a Mercedes – you’d tell What impact did America have on the band?
material ready, apart from the song Paranoid.
That came out of the blue and it worked... them where you’d seen it and they would sort it It had a big impact on us. It opened our eyes to a
out and get it delivered. It was the same with whole new world and it took us on to a big
In the photos shot in the studio during those houses too. But we were in the dark in terms of stage. We’d been slated in England but in
sessions you have a black eye… the cash itself. We did have a bit in our accounts America they seemed to really get what we were
Yes. We had a fight at a seaside resort. Basically, but not that much. It took us a while to realise that doing. The stages there were bigger too,

PLANET ROCK 93
understood when people behave like
that. You’re a musician, you play music.
That doesn’t give you the right to treat
people differently. Why should it?
Even though you maintained a certain
earthiness, excess came into play. Was
there a specific moment where you felt
you’d lost the plot because of that?
There probably was. It was definitely more when
the drugs got involved. I know I lost the plot at
that point. But I realised I was doing too much
and I managed to cut it down. Some people don’t
realise it at all but I did. I realised I was losing my
identity and myself, too. Some people go into
rehab to sort that out. I didn’t. It was like when I
stopped smoking, I just did it. But, to be honest,
I did do quite a lot of drugs and then I stopped.
Lord of this world: (top) Obviously, there were moments in the
Tony Iommi at home in
band’s career when you felt under pressure.
Warwickshire in 1975
Sabbath Bloody Sabbath being one of them
and (below) on-stage
in the US in the same when you had writer’s block. Did that ever
year; Clearwell Castle; happen again?
Quiet Riot’s best-selling It didn’t but when it happened the first time, it
Metal Health album; frightened me to death. We went to LA to write
the Ten Year Booklet.
and record, and it just wasn’t happening. Maybe
it was the fact that the drugs had got in the way.
It was the same set up as we’d had on Vol. 4,
exactly the same house and the same process
but the more I over-thought things, the worse it
got. In the end we just had to stop. Then, when
we booked time at Clearwell Castle, the writing
all started again.
Sabotage is another album title based on
the reality that surrounded the band, most
notably the legal battle you waged with your
management at the time. What do you feel
when you hear that album now?
It puts me back into that situation. It was most
definitely not a good time. We also had a
problem in the studio where one of the
engineers taped over the master tape. There
was just so much bad stuff going on. We’d be in
court in the morning and back in the studio in the
afternoon. It was dreadful really, but somehow
we got the album done.
Is Technical Ecstasy overlooked as a
Sabbath album?

ROSS HALFIN, ALAMY, GET TY, MIRRORPIX


Yeah. I liked Technical Ecstasy. There was some
good stuff on there but it did get overlooked.
Even our band overlooked it. Ozzy didn’t like it at
first, and then, when it started selling, he did.
I was totally involved in it from start to finish so
and it was the first time we actually used a about the music, not about success itself. There I had a different perspective. We did it in Miami
monitor system. We also had really good PAs wasn’t much flash nonsense that went on. I have so there was a lot of sitting on the beach for
which was a new thing for us. Then there was never understood that, really. There was a band everyone but I was stuck in the studio for most of
the lifestyle, of course. Touring there introduced we toured with once, I won’t name names, but the time. [Keyboard player] Jezz Woodroffe played
us to quite a lot of other things! they had a Number 1 album in America… Actually, on it so it sounded different but it had some really
I will name names... It was Quiet Riot. I couldn’t good stuff on it, like Back Street Kids and You
Looking back, what impact did success have believe the attitude they had. We went to this do Won’t Change Me. They were good songs.
on you as a band, and as individuals? and their guitar player was there surrounded by
I don’t think success changed our personalities. women. He was really trying to impress them by Never Say Die! was the final bow. How do
We were still basic chaps. The only difference talking about the fact that he’d got a platinum you feel about that period now?
was that we saw a new kind of lifestyle around us album. I heard him and I couldn’t resist saying, That was hard. It was the period when Ozzy left.
and we got everything that we wanted. But we “Oh, you’ve only got one, then?” (laughs) I just We wrote a few songs with Dave Walker then
didn’t pose around because to us it was still all didn’t like the ego and the attitude. I’ve never Ozzy wanted to come back and he didn’t want to

94 PLANET ROCK
record any of the material we’d written with first album. One day Rick said, “I’ve found But that was the idea with the film. I suggested
Dave. We went to Toronto to record and we somebody who knows how we can get that we go into the studio and play through a few
started with Junior’s Eyes, which we had actually sound.” I was like, “What do you mean? I’m the songs as if we were just rehearsing. It was just
recorded with Dave, but Bill had to sing guy who got that fucking sound in the first place!” a case of playing so that Ozzy wouldn’t feel the
Swinging The Chain because Ozzy didn’t want In my personal view, I wrote and recorded a pressure of performing in front of the audience
to do it, so we had to start all over again. It was lot of the songs at home and I liked what we’d and we could concentrate on the music, so that’s
freezing in Toronto and we hired this cinema to done with those versions. Not trying to put Rick what we did and it’s part of the package.
start writing again. We’d write in the day and down, but I preferred the sound we got there.
The film documents the final show in
then record in the evening. The pressure was But it was good to have him involved because he
Birmingham on February 4, 2017. What is
unbelievable and the whole process was has a different way of doing things.
the main memory you have of that night?
disjointed. It was terrible, really. We couldn’t
The final tour is being documented with the It was strange and nervy. I remember thinking,
carry on like that. It had to change.
upcoming concert film The End Of The End. “Blimey! This could be the last time we play
The Ten Year Booklet – which came out to How did you find the tour? together”, and then the next second I’m thinking,
accompany Never Say Die! – collated a It was great. I really enjoyed it. When you say “No, it won’t be.” Seeing the audience was
large chuck of slatings you got from the upfront, “Let’s do a tour”, and then you see it’s 80 strange too – all these people that had come to
press down the years. Whose idea was it? shows, it can be daunting. I did feel a little lonely see us from everywhere. It was quite sad, really.
I can’t remember but we thought it was quite at times because everybody wanted their own A very weird experience in the end that’s quite
funny. There was so much turmoil in that period. little space and stayed in their room a lot. They hard to put into words.
didn’t come down to the bar and have a pint
At what point do you think you fell out? It must have been and you do sense you
because they’re all recovering alcoholics. In the
It almost felt like a betrayal when Ozzy left but it’s want to play with Sabbath again. But what’s
old days that was our way of communicating,
hard to put myself back into that space. We next for you?
relaxing at the bar, but it didn’t happen this time.
were all having so many problems that it got to a We didn’t really hang out the way we used to, and Well, I’ve been involved with the mixing of the
point where something had to happen. It started I missed that. It was quite lonely at times. CD and the movie, so I still feel like I’m on the
with Ozzy, but things were bad for us all. We road because I’ve been so busy. I haven’t really
went to LA again and that was really it. The People forget that touring can be quite a had any time off as such, so I want a break to be
drugs really did set it all off and Ozzy in lonely experience. able to think what’s next. I need to close the door
particular got carried away. We went into the You do get isolated sometimes. I’d keep myself for a bit. But I also want to get back to writing.
studio to start writing songs and he’d go missing busy but it would’ve been nice for all of us to go I’ve been offered some TV work too because I
for days and we wouldn’t know where he was. out more and to chat more. I also wished we could did that TV show for Sky, Guitar Star, and there’s
Then, when he was in the studio he’d just fall have changed things around in the set more. It a different way of approaching that which they
asleep. He just wasn’t into it would’ve been nice to do different want to discuss. I’ve also been offered the
anymore. songs every night. As a musician chance to play with various bands on different
you like to play different things. There’s quite a few things I’ve been
The wounds took a while
things. It’s different for Ozzy offered but I just want to breathe a bit. The last
to heal but you finally
though because some of few years have been quite intense so I want that
got there in 1997. It’s
the old songs are really looseness for a bit. I don’t want to stop playing,
been a stop-start
hard to sing. A song though, and I won’t because I love it too much.
reunion but 13 was
like Symptom Of The There’s always something for me to do and, in
a Number 1 album.
Universe is just too the end, I’m glad because that’s really good.
How do you view
high for him to sing. Let’s see what comes next.
the album now?
You know what I’m
like. It’s hard to leave
it at that as far as I’m
concerned. I don’t
think it’s the best album
we’re ever going to do.
But, bearing in mind the
circumstances in which we did
it with me falling ill, it’s pretty
good. The process of making it brought
the three of us so much closer together. That
was great. The guys were really there for me,
they were real friends. We had Rick Rubin
involved and there were times when we were
at loggerheads.
What did you disagree about?
Basically, Rick wanted to recreate the first album
sounds. We recorded at Rick’s place out in LA
and strange things would happen. Like a stack of
10 vintage Marshall amps would appear in the Fiends reunited:
studio. I’d be like, “What are they for?” And he’d Sabbath’s original
say, “They’re vintage amps to get that old sound.” line-up at Monnow
Then I’d say, “But I used Laney amps to get that Valley Studios,
sound.” The next day a load of Laney amps would Wales, May 1998.
turn up which didn’t exist when we recorded the

PLANET ROCK 95
. . .ALBUMS YOU NEED TO HEAR RIGHT NOW!
Your hand-picked selection of essential
releases… Foo Fighters, Black p98

Country Communion, Oh Sees, p100 p101

QOTSA, The Darkness, Alter


p102 p103

Bridge, Josh Todd, Prophets Of


p104 p104

Rage, Arcane Roots, Gun,


p104 p105 p105

Lionize, Lionheart, Dead Cross,


p105 p105 p106

Living Colour, King King, Koyo,


p106 p106 p106

Lukas Nelson, Dead Lord, p107 p107

Wayward Sons, Suzi Quatro, p107 p108

Motörhead, Monster Magnet,


p110 p110

Saxon, ELP, Stone Temple Pilots


p110 p110 p110

PLUS BOOKS & DVDS Foreigner, Jane’s p112

Addiction, Guns N’Roses,


p113 p113

Greg Lake, Brian Slagel


p113 p113

AND... LIVE ACTION ZZ Top, Tyler Bryant p118

& The Shakedown, Saxon p120 p122

PLANET ROCK 97
Albums


Experimental. Intriguing.
Classic rock rewired in


fascinating fashion...
Dave Grohl’s arena rockers get “weird” B Y PA U L B R A N N I G A N DOUHDG\KHDYLO\LQÀXHQFHGE\6DEEDWKĪWDUĥWKLFN

FOO FIGHTERS
on shape-shifting ninth album. IX]]HGĥRXW LQWUR ULɱī DQG )OR\G ĪO\VHUJLF YRFDOV
JUDFHIXOSDFLQJ'DYLG*LOPRXUJXLWDUVKDGLQJī
IT’S TELLING that when Foo Fighters closed “He left the room and I said, The rest of the
their summer 2017 European tour at Athens’ fucking record has to sound like this!” Grohl
Concrete And Gold
stunning Odeon of Herodes Atticus on July 10, COLUMBIA
UHYHDOHG7KHUHVXOWWKHQLVDFROOHFWLRQURRWHG
not a single track from 2014’s Sonic Highways LQFODVVLFURFNEXWUHZLUHGLQIDVFLQDWLQJIDVKLRQ
IHDWXUHGDPLGWKHLUĥVRQJVHWOLVW$FRPSDQLRQ
piece to the HBO series of the same name, frontĥ
++++ ,W VWDUWV LQ WKH PRVW ORZĥNH\ PDQQHU ZLWK
7ĥ6KLUW*URKOFURRQLQJ³,GRQ¶WZDQQDEH.LQJ
man Dave Grohl’s “love letter to the history of I just wanna sing a love song, pretend there’s
American music”, the album was compromised nothing wrong…” over spare, sparse minor
as a result of the concept attached to its creation, namely that each of FKRUGV)URPKHUHKRZHYHULWH[SORGHVVN\ZDUGVLQDZHOWHURISRZHU
LWVHLJKWWUDFNVZRXOGEHZULWWHQDQGUHFRUGHGLQDGLɱHUHQW86FLW\ FKRUGV DQG VWDFNHG FHOHVWLDO KDUPRQLHV DQ XQDQWLFLSDWHG VKDSHĥVKLIW
LQVSLUHGE\WKHKLVWRU\DQGPXVLFDOKHULWDJHRILWVELUWKSODFH ZKLFK SUH¿JXUHV WKH XQLQKLELWHG QDWXUH RI WKH  PLQXWHV RI PXVLF
Though the conceit was consistent with Grohl’s desire to frame ZKLFKIROORZV
HDFK)RR)LJKWHUV/3ZLWKDGLVWLQFWQDUUDWLYHĦLWVSUHGHFHVVRU¶V Part of the joy of Concrete And Gold is the inescapable sense that the
muscular Wasting Light, was recorded in Grohl’s garage by Nevermind )RRV QRZ H[SDQGHG WR D VH[WHW ZLWK ORQJĥVHUYLQJ NH\ERDUGLVW 5DPL
producer Butch Vig, and envisaged as a “tapping the source” collection -DɱHH DFFRUGHG IXOO PHPEHU VWDWXV ZHUH KDYLQJ D JHQXLQH EODVW DW
ĦWKHVHDUWLVWLFVWULFWXUHVDQGWKHDWWHQGDQWWLPHFRQVWUDLQWVUHVXOWHGLQ +ROO\ZRRG¶V (DVW:HVW VWXGLR *URKO JHWV WR UHYLVLW KLV:KLWH /LPR
DQXQHYHQFROOHFWLRQHDVLHUWRDSSUHFLDWHWKDQWRWUHDVXUH snarl on the otherwise dreamy Run, Dirty Water switches at its midĥ
But if Sonic Highways was the sole Foo Fighters album not SRLQW IURP ODQJXLG MD]] OLFNV LQWR D JORULRXVO\ ¿OWK\ VD[ĥDXJPHQWHG
represented at the band’s televised Acropolis, Wow! spectacular, it’s GURQHĥURFNULɱDQG6XQGD\5DLQUHORFDWHVWKH
VLJQL¿FDQWWRRWKDW'DYH*URKOHOHFWHGWRLQFOXGHQRIHZHUWKDQ¿YH (DJOHVIURP/DXUHO&DQ\RQWR/RQGRQ¶V8)2
selections from Concrete And GoldWKHQVWLOOWZRPRQWKVIURPUHOHDVH &OXEFLUFD
In an age where record company paranoia over piracy ensures that even And if Grohl’s lyrics remain frustratingly
the most undistinguished releases are guarded as if they are freshly opaque, maybe that’s part of the fun, satisfying
excavated ‘lost’ Led Zeppelin sessions, this displayed a welcome chutzĥ as it may be for the curious to know the
pah: moreover it suggests that Grohl is preternaturally pleased with VLJQL¿FDQFH RI WKH QDPHFKHFNV IRU SRVWĥSXQN
ZKDW KLV EDQG XQWHWKHUHG IURP VHOIĥLPSRVHG UHVWULFWLRQV KDYH mavericks Psychic TV, Whitehouse and Death
IDVKLRQHGWKLVWLPHDURXQG$VZHOOKHPLJKWEH In June in the thrillingly punchy La Dee Da, or
Those speculating in advance as to the colour and shape of Concrete the source for “licking bitter envelopes, blood
And Gold have zeroed in on the hiring of producer Greg Kurstin, best on your tongue” in the otherwise jaunty, Beatĥ TRACKS
known for his work with Adele, Sia and Ellie Goulding, as telegraphing OHVĥLQÀXHQFHG+DSS\(YHU$IWHUĪ=HUR+RXUī T-Shirt
DSRWHQWLDOVKLIWLQWRμSRS¶WHUULWRU\)URPDEXVLQHVVVWDQGSRLQWWKLV Grohl has likened Concrete And Gold to Run
would make sense: in 2016, Metallica’s Hardwired collection was the “Motörhead’s version of Sgt. Pepper” and “Slayer Make It Right
sole hard rock/heavy metal album to top 500,000 sales in America, and making Pet Sounds´,W¶VQHLWKHUREYLRXVO\EXW The Sky Is A
86UDGLRKDVODUJHO\DEDQGRQHGULɱĥURFN%XWZKDW)RR)LJKWHUVKDYH it’s undeniably an album ambitious in scale and Neighborhood
FUHDWHGKHUHĦLQVSLUHGQRGRXEWE\*URKO¶VSUHĥSURGXFWLRQSHSĥWDON rich in invention, yielding more tricks and La Dee Da
RQKLVQHZVRQJVĪ³/HW¶VPDNHWKHPORQJOHW¶VPDNHWKHPQRLV\OHW¶V WUHDWV ZLWK HDFK VXFFHVVLYH OLVWHQ ,W ZRQ¶W Dirty Water
PDNHWKHPZHLUG´īĦLVLQ¿QLWHO\PRUHLQWULJXLQJ imperil the Foos’ stadium rock status, but gleeĥ Arrows
An unlikely catalyst for this atypically experimental approach, fully detonates any criticism that Grohl’s unit Happy Ever After
*URKOUHFHQWO\FRQIHVVHGZDV%R\],,0HQYRFDOLVW6KDZQ6WRFNPDQ DUH ULVNĥDYHUVH RU FRPSODFHQW 7KH VRQLF (Zero Hour)
Invited to record backing vocals for Concrete And Gold’s title track, the KLJKZD\VDKHDGKDYHQHYHUORRNHGPRUHRSHQ Sunday Rain
5 % WHQRU UHVSRQGHG E\ OD\HULQJ PXOWLĥ The Line
I L L U S T R AT I O N B Y tracked choral vocals, adding a grandiose B E ST TRACKS: Concrete And Gold, La Dee Da, Concrete And Gold
GIAN GALANG Queen sheen to a striking album closer The Sky Is A Neighborhood

PLANET ROCK 99
Fire and ice: BCC
return in style.


A phoenix rises from


the ashes to take flight...
Glenn Hughes and Joe Bonamassa’s hard BY STEVE B E E B E E DOZD\VJRLQJWREHDSUREOHP,WOHGWRFDQFHOODWLRQV

BLACK COUNTRY
rock supergroup rise from the dead… and a frustrated breakdown, with both Hughes and
the guitarist airing their disappointment and apparĥ
THERE CAN be little debate about the meaning of HQWO\FRQVLJQLQJWKHSURMHFWWRKLVWRU\

COMMUNION
WKLV DOEXP¶V DUWZRUN D SKRHQL[ DVFHQGLQJ Ħ ZLQJV Three years later, an unlikely reunion was mootĥ
XQIXUOHG Ħ DV ÀDPHV OLFN DW LWV IHDWKHUV $IWHU DQ ed, and at this point perhaps BCCIV’s phoenix began
acrimonious ending in 2013, few would have expectĥ WR DW OHDVW SUHHQ LWV IHDWKHUV DQG SRNH LWV KHDG XS
ed Black Country Communion to be in any position BCCIV Hughes and Bonamassa are undoubtedly musicians
WRKHDOWKHPVHOYHVOHWDORQHWDNHÀLJKW MASCOT RI GLɱHUHQW PHQWDOLWLHV RQH %ULWLVK RQH$PHULFDQ
Yet, remarkably, the band that received its worldĥ +XJKHVROGHQRXJKWREHWKHVL[ĥVWULQJHU¶VIDWKHUDQG
wide radio debut on Planet Rock back in 2010 has ++++ despite the age gap, much the more comfortable with
not only returned but has exceeded its earlier WKHWUDSSLQJVRIURFNVWDUGRP<RXFRXOGFDOOLW\LQ
SURPLVH+HDYLHUPRUHIRFXVHGDQGELJJHULQHYHU\ DQG\DQJEXW¿UHDQGLFHPLJKWEHQHDUHUWKHWUXWK
respect, BCCIV isn’t perfect but it’s a true realisation Regardless, on BCCIV their connection is so
of four extraordinary talents, united through an instinctive chemistry DVVXUHG\RXFDQDOPRVWKHDUWKHFOLFNDVLWVQDSVLQWRSODFH<RXDOVRJHW
WKDWVXUSDVVHVWKHVWUHQJWKRILWVLQGLYLGXDOSDUWV WKH LPSUHVVLRQ WKDW %RQKDP LV JULQQLQJ GXULQJ WKH ZKROH WKLQJ
9RFDOLVWDQGEDVVLVW*OHQQ+XJKHVĪ'HHS3XUSOH7UDSH]HīKRRNHG His drum parts never exceed their purpose, but they’re joyfully
up with blues rock supremo Joe Bonamassa in 2009, and with the help LQGXOJHQW+HJLYHVSRZHUDQGSURSXOVLRQWRWKHHQWLUHDOEXPPHDQLQJ
RIGUXPPHU-DVRQ%RQKDPDQGIRUPHU'UHDP7KHDWHUNH\ERDUGSOD\HU WKDW HYHQ WKH ORQJHU WUDFNV RQ WKLV KRXUĥORQJ FRPHEDFN FRQVWDQWO\
'HUHN6KHULQLDQUHOHDVHGQRIHZHUWKDQWKUHHDOEXPVLQDVPDQ\\HDUV VKLIWJHDUDQGHQWHUWDLQ
The shows, if you were lucky enough to catch one, were incendiary but, From the very start, and perhaps tipping his hat to Jason’s late
JLYHQ%RQDPDVVD¶VKLJKSUR¿OHVRORFDUHHUFRPPLWPHQWWRWRXULQJZDV IDWKHU%RQDPDVVDQDLOVD%ODFN'RJĥW\SHULɱRQ&ROOLGHZLWK+XJKHV¶

100 P L A N E T R O C K
Albums


HODVWLF YRFDOV VHHPLQJO\ EHDPHG LQ IURP D
GLɱHUHQW JDOD[\ 8QOLNH PDQ\ VLQJHUV RI KLV
generation, the latter has lost none of his feral
Synapse-frying
collages, freak-beat
SRZHUĦKHJRHVIURPIXOOPHWDO\RZORQ6ZD\


WR PLGĥIDOVHWWR WHQGHUQHVV RQ /RYH 5HPDLQV
7KDWVDLGWKHJXLWDULVWKDVSOHQW\RIYRFDOVRXO
KLPVHOI IURQWLQJ WKH H[WUDRUGLQDU\ 7KH /DVW

TRACKS
6RQJ)RU0\5HVWLQJ3ODFH,W¶VLQVSLUHGE\WKH
VWRU\ RI YLROLQLVW :DOODFH +DUWOH\ WKH VWRLF
PXVLFLDQZKROHGWKHHLJKWĥSLHFHEDQGDERDUG
excursionism...
Collide the Titanic and apparently continued playing
Over My Head XQWLOVXFNHGLQWRWKH$WODQWLF¶VIUHH]LQJGHSWKV
The Last Song For $VRQJRIVHYHUDOSDUWVLWLQYROYHVH[TXLVLWHO\
My Resting Place HPRWLYHRSHQLQJDQGFORVLQJFKDSWHUVIHDWXUĥ BY STEVI E C H I C K The US underground’s

OH SEES
Sway LQJ YLROLQ DQG PDQGROLQ DQG D GDUN VKLIWLQJ next break-out band?
The Cove FHQWUDO VHFWLRQ :KLOH LW GRHV QRW VRXQG
The Crow OLNHDQ\WKLQJ%ODFN&RXQWU\&RPPXQLRQKDYH THE SIGNATURE project
Wanderlust UHFRUGHG EHIRUH LW LV FRQFHLYDEO\ WKHLU EHVW of John Dwyer, a career noiseĥ
Orc
Love Remains ZRUNWRGDWH nik of 20 years’ standing and
Castle Face
Awake the pioneering godfather of
0XFK PRUH IDPLOLDU LV 2YHU 0\ +HDG D
When The
Morning Comes
+XJKHVĥWKURZQ JURRYH EDOO ZLWK DQ LQVWDQWO\ +++++ the recent San Francisco
psychedelic rock renaissance,
DGGLFWLYHFKRUXV,W¶VLQWKHVDPHKHDGVSDFHDV
2QH/DVW6RXOIURPWKH¿UVWDOEXPDQGLVOLNHO\ 2K 6HHV ĪQR μ7KH¶ WKLV WLPH
WR¿QGLPPHGLDWHIDYRXUDORQJZLWKWKHVQRUWĥ DURXQGī KDYH QHYHU OHW WKHLU
LQJVZDJJHULQJ6ZD\$JDLQ+XJKHV¶FKHVWĥEXUVWLQJYRFDOODXQFKHVWKLV SUROL¿F RXWSXW Ħ  IXOOĥOHQJWKV WR GDWH QRW LQFOXGLQJ FRPSLODWLRQV
chorus with such power that it could be shaking hands with astronauts DQG FRQFHUW DOEXPV Ħ GLOXWH WKHLU LPSDFW Orc LV WKH JURXS¶V PRVW
DERDUGWKH,QWHUQDWLRQDO6SDFH6WDWLRQE\WKHWLPH\RXUHDGWKLV DGYHQWXURXVVHW\HWLWVPLQXWHVRIJDUDJHĥSV\FKDWUHDWIRUDQ\RQH
5DWKHUPRUHFXULRXVLV7KH&RYHDEOXHV\QXPEHUWKDWDGGUHVVHV ZLWKWZRZRUNLQJHDUVDQGDQRSHQPLQGWKDWZDQWVPHVVLQJZLWK
WKHNLOOLQJRIGROSKLQVLQ-DSDQ:KLOH5LF2¶%DUU\¶V'ROSKLQ3URMHFWLV %XLOGLQJRQWKHDFKLHYHPHQWVRIODVW\HDU¶VEUHDNWKURXJKA Weird
DFDXVHFORVHWR*OHQQ¶VKHDUWLWPD\EHWKDWWKHURFNFRPPXQLW\LVQ¶W Exits, OrcSOD\VLWSRO\PRUSKRXVO\SHUYHUVH¿QGLQJWLPHIRUSDVVDJHV
TXLWHUHDG\IRUKLVVRQJVDERXWVHDOLIH7KH&URZJHWVXVEDFNRQWUDFN RI DWPRVSKHULF LQWHULRU H[SORUDWLRQ Ī.H\V 7R 7KH &DVWOH¶V GDUNO\
DQGZKLOHLWODFNVDELJSD\ĥRɱWKHUH¶VDJULSSLQJEUHDNGRZQWKDWVWDUWV PDJQL¿FHQW FRGDī GRRP\ )OR\GLDQ EDOODGU\ ĪWKH VWDWHO\ RUJDQĥ
ZLWKSRSSLQJEDVVQRWHVDQGKHDGVLQWROLJKWQLQJĥVSHHGJXLWDUZRUNYLD IXHOOHG&DGDYHU'RJīDQGEUDLQĥVFUDPEOLQJIUHDNĥEHDWH[FXUVLRQLVP
6KHULQLDQ¶VÀDVK\RUJDQVROR ĪWKHV\QDSVHĥIU\LQJFROODJHVRI3DUDQRLVHīDOOH[SDQGLQJWKHJURXS¶V
:DQGHUOXVW WKRXJK RYHUORQJ SDOHWWHZLWKRXWORVLQJWKHLULGLRV\QFUDWLFYRLFH
UHYROYHVDURXQGDODQJXLG%HDWOHV 0RUHRYHUZKHQLWSOD\VWR2K6HHV¶IDPLOLDUVWUHQJWKVLWGHOLYHUV
ĥVW\OHKDUPRQ\ZKLOH$ZDNHLVD VRPH RI WKHLU ¿QHVW ZRUN HYHU Ħ 7KH 6WDWLF *RG¶V EUHDWKOHVV
SURSHUWUHDWDSRVLWLYHKLJKĥVSHHG SDQLFĥGULYHQ DQG LQVDQHO\ H[FLWLQJ UK\WKPV EODVWV RI LFRQRFODVWLF
URFN VRQJ VSXQ DURXQG VRPH JXLWDUVFUHHĪWKURZLQJ+@VNHU'@¶VWUHEO\IUHWĥDWWDFNKXUWOLQJWKURXJK
XQEHOLHYDEO\ ¿GGO\ ULɱV 7KH D KDOO RI PLUURUVī VSDUN\ ULɱDJH ĪVSUDLQHG SRVWĥSXQN SRZHUĥFKRUGV
DOEXP FRQFOXGHV ZLWK WKH FUDFNOLQJOLNHOLJKWQLQJEROWVīDQGDQGURJ\QRXVSV\FKĥSRSPHORGLRXVĥ
VKDSHĥVKLIWLQJ HSLF WKDW LV :KHQ QHVV FRXOG PDNH D FRUSVH IUXJ 7KXV IDU D
7KH 0RUQLQJ &RPHV Ħ LWV FOLPD[ FXOWĥLVKFRQFHUQ2K6HHVDUHDUJXDEO\QRZ
WUDQVSRUWV XV YLD D ELJĥULɱHG =HSSHOLQ WKH PRVW LPSRUWDQW DOWHUQDWLYH
JOLGHĥSDWK WRZDUGV +XJKHV¶ WUDQTXLO rock group currently operating,
DQGYDJXHO\SV\FKHGHOLFKRRN a crew who know just
,WLVWREHKRSHGWKDWWKLVSKHQRPĥ what buttons
HQDOEXWWXPXOWXRXVEDQGFDQ¿QG
D ZD\ WR IRFXV RQ WKH IRUPHU
without the constant dragĥ
JLQJ RI WKH ODWWHU ,I WKH\
to press to TRACKS
can, then BCCIV is the
SKRHQL[ WKDW FRXOG send their The Static God

UDLVHWKHPIURPWKH D G P L U H U V Nite Expo


DQJULHVWRI¿UHVWR JOHHIXOO\ PDQLF Animated Violence
OrcIHDUOHVVO\PDVKHV Keys To The Castle
the biggest of
those buttons like a Jettison
VWDJHV
JUDQGPDVWHU SOD\LQJ 7HNNHQ
Cadaver Dog
WKH UHVXOW LV WKH ¿QHVW QRLVH WR
B E ST Gleefully Paranoise
FUDZORXWRIWKH$PHULFDQXQGHUĥ
TRACKS : manic: Oh Cooling Tower
JURXQGLQ\HDUV
Sees make Drowned Beast
Collide, The
a fine noise.
Last Song For B E ST TRACKS: The Static God, Raw Optics
My Resting Place, Sway Animated Violence, Cooling Tower

P L A N E T R O C K 101
Albums


Hooks, fun and grooves


led with the heart...
Homme’s heroes return – and this time BY STEVI E C H I C K VWHHO\F\ERUJWHFKDQGDEHDWZKRVHJUDQGIDWKHURQFH

QUEENS OF
they’ve got the Saturday night fever. VWUXWWHGLQDZKLWHÀDUHGOHLVXUHVXLWRQDQLOOXPLQDWHG
GDQFHÀRRU 7KH DOEXP WHDPV +RPPH ZLWK SRS
JOSH HOMME, indestructible bastard. Invented SURGXFHU 0DUN 5RQVRQ WKH PDQ EHKLQG 8SWRZQ

THE STONE AGE


VWRQHUURFNZLWKKLVGHVHUWĥGZHOOLQJEXGGLHV.\XVV )XQNDQG7KH%LNH6RQJEXWMXVWDV\RX¶UHIHDULQJWKH
5RGHWKHEXFNLQJEURQFRWKDWZDV6FUHDPLQJ7UHHV ZRUVW NLQG RI VHOOĥRXW FURVVRYHU FULPH +RPPH¶V
5HWXUQHG WR WKH GHVHUW DQG IRUPHG 4276$ WKH IDPLOLDUKROOHUNLFNVLQVQDUOLQJVRPHVLQIXODXWRELRJĥ
PRVWEDGDVVSDFNRIPDUDXGLQJSLUDWHVDQGSXUYH\ĥ Villains UDSK\³,ZDVERUQLQWKHGHVHUWEDEH«7KHQHHGOHKLW
RUVRIVRPHRIWKHPRVWPLQGĥEORZLQJURFNWKHJHQUH MATADOR WKH JURRYH« , ZDV FKDVLQJ ZKDW ZDV FDOOLQJ PH«´
KDVHYHUKHDUGμ7KH*LQJHU(OYLV¶WKH\FDOOHGKLP $QG\RXUHDOLVHWKDWLIWKLVPDQHYHUFXWDOLQHĥGDQFLQJ
WKRXJKUDUHO\WRKLVIDFHDWZRĥ¿VWHGIURQWPDQZKR ++++ UHFRUGHYHQWKDWZRXOGSUREDEO\URFNWKHIXFNRXW
QHYHU PHW DQ LUULWDQW KH FRXOGQ¶W SXQFK RXW QHYHU 0DNH QR PLVWDNH 5RQVRQ¶V KDQG LV DXGLEOH
PHWDQLQWR[LFDQWKHZRXOGQ¶WFRQVXPHDQGWKHQVLQJ WKURXJKRXWVillainsDVHQVHRIJURRYHSHUYDGLQJWKH
DERXWLQVRPHIHHOJRRGKLWRIWKDWVXPPHU JXLWDUVFOLSSHG¿HUFHDQGDOZD\VODVHUĥJXLGHGWRWKHLU
$QGWKHQ«$URXWLQHERXWRINQHHĥVXUJHU\DQGKLVKHDUWVWRSSHG XOWLPDWHWDUJHW%XWVillainsLVQRDZNZDUGGDQFHÀRRUSUHWHQGHUOLNH
D EUXVK ZLWK GHDWK WKDW HQVXUHG ¶V …Like Clockwork was unlike VD\ 4XHHQ¶V Hot Space LWV IXQN PRYHV QHYHU VSXULRXV 4276$ SOD\
DQ\WKLQJ HOVH LQ WKH JURXS¶V FDWDORJXH /LIHĥDɷUPLQJ EXW GDUNĥ ZLWKWKHVDPHKHIWDQGIRFXVDVWKH=HSRI7UDPSOHG8QGHU)RRWRU
QHVVĥVWULFNHQ +RPPH VRXQGHG IRU WKH ¿UVW WLPH PRUWDO ,W ZDV :DQWRQ 6RQJ 8Qĥ5HERUQ $JDLQ D VLQIXO ERRJLH ZLWK WKH JXLWDUV
DPDVWHUSLHFHĦEXWZKHUHQH[WDIWHU\RX¶YHWULXPSKHGRYHUGHDWK" DQG V\QWKV FDXJKW LQ VRPH ;ĥUDWHG GDQFH OLNH WKH /DPEDGD RQO\
7KHDQVZHUPLJKWVXUSULVH\RXVillainsRSHQVZLWK)HHW'RQ¶W)DLO RQJRRGEDGGUXJV
0HWKUREELQJZLWKQHRQĥHGJHGV\QWKHVL]HUDFWLRQVLQHZJLYLQJZD\WR (OVHZKHUH5RQVRQ¶VOLJKWQHVVRIWRXFKNHHSV4276$¶VIRFXVVKDUS
WKH ULɱ RQ 'RPHVWLFDWHG$QLPDOV ULVLQJ OLNH KDFNOHV RQ WKH EDFN RI
DQHFNOLNHDYHLQZLUHGZLWKHOHFWULFLW\DQGWKHJRRQLVKJRQ]RLGSXQN
URFNRI+HDG/LNH$+DXQWHG+RXVHFDUHHQLQJOLNHDKRWZLUHGFORZQĥ
FDU FRPSOHWH ZLWK &UDPSVĥ\ YRFDOV DQG +DOORZHHQĥUHDG\ 7KHUHPLQ
EODVWV7KLVLVQ¶WWKH4276$WKDWFKDVHGNUDXWĥ\WUDQFHĥ\VWRQHUQLUYDĥ
QDIRUPLQXWHVRQHQGRQWKHLUGHEXWWKH-RVK+RPPHRIVillains has
QLFNHG5R[HWWH¶VROGPDQWUDGRQ¶WERUHXVJHWWRWKHFKRUXV
+HUH+RPPH¶VXQDIUDLGWRSOD\KLVZRUGVWRWKHIRUHEXLOGLQJRQ
WKHPDWXULW\WKDWFKDUDFWHULVHG…Like Clockwork+LGHDZD\SOD\VOLNHDQ
ROGFRXQWU\FODVVLF+RPPHPXVLQJ³,QQRFHQFH
LVZKDW\RXORVH/LNHNH\VDQGGUHDPVDQGROG
WDWWRRV´ 2Q )RUWUHVV KH¶V SURPLVLQJ ³,I HYHU
\RXUIRUWUHVVFDYHV<RX¶UHDOZD\VVDIHLQPLQH´
,W¶VDIDUFU\IURPWKHROG³QLFRWLQH9DOLXP
$ONDĥVHOW]HU,PRGLXP´VWUXWWLQJSHUKDSVEXW
on Villains+RPPHSXOOVRɱDQHDWWULFNRIUHĥ
YHDOLQJWKHPDQEHQHDWKWKHSHUVRQDRIEHLQJ
DELWRIDVRIWLHZLWKRXWJRLQJVRIW)ROORZLQJ…
Like Clockwork¶V ORQJ GDUN QLJKW RI WKH VRXO
KH¶V UHGLVFRYHUHG WKH SOHDVXUHV RI KDYLQJ IXQ TRACKS
DQG WKH SRZHU RI VD\LQJ ZKDW \RX PHDQ Feet Don't Fail Me
GHOLYHULQJDUHFRUGDZDVKZLWKKRRNVLQIXVHG The Way You Used To Do
ZLWKJURRYHXQDIUDLGWROHDGZLWKLWVKHDUW,W¶V Domesticated Animals
DQDOEXPWKDW¶OOFRQYLQFHWKHUH¶VOLWWOH+RPPH Fortress
FDQ¶WGRDQDOEXPWKDW¶OOOHDYH\RXEUHDWKOHVVWR Head Like A Haunted
VHHZKHUHKHJRHVQH[W0RVWLPSRUWDQWO\LW¶V House

Don’t hold back: WKHIHHOJRRGDOEXPRIWKH\HDUDQGORUGNQRZV Un-Reborn Again


Homme makes we need one. Hideaway
(another) feelgood hit The Evil Has Landed
of the summer.
B E ST TRACKS: Domesticated Animals, Hideaway, Villains Of Circumstance
Villains Of Circumstance

102 P L A N E T R O C K
Triumphant
return: The
Darkness.


They sound like
eccentricities on their sleeve, to embrace being, well… The Darkness.
7KLVWLPHDURXQGWKLQJVDUHGLɱHUHQW
On the most basic level, Pinewood Smile is thrilling because it
adheres to the most simple of mandates: rock very hard. To achieve

a band intent on this, sometimes they borrow liberally from AC/DC’s orthodoxy, at
others they branch out into the kind of metallised rock that Alter
Bridge have made a career out of. Regardless of approach, and even

reasserting their GXULQJWKHVOLJKWPLV¿UHRI%XFFDQHHUV2I+LVSDQLROD7KH'DUNQHVV


sound like a band intent on reasserting their sovereignty.
5HVWDVVXUHGWKHO\ULFVDUHFRPSUHKHQVLYHO\OXGLFURXV:KRHOVHLQ
2017 would record a song called Lay Down

sovereignty... :LWK 0H %DUEDUD":KR HOVH ZRXOG KDYH WKH


temerity to write a track about major commutĥ
LQJGHOD\VĦRQHVDPSOHO\ULF
on Southern Trains being,
“trying to eat dinner with an
Lowestoft’s glam rock boulevardiers put BY G E O R G E G A R N E R arse in your face, it’s a

THE DARKNESS
their troubled past behind them on disgrace”. This is to say nothĥ
ferociously confident comeback. ing of Japanese Prisoner Of
Love’s compelling account of
THERE ARE moments on The Darkness’s Pinewood being “taken by force from TRACKS
Smile that feel more like extracts from an autobiograĥ
Pinewood Smile
behind by a stabby white All The Pretty Girls
COOKING VINYL
phy than songs. Take Solid Gold, a strutting track supremacist named Klaus”. Buccaneers Of
which lays bare their early naivety and hubris in the
music biz, Justin Hawkins singing about an A&R who
++++ You wouldn’t want to meet
the person who doesn’t at
Hispaniola
Solid Gold
is “desperate to sign us, ’cos we melted his fucking least crack a smile during Southern Trains
IDFH´ (OVHZKHUH $OO 7KH 3UHWW\ *LUOV RɱHUV DQ these songs. Why Don’t The Beautiful
DFFRXQWRIWKHFRUURVLYHHɱHFWVRIRYHUQLJKWIDPHZKLOH,:LVK,:DV ,WZRXOGKRZHYHUEHDVKDPHLI7KH'DUNĥ Cry?
,Q+HDYHQVHHPLQJO\GHWDLOVZKDWKDSSHQHGDIWHUWKH\IDLOHGWRFDSLWDOĥ ness’s shtick obscures the fact that they are, Japanese Prisoner Of
ise on the blockbusting success of their 2003 Permission To Land debut. ¿UVW DQG IRUHPRVW D EULOOLDQW EDQG GHOLYHULQJ Love
“A year full of glory and an empty decade, came out for the encore but IUHQHWLF ULɱV DQG XQGHQLDEOH PHORGLHV $QG Lay Down With Me,
QRERG\VWD\HG´ODPHQWV+DZNLQV,QIDOVHWWRQDWXUDOO\ here they convert the narrative of their fall Barbara
,WLVRIFRXUVHDOOWUXH7KDQNVWRDFRPELQDWLRQRIGUXJVDOFRKRO from grace into a triumphant comeback. I Wish I Was In Heaven
HJR PRUH GUXJV DQG D ¿FNOH SXEOLF7KH 'DUNQHVV EHFDPH WKH YHU\ Happiness
URFN¶Q¶URFN UROO FOLFKpV WKH\ ZHUH RIWHQ SDVWLFKLQJ :KDW WKH\ KDYH B E ST TRACKS: Solid Gold, Southern Trains, Stampede Of Love
ODFNHGIRURYHUDGHFDGHQRZLVWKHFRQ¿GHQFHWRZHDUWKHLULQDOLHQDEOH Lay Down With Me, Barbara

P L A N E T R O C K 103
Rage Against
The Public Hill:
revolutionary.

captured on a recording, no one told Alter


%ULGJH IRU WKLV GRFXPHQW RI WKH TXDUWHW¶V
November 24 show at the world’s busiest
FRQFHUW YHQXH LV PRUH WKDQ MXVW D NHHSVDNH
IRU WKRVH ZKR ZHUH LQ DWWHQGDQFH )URP
UROOLFNLQJ RSHQHU7KH:ULWLQJ 2Q7KH:DOO
WKURXJK WKH ODPHQWLQJ DFRXVWLFĥOHG :DWFK
2YHU <RX WR WKH ERPEDVWLF PHORGLF URFN
FORVHU0\&KDPSLRQWKHVHQVHWKDWWKHZHOOĥ
GULOOHG )ORULGD IRXUĥSLHFH KDYH WKH DXGLHQFH
LQ WKHLU SDOPV LV SDOSDEOH ZLWK FURZG VLQJĥ
alongs bringing an energy usually lost in
translation. An extra disc of rare/unreleased
WUDFNV VWURQJ HQRXJK WR VWDQG RQ LWV RZQ
GHIWO\ GHPRQVWUDWHV WKDW WKH TXDUWHW KDYH
KRQHG WKHLU PHWDOOLFĥURFN FKRSV LQWR PRUH
WKDQ PHUH DUHQDĥURFNĥE\ĥQXPEHUV 7KRVH
VHHNLQJWKHQH[WJHQHUDWLRQRIIHVWLYDOKHDGĥ
liners could do worse than starting here.
CAREN GIBSON

B E ST TRACKS: 7KH:ULWLQJ2Q7KH:DOOīOLYHĬ
Zero, Never Born To Follow

JOSH TODD & THE CONFLICT


Year Of The Tiger
CENTURY MEDIA

++++
Buckcherry singer

PROPHETS OF RAGE
and guitarist go for
pumping manifestos. And while broke on cathartic
not reaching the sonic highs of side project.
Prophets Of Rage their previous projects, they’ve
Step on a viper and you
FANTASY GHOLYHUHG D VSLN\ UHVLVWDQFH
can expect it to uncoil at speed and jab
++++
project that ensures their
you with venom. That’s pretty much
dissident juggernaut can
ZKDW KDSSHQV KHUH Ħ ZLWKRXW WKH
Moshpit manifestos from GLVSDWFK ³GDQJHURXV VRQJV
VFUHDPLQJDQGSDLQWKDQNIXOO\7KHXQĥ
the rock-rap supergroup. for dangerous times”.
GLVFORVHG WKLQJ WKDW KDV UDWWOHG %XFNĥ
An unexpected rush on this MATT ALLEN
cherry frontman Josh Todd and guitarĥ
summer’s festival circuit, LVW6WHYLH'KDVUHVXOWHGLQDKDUVKOHDQ
B E ST TRACKS: Living On The
VHOIĥSURIHVVHG ³HOLWH WDVNIRUFH DOEXP IXOO RI ZKLSODVK VWUHHW PHWDO OLNH
110, Unfuck The World, Hail To
of revolutionary musicians” Prophets Of WKHSXQFK\WLWOHWUDFNDQG7KH&RQÀLFW
The Chief
5DJHPLQHERWKURFNQRVWDOJLDDQGULJKWHRXV 0HDQZKLOH )XFNHG 8S LV DERXW DV H[ĥ
anger. Combining the engine room for Rage plosive a release of frustration as you
Against The Machine’s scorched grooves FDQLPDJLQH,WLVQ¶WDOOOLNHWKDWĦ5DLQ
Ī7RP0RUHOOR%UDG:LON7LP&RPPHUIRUGī
with the vocal heft of Public Enemy frontman ALTER BRIDGE and Good Enough are more
UHÀHFWLYHEXWWKHO\ULFVVWLOOVXJJHVWD
&KXFN ' DQG &\SUHVV +LOO¶V %ĥ5HDO WKH Live At The O2 Arena PLQG LQ WXUPRLO VHHNLQJ DQVZHUV
UDSĥPHWDO VXSHUJURXS KDYH XSGDWHG WKHLU + Rarities Meanwhile, Erotic City’s disco hue
LPSUHVVLYHEDFNFDWDORJXHVZLWKD¿QHGHEXW NAPALM  aligns it more closely with the duo’s
WKDW IXVHV VOHGJHKDPPHU ULɱV ZLWK DQWKHPV
RI SROLWLFDO IXU\ $QWLĥHVWDEOLVKPHQW EORZV
++++ other band. This isn’t simply the
VRXQGRI%XFNFKHUU\RQVSHHGĦ
ODQG KHDY\ KHUH WKH EXFNLQJ WKUDVK RI Florida rockers’ it’s the best album that the band
8QIXFN 7KH :RUOG Ī³)XFN UDFLVWV´ī 7DNH landmark 2016 never made.
Myles Kennedy:
0H +LJKHU¶V PHWDOĥFODG IXQN ¿UH Ī³<RX¶UH D O2 show in full – STEVE BEEBEE
crowd pleaser.
WDUJHW´ī DQG WKH VSLUDOLVHG JXLWDU OLFNV RI and much more.
/LYLQJ2Q7KHĪ³<RXGHSHQGRQGHPRFUDĥ If it’s a truism that the B E ST TRACKS: Push It,
F\ K\SRFULV\´ī DOO PDNH IRU H[FHOOHQW ¿VW spirit of a live gig can never be fully Fucked Up, Rain

104 P L A N E T R O C K
Albums

ARCANE ROOTS LIONHEART


6HFRQG1DWXUH
LIONIZE
Melancholia Hymns 1XFOHDU6RXO
EASY LIFE/RED ESSENTIAL AOR HEAVEN THE END 

++++ ++++ +++


Kingston-upon-Thames Former Iron Maiden Foot-stomping,
trio soar skywards. guitarist’s 1980s band deep-grooving blues-rock
Arcane Roots have developed completes remarkable from Clutch’s mates.
a reputation for crafting sideĥ comeback. +DUGĥKLWWLQJ EOXHV URFNHUV
winding slabs of proggressive ,W¶V SUREDEO\ VDIH WR VD\ ZH /LRQL]H KDLO IURP WKH FUHDWLYH
atmospheric rock, most notably on 2013’s weren’t expecting this. Formed back in 1980 hive of Maryland, and consequently spent
Blood & Chemistry. Melancholia Hymns further E\ JXLWDULVW 'HQQLV 6WUDWWRQ ZKR SOD\HG RQ much of their formative years bonding with
advances their claim for greatness, bringing ,URQ 0DLGHQ¶V VHOIĥWLWOHG GHEXW /LRQKHDUW IHOORZ 2OG /LQH 6WDWH QDWLYHV &OXWFK ZKRVH
%Lɱ\&O\URĥVL]HGJXLWDUULɱVDQGPHORGLHVWRD made one album, +RW7RQLJKW, before abruptly Weathermaker imprint was their last home.
grandiose soundscape underpinned by band disappearing. A new version of the band 7KHLU FORVH UHODWLRQVKLS KDV OHG WR &OXWFK
OHDGHU $QGUHZ *URYHV¶ KDXQWLQJ JKRVWĥRQĥ returned in 2016 to play the Rockingham JXLWDULVW7LP6XOWSURGXFLQJ1XFOHDU6RXO, the
WKHĥPRRUV YRFDO UDQJH 2Q DQ DOEXP ZKRVH )HVWLYDO Ħ EXW ZKDW¶V UHDOO\ LPSUHVVLYH LV WKH TXDUWHW¶V VL[WK DOEXP 1RZ LQWR WKHLU WK
complexities are revealed with repeated plays, fruits of their labour since then. 6HFRQG1DWXUH \HDU WKH\¶YH SDUHG EDFN WKH UHJJDHĥ DQG
the highs arrive when distorted, heavy guitars is classic hard rock that doesn’t shy away from IXQNĥLQIXVHGVSDFHMDPVRIWKHSDVWWRSORXJK
are twinned with scattershot drum grooves VKRZSLHFH ORRNĥDWĥPH FKRUXVHV 7KHVH DUH a more turbocharged rock furrow: think Five
Ī6ROHPQīRURQVHYHUDOVQLSSHWVRIEURRGLQJ WKH W\SH RI KRRNV 'HI /HSSDUG IDQV ORYH Ħ +RUVH -RKQVRQ DQG 5RDGVDZ ĪRU &OXWFK DQG
V\QWKĥGULYHQ KDUPRQ\ Ī,QGLJR¶V DWPRVSKHULF SURXGSXPSHGKDUPRQLHVĦDQGWKHUH¶VDWRQ FODVVLF%ODFN&URZHVZLWKPRUHFRZEHOOīDQG
close; dreamy, slow burning album opener, of imaginative and compelling guitar work \RX¶UHFORVH7KHUHJJDHDQGIXQNLQÀHFWLRQV
%HIRUH0Hī$QDEVHQFHRIREYLRXVUDGLRKLWV IURP 6WUDWWRQ DQG 6WHYH 0DQQ ĪH[ĥ0LFKDHO VWLOOSHSSHUWKHOLNHVRI$LQ¶W,W$6KDPHEXW
might slow their progression to festival 6FKHQNHU *URXSī WR EDFN WKHP XS 1HZ it’s a subtle accent, allowing the soulful
ubiquity, but it won’t be for a lack of ambition. IURQWPDQ /HH 6PDOO KLWV WKH KLJK QRWHV +DPPRQG RUJDQ DQG PXOWLĥOD\HUHG KDUPRĥ
MATT ALLEN ZLWKRXW VDFUL¿FLQJ RQH LRWD RI VRXO PDNLQJ QLHVWRSOD\WKHVWDUULQJUROHKHUH,I\RXPLVV
6HFRQG 1DWXUH D GDPQ QHDU PXVWĥEX\ UHOHDVH 6RXWKHUQ +DUPRQ\ĥHUD %ODFN&URZHV 1XFOHDU
B E ST TRACKS: 6ROHPQ,QGLJR2ɲ7KH)ORRU IRUELJĥPDQHGURFNHUV 6RXO is a solid investment.
STEVE BEEBEE CAREN GIBSON

B E ST TRACKS: *LYH0H7KH/LJKW3ULVRQHU

GUN
B E ST TRACKS: 'DUNHVW7LPHOLQH3RZHU*ULG
Lionheart /HW<RX'RZQ
)DYRXULWH3OHDVXUHV
CAROLINE INTERNATIONAL

++++ Gun: firing


on all
The Italo-Glaswegian cylinders.
outfit’s seventh album.
Given the band’s numerous
OLQHĥXSFKDQJHVRYHUWKH\HDUV
you could be forgiven for
thinking that the favourite pleasures of Gun
O\QFKSLQV 'DQWH DQG *LXOLDQR *L]]L DUH
KLULQJDQG¿ULQJ/DVWPDQLQWKLVWLPHLVQHZ
lead guitarist Tommy Gentry, a tasteful player
who adds extra vim to an album teeming with
KRRN\ULɱVDQGPHPRUDEOHSRSĥURFNFKRUXVĥ
es. The set is largely a return to the tougher
textures of debut album 7DNLQJ2Q7KH:RUOG
and Swagger, but piano ballad closer The Boy
:KR)RROHG7KH:RUOGPD\EHWRR86WHHQ
soap opera for some. Thankfully, Gun strike
bullseyes elsewhere, the title track a winning
cousin of Zeppelin’s Trampled Underfoot, and
6KH.QRZVDPLQLPDVWHUSLHFH
JAMES MCNAIR

B E ST TRACKS: 6KH.QRZV+HUH·V:KHUH,$P
6LOHQW/RYHU

P L A N E T R O C K 105
Albums

DEAD CROSS :KLWHVQDNH¶V*LYH0H$OO<RXU/RYHī)ODJĥ


VKLS VLQJOH Ī6KH 'RQ¶Wī *LPPH 1R /RYLQ¶ LV
DFH WRR D O\ULFDO EHGIHOORZ RI 7RP -RQHV¶
DQG WKH JHQLXV JXLWDU H[FXUVLRQV RI 9HUQRQ
5HLG ZKLFK VZLQJ IURP FODVVLF VOLGH ZDLO WR
IXOOĥRQ );ĥIUHDNĥRXW$Q LQFHQGLDU\ FRYHU RI
Dead Cross
IPECAC preposterous melodrama Daughter Of Darkĥ 5REHUW-RKQVRQ¶V3UHDFKLQ¶%OXHVWUDFHVWKHLU

++++
QHVV³6WRQHFROGGHYLOZRPDQIRROLQ¶DURXQG´ path back to the source, but Living Colour
URDUV1LPPRHPSOR\LQJWKHFXULRXVOH[LFRQ PDNH WKH VWDQGDUG WKHLU RZQ$V 5HLG VD\V
Mike Patton/Dave hard rock reserves for its Jezebels. ³7KHEOXHVLVDPLUURU´DQGRQShade, his band
Lombardo ‘supergroup’ JAMES MCNAIR KDYHIRXQGDFOHDUUHÀHFWLRQRIWKHPVHOYHV
in manic hardcore treat. STEVIE CHICK
B E ST TRACKS: ī6KH'RQ·WĬ*LPPH1R/RYLQ·
If there’s something ludicrous
about Faith No More/ Find Your Way, Heed The Warning B E ST TRACKS: 3UHDFKLQ·%OXHV)UHHGRP2I

Fantômas frontman Mike Patton deciding, at Expression, Who Shot Ya?


WKH DJH RI  WR UHFRUG KLV ¿UVW KDUGFRUH
punk album, rest assured, Dead Cross is no
laughing matter. Drummer Dave Lombardo
ĪIRUPHUO\RI6OD\HUQRZZLWK6XLFLGDO7HQGHQĥ
LIVING COLOUR KOYO
Shade
FLHVīJXLWDULVW0LNH&UDLQĪ5HWR[īDQGEDVVLVW MEGAFORCE KOYO
Justin Pearson Ī7KH /RFXVWī KDG DOUHDG\
recorded the music for the band’s savage ++++ 88 WATT

ĥPLQXWH GHEXW FROOHFWLRQ ZKHQ RULJLQDO


Six albums in, the New
++++
YRFDOLVW *DEH 6HUELDQ H[LWHG WKH JURXS DQG
York quartet have got a Ambitious, engaging first
WKHSURVSHFWRIPDNLQJDQROGVFKRROSHQFLOĥ
right to sing the blues. album from youthful
LQĥ\RXUĥH\HSXQNDOEXPDSSHDOHGWR3DWWRQ¶V
7KH EOXHV ZDV LQVSLUDWLRQ IRU Yorkshire prog-rockers.
QRWRULRXVO\ ZDUSHG VHQVH RI KXPRXU Dead
/LYLQJ &RORXU¶V VL[WK DOEXP 1RPLQDOO\ D SURJ FROOHFWLYH
Cross LV VKRW WKURXJK ZLWK 3DWWRQ¶V VFDWKLQJ
EXWGRQ¶WLPDJLQHDQ\NLQGRIWLUHGWUDGKHUH /HHGV TXLQWHW .2<2 QDPHG
F\QLFLVPQRWOHDVWWKHSURYRFDWLYH,GLRSDWKLF
7KHLUYLVLRQFRPHVLQPXOWLSOHKXHVWDNLQJLQ DIWHU WKH -DSDQHVH ZRUG IRU DXWXPQ OHDYHV
Ī³:H DUH DOO WHUURULVWV DQG IDJV DQG Q HUV
GUDJRQĥVOD\LQJPHWDOĪ3URJUDPīEDOOV\%LJJLH GUDZIURPDSRRORILQÀXHQFHVRQWKHLUGHEXW
DQGVSLFVDQGIXFNLQ¶GLUWĥEDJV´īEXWKLVYRFDO
FRYHUVĪDUHYHODWRU\UHDGLQJRI:KR6KRW<D"ī DEVRUELQJ HOHPHQWV RI SRVWĥURFN VKRHJD]H
GH[WHULW\ HOHYDWHV WKH DOEXP IDU DERYH LWV
DQGRQ&RPH2QIHHGLQJKRDU\KHDY\URFN SV\FK DQG DPELHQW HOHFWURQLFD LQWR D VRQLF
'5,'HHS:RXQGRULJLQV7KDW/RPEDUGR
through futuristic EDM sounds, a prank that PHODQJH2SHQLQJWUDFN6WUDQJH%LUG,Q7KH
ZKRSOD\HGRQ6OD\HU¶VSHHUOHVVReign In Blood,
WDNHVWKLVJURXS¶VJUDFHDQGPXVFOHWRSXOORɱ 6N\ LV D FDVH LQ SRLQW XQVSRROLQJ ZLWK
describes Dead Cross DV ³WKH KHDYLHVW DOEXP
)UHHGRP 2I ([SUHVVLRQ VDPSOHV 0DOFROP; 5DGLRKHDGĥVW\OH JOLWFK JXLWDUV DQG UROOLQJ
,¶YH HYHU UHFRUGHG´ VKRXOG EH LQYLWDWLRQ
ĪDVWKHJURXSGLGRQWKHLUEUHDNWKURXJK&XOW GUXP¿OOVEHIRUHH[SDQGLQJLQWRDZLGHVFUHHQ
enough for curious headbangers.
2I3HUVRQDOLW\EDFNLQīZKLOHVKRZFDVĥ FKRUXV5HFRUGHGLQWKH:HOVKFRXQWU\VLGHDW
PAUL BRANNIGAN
LQJ &RUH\ *ORYHU¶V IXUQDFHĥWKURDWHG YRFDOV D VWXGLR RZQHG E\ IRUPHU +DZNZLQG$PRQ
B E ST TRACKS: Shillelagh, Church Of The
Motherfuckers, Divine Filth
Fall guys: Leeds
quintet KOYO

KING KING
meddle with prog,
psych and post-rock.

Exile & Grace


MANHATON

++++
Taking a new direction,
studio album number four
is a right royal rumpus.
/DVW VHHQ ODGHQ ZLWK JRQJV DW
¶V %ULWLVK %OXHV $ZDUGV
*ODVJRZ&ODFNPDQQDQVKLUH TXDUWHW .LQJ
.LQJ KHUH WUDGH D VPLGJHRQ RI &HOWLF 'HOWD
NXGRV IRU D QHZ DQG PDMHVWLF JUDVS RI FRFN
URFN¶V ¿QHU SRLQWV :LWK NLOWĥWRWLQJ VLQJHUĥ
JXLWDULVW$ODQ1LPPRVHHPLQJO\FKDQQHOOLQJ
3DXOV5RGJHUVDQG.RVVRɱKHUHWKH\HPEUDFH
VWDGLD DQWKHPV DV QHYHU EHIRUH +DPPRQGĥ
EDQJLQJ OLJKWHUVĥDORIW WUDFNV VXFK DV )LQG
<RXU :D\ DQG +HHG 7KH :DUQLQJ VXJJHVW
.LQJ .LQJ DUH DOVR IDPLOLDU ZLWK &RYHUGDOH
+XJKHVĥHUD 'HHS 3XUSOH ĪWKH\ DOVR FRYHU

106 P L A N E T R O C K
Dirty Thrills:
get them while
they’re hot.

Düül II bassist Dave Anderson, its ten tracks Scarborough’s answer to Bon Jovi. Since then,
have a stately feel, luxuriating in rich, layered PLJKW\ĥYRLFHG IURQWPDQ 7RE\ -HSVRQ KDV
sounds. It’s easy to imagine the rural surrounds FRĥZULWWHQVRQJVZLWK.DWLH0HOXDDQGVXQJ
bled into the mix, not least on What Is Mine, with Fastway and Gun. Wayward Sons pairs
which mixes bucolic folk with echoes of KLP ZLWK EDVVLVW 1LF :DVWHOO ĪH[ĥ&KURPH
0HOORQ &ROOLH $QG 7KH ,QÀQLWH 6DGQHVVĥHUD Molly, a group familiar only to lapsed
Smashing Pumpkins, and The Beauty In .HUUDQJ UHDGHUV RI D FHUWDLQ DJHī7KHUH¶V D
Loneliness, featuring guest vocals from the /DVW&KDQFH6DORRQIHHOWRWKLVGHEXWDOEXP
studio cats. A classy, inventive, inviting debut. WKH ZRUN RI RQHĥWLPH SUHWW\ĥER\ URFNHUV
PAUL BRANNIGAN coming to terms with middle age spread and
stubble. Everything here sounds urgent and
B E ST TRACKS: 6WUDQJH%LUG,Q7KH6N\:KDW to the point: Give It Away and the standout
,V0LQH7HWUDFKURPDWī3DUWV Ĭ Until The End are awash with pummelling
JXLWDUV DQG VLQJĥVRQJ FKRUXVHV ZKLOH WKH

SHORT CUTS
RSHQLQJ WUDFN $OLYH LV WKH VRUW RI FKHVWĥ

DEAD LORD
beating arena rock Alter Bridge have built an
empire out of. If Wayward Sons had one big
power ballad and a set of American passports
,Q,JQRUDQFH:H7UXVW they’d probably be massive.
CENTURY MEDIA MARK BLAKE but ’80s glammers
Nothing More
+++ B E ST TRACKS: $OLYH8QWLO7KH(QG'RQ·W
THE STORIE S
WE TELL
The Quireboys fill
the air with
:DQQD*R*LYH,W$ZD\ summertime blues,
Tongue-in-cheek OURSELVE S
offering more in
Swedes pay homage to BETTER NOISE
Allman Brothers-
Jailbreak-era Lizzy. ++++ worship than

LUKAS NELSON
Though only the thickness of decadent sleaze.
Phil Lynott’s mirrored scratch
Jon Stevens
& PROMISE OF THE REAL
plate separates Stockholm’s Dead Lord from
STARLIGHT
D IXOOĥRQ7KLQ /L]]\ Sastiche, their playfully BMG
GXPEHGĥGRZQGHPHDQRXUDQGVXLWDEO\JXQJĥ
ho manner makes third album ,Q,JQRUDQFH:H /XNDV1HOVRQ 3URPLVH2I7KH5HDO For album number
+++
FANTASY six, the Texan radio
7UXVW a most enjoyable listen. That Hakim
Krim and Olle Hedenström are credited with
“left side guitar” and “right side guitar”
++++ rockers have
written some of the
most infectious
respectively on an album that was recorded to Superstar appearances songs of their
tape speaks volumes about their approach, and storytelling defines career to date.
Ex-INXS frontman
and they do indeed party like it’s 1976. “Tired latest outing from Neil
Jon Stevens gets a
of reruns in my head/Tired of dancing with Young collaborator(s). Dirty Thrills
little help from his
HE AV Y LIVING
WKH GHDG´ +DNLP VLQJV LQ EHVW ZDUULRUĥSRHW Talk about pressure. As if FRONTIERS MUSIC
friends – including
voice on Reruns, while Darker Times is all being the progeny of Willie Nelson wasn’t Ringo Starr and
syncopated swagger, spit and sawdust. Only enough, as part of Promise Of The Real,
++++ Eurythmics’ Dave
Stewart – on 11
on Part Of Me, a widescreen cowboy ballad, /XNDV 1HOVRQ DOVR KDG VRPH &UD]\ +RUVH tracks of soul-
does the chorus of The Boys Are Back In KRRI SULQWV WR ¿OO ZKHQ 1HLO<RXQJ DGRSWHG searching soft rock.
7RZQVHHPPRUHWKDQDGUXPĥ¿OODZD\ĦEXW WKHP DV KLV WRXULQJ EDQG <HW WKLV UHOHDVH
LW¶VDOOGRQHZLWKDɱectionate aplomb. FRQ¿UPV WKDW ZLWK 3275 LQ WRZ 1HOVRQ¶V Walter Trout
JAMES MCNAIR talent lies in nobody’s shadow. Whether WE’RE ALL IN
London upstarts THIS TOGETHER
PHUJLQJ FRXQWU\ DQG URFN WR VXEOLPH HɱHFW
led by Louis James, PROVOGUE/MASCOT
B E ST TRACKS: ,JQRUDQFH5HUXQV'DUNHU7LPHV on Forget About Georgia, or stomping
through America’s current, febrile political
son of one-time
Moody Blue Nicky,
++++
and cultural landscape on the loaded High come on like the
next Rival Sons.

WAYWARD SONS
Times, Nelson distinguishes himself throughĥ
out. His gift for storytelling is clearly evident,
The
Runnin’ Shine, with it’s opening: “My grand Quireboys
*KRVWV2I<HW7R&RPH ĥIDWKHU GLHG XS LQ WKH KLOOV RI $SSDODFKLD´ WHITE TR ASH
FRONTIERS MUSIC
EHLQJ RQH VXFK WKUHHĥPLQXWH HXORJ\ :LWK Walter Trout also
BLUE S
++++
gets his mates into
Lady Gaga supplying impassioned guest OFF YER ROCKA
the party. And it
YRFDOVRQ&DUROLQDDQG)LQG<RXUVHOISOXVKLV +++ looks though he
Former Little Angel Toby GDG¶V ÀHHWĥ¿QJHUHG VROR RQ -XVW 2XWVLGH 2I has even more: Joe
Jepson and friends keep Austin, Lukas Nelson has engineered a comeĥ Bonamassa, John
themselves limber by Mayall, Randy
EDFNRIPXFKPDJQL¿FHQFH
Bachman, Warren
bringing the noise. GEORGE GARNER Haynes, Sonny
Little Angels’ star burned Landreth… the list
EULJKWO\LIEULHÀ\DWWKHWXUQRIWKH¶VZLWK B E ST TRACKS: )RUJHW$ERXW*HRUJLD5XQQLQ· The weather may goes on and on.
the outside world quickly losing interest in 6KLQH+LJK7LPHV have let us down, AMIT SHARMA

P L A N E T R O C K 107
Reissues


A pint-sized rebel with
shitloads of attitude and


a gravelly voice...
Career summary of Leather Tuscadero is BY JA M E S M C NAI R ZLWK VKLWORDGV RI DWWLWXGH DQG D JUDYHOO\ YRLFH

SUZI QUATRO
a masterclass in pounding bubble-glam. WRXJKHQHG E\ HLJKW \HDUV RI WRXULQJ LQFOXGLQJ
At least to begin with… DVWLQWVXSSRUWLQJ7KLQ/L]]\DQG6ODGH
6RPHZKDW LQHYLWDEO\ LW¶V 4XDWUR¶V HDUO\ WULSĥ
IN THE HDUO\ĥWRĥPLGĥ¶V JODP ZDV HYHU\ZKHUH W\FKRIVPDVKKLWVLQJOHVHDFKRIZKLFKVROGRYHUD
The Best Of Suzi Quatro: Legend PLOOLRQ FRSLHV DW WKDW WLPH WKDW VWHDO WKH VKRZ
EXWJODPRXUZDVDOLWWOHKDUGHUWR¿QG0DQ\RIXV
ER\V WXUQHG WR 79 ZKHUH ZH JOLPSVHG FHUWDLQ CHRYSALIS KHUH&DQ7KH&DQUHPDLQVDPDUYHORIWULEDOGUXPĥ
LPSRVVLEO\H[RWLFZRPHQZKROHIWXVIHHOLQJSOHDVĥ PLQJ IHUDO VRXQGLQJ YRFDOV DQG GDIW O\ULFV DERXW
DQWO\ GLVFRPEREXODWHG 7KRVH +DPPHU +RUURU +++ D FDW JHWWLQJ LQWR DQ HDJOH¶V QHVW ,WV PXVLFDO
EHDXWLHV 'UDFXOD ELW -XOLH 1HZPDU DV &DWZRPDQ WHPSODWHUHSOHWHZLWK$ODVWDLU0F.HQ]LH¶VZRQGHUĥ
LQ UHĥUXQV RI %DWPDQ $QG 6X]L 4XDWUR LQ WKDW IXODQGVRPHZKDWXQVXQJHOHFWULFSLDQRLVUHSULVHG
]LSĥXSOHDWKHUMXPSVXLWRQ7RS2I7KH3RSV RQ&UDVKDQGWRDOHVVHUH[WHQW'HYLO*DWH'ULYHZKHUH0F.HQ]LH
,I\RXZDWFKHG¶VĥVHWVLWFRP+DSS\'D\VDVDOPRVWHYHU\ERG\GLG VZDSVWRDUHDOMRDQQD)RUDOOLWV¶VFRUQLQHVVĦZLWQHVVWKRVHUHYYLQJ
EDFN WKHQ 4XDWUR¶V WKUHHĥ\HDU DFWLQJ VWLQW RXWĥFRROLQJ 7KH )RQ] DV PRWRUF\FOHVDQGWKDWVLOO\³:HOFRPHWRWKHGLYHĪVLFī´YRLFHRYHUĦWKH
WRXJKĥJDOOHDGVLQJHU/HDWKHU7XVFDGHURWKH\RXQJHUVLVWHURI)RQ]LH¶V ODWWHU VRQJ UHPDLQV LPSRVVLEO\ FDWFK\ 7KRVH
JLUOIULHQG3LQN\7XVFDGHURKHOSHGFHPHQWKHULWĥJLUOVWDWXV%HWWHU\HW ³'RZQ LQ 'HYLO JDWH´ SXVKHV WKDW &KLQQ DQG
WKH ZRPDQ ERUQ 6XVDQ .D\ 4XDWUR KDG D EDFNĥVWRU\ DQG PXVLFDO &9 &KDSPDQEXLOWLQWRWKHVRQJDUHXWWHUJHQLXV
WKDWSURYHGVKHZDVPXFKPRUHOLNHWKHUHDOWKLQJWKDQKHU8.UHERRW (OVHZKHUH 6WXPEOLQ¶ ,Q DQG ,I <RX &DQ¶W
DWWKHKDQGVRIIDPHGUHFRUGSURGXFHU0LFNLH0RVWOHGVRPHWREHOLHYH *LYH 0H /RYH DQRWKHU EUDFH RI &KLQQ DQG
4XDWUR KDG JURZQĥXS LQ WKDW PRVW URFN¶Q¶UROO RI FLWLHV 'HWURLW &KDSPDQĥSHQQHG 4XDWUR KLWV IURP  DUH
+HU IDWKHU ZDV D VHPLĥSUR MD]] PXVLFLDQ ZKR ZRUNHG DW *HQHUDO QRWDEOHIRUWKHZD\WKH\HDVHRɱRQWKHUDXQFK
0RWRUVDQG6X]LOHDUQHGGUXPVDQGSLDQREHIRUHWHDFKLQJKHUVHOIEDVV DQG DLP IRU D IDLUO\ VOLFN FRPPHUFLDOLW\ %RWK
)URP4XDWURDQGKHUHOGHUVLVWHU3DWWLFRPSULVHGSDUWRIDOOĥJLUO DUH H[FHOOHQW VRQJV EXW WKH\ KDYH WKH VOLJKW
DFW7KH3OHDVXUH6HHNHUVZKRVHWZRVLQJOHVLQFOXGHG¶VTXHVWLRQĥ ZKLɱ RI ¶V79 YDULHW\ VKRZ 6HDVLGH 6SHFLDO
DEO\ WLWOHG %ĥVLGH *RRG .LQG 2I +XUW ,W ZDV DIWHU DQRWKHU VLVWHU DERXW WKHP DQG WKH IRUPHU D GXHW ZLWK TRACKS
1DQF\MRLQHG7KH3OHDVXUH6HHNHUVWKDWWKH\EHFDPH&UDGOH$QGWKH 6PRNLH¶V &KULV 1RUPDQ FRPHV RQ OLNH D
Can The Can
FUDGOHDVZHDOONQRZZLOOURFN EDUJDLQEDVHPHQW,VODQGV,Q7KH6WUHDPJUH\
Shine My Machine
7KXVZKHQWKHVROR4XDWURKDYLQJMXVWWXUQHGWRRNWKH1LFN\ ROG%ULWDLQ¶VSUHTXHOWR.HQQ\DQG'ROO\
48 Crash
&KLQQDQG0LNH&KDSPDQĥSHQQHG&DQ7KH&DQWRWKHWRSRIWKH8. ³0LFNLH 0RVW DOZD\V WROG PH μ<RXU VHOIĥ
Skin Tight Skin
&KDUWVLQVKHZDVDOUHDG\DIXOO\IRUPHGWDOHQWDSLQWĥVL]HGUHEHO SHQQHG VRQJV DUH WKH PHDW RI ZKDW \RX GR¶´
Daytona Demon
4XDWUR KDV VDLG 7KDW PD\ EH WUXH EXW OLNH
Devil Gate Drive
IHOORZ &KLQQ DQG &KDSPDQ EHQHIDFWRUV 0XG
Happy days: The Wild One
DQG 7KH 6ZHHW WKHUH ZDV D UHDVRQ ZK\ VKH
‘Leather’ with Cat Size
The Fonz.
QHHGHG WKHLU LQSXW MXVW DV WKHUH ZDV D UHDVRQ
ZK\ WKH\ QHHGHG KHU 6R ZKLOH 4XDWUR EULQJV Too Big

XWWHU FRPPLWPHQW WR WKH PLQL VWUHHWĥRSHUD Michael

6XLFLGHDFRĥZULWHZLWKKHUWKHQĥKXVEDQG/HQ Half As Much As Me

7XFNH\WDNHQIURPKHUDOEXP,f You Knew Stumblin’ In


Suzi… ¶V  0LQXWHV 2I )DPH ZLWK LWV If You Can’t Give Me Love
YRFRGHUDQG-*HLOV%DQGĥOLNHFKRUXVLVDZIXO Suicide
$OOWKDWVDLG4XDWURGRHVLQGHHGUHPDLQD Wiser Than You
³OHJHQG´ )LIW\ PLOOLRQ UHFRUG VDOHV KHU RQĥ She’s In Love With You
JRLQJ VXFFHVV DV D UDGLR EURDGFDVWHU DQG KHU Hollywood
ALAMY, REX

XSFRPLQJ8.DUHQDWRXUDOOWHVWLI\WRWKDW 15 Minutes Of Fame


Free The Butterfly
B E ST TRACKS: Can The Can, Devil Gate Drive, Dancing In The Wind
If You Can’t Give Me Love

108 P L A N E T R O C K
Solid gold:
Suzi Quatro at her
discombobulating
’70s zenith.
Reissues

EMERSON, LAKE & PALMER MONSTER MAGNET Heroes that stand out. They’re not uniformly
ZRQGHUIXO /HPP\¶V ERXUERQĥDQGĥUXVW\ĥ
QDLOVEDUNWHQGHGWRÀDWWHQPRVWWKLQJVLQLWV
)DQIDUHĦ Spine Of God/Tab
BMG/MANTICORE NAPALM SDWK LQFOXGLQJ D VRQJ¶V SDUWLFXODU QXDQFHV
%XW DOO WKH WUDFNV LQFOXGHG KHUH PDNH D
+++ ++++ VWURQJ FDVH IRU 0RW|UKHDG DV D ¿HU\
Career-spanning box of URFN¶Q¶UROODFWOLNHDODWWHUĥGD\/LWWOH5LFKDUG
remastered CDs, unis- Space-rock heroes take Ħ EXW ZLWK ZDUWV DQG D ELNHU¶V ¶WDFKH 7KH
sued live stuff and more. us back to the start of FORVLQJFRYHURI0HWDOOLFD¶V:KLSODVKKDVDQ
The six sets of live recordings the trip. 0& (VFKHUĥHVTXH TXDOLW\ ,W¶V 0RW|UKHDG
here mirror ELP’s career arc. There was always something a FRYHULQJ D VRQJ WKDW VRXQGHG OLNH D
Those from 1972 and ’73 show an eclectic but ELW GLɱHUHQW DERXW 0RQVWHU 0RW|UKHDG VRQJ LQ WKH ¿UVW SODFH PXVLF
XQL¿HG JURXS DW WKHLU SHDN SRZHULQJ WKHLU 0DJQHW:KLOHWKH1HZ-HUVH\RXW¿WRZHGDV history seemingly going around and around
way through material in a bombastic but PXFK WR 6DEEDWK DQG 3XUSOH DV DQ\ RWKHU in circles forever.
nonetheless thrilling manner. There were VWRQHU URFN JURXS LW ZDV WKH DFLGĥZDVKHG MARK BLAKE
PDQ\ ORQJXHXUV EXW EDFN WKHQ WKH DXGLHQFH IX]] DQG SV\FKHGHOLF KHDGĥPHOW LQKHULWHG
B E ST TRACKS: God Save The Queen, Jumpin’
SUDFWLFDOO\ GHPDQGHG HORQJDWHG PRRJ DQG IURPSURJUHVVLYHPDVWHUVOLNH+DZNZLQGWKDW
drum solos. The musicians have all been VHWWKHPDSDUWIURPWKHSDFN7KLVZRXOGEH Jack Flash, Heroes
TXRWHG DV UXHLQJ WKHLU IRXUĥ\HDU UHFRUGLQJ an element that would eventually get toned
EUHDNEHWZHHQ¶VBrain Salad Surgery and down by the time they came to record 1998
Works Volume I in 1977. ELP were losing their
way and soon arrived at the dismal Love Beach
LQWKH\UHIRUPHGLQEXWWKHVWXGLR
FRPPHUFLDO EUHDNWKURXJK Powertrip EXW WKH
VRQJVKHDUGRQ¶VGHEXWIXOOĥOHQJWKSpine
Of God DQG LWV IROORZĥXS 7DE (3 DUH
STONE TEMPLE PILOTS
Core
albums Black Moon and In The Hot Seat are avĥ SXUSRVHĥEXLOW WR SDUDFKXWH \RX IDU LQWR WKH RHINO
HUDJHDQGOLYHVHWVIURP¶DQG¶¿QGWKHP FRVPRV1HYHUĥHQGLQJEOXHVMDPVEDWWOHDOLHQ
OHVVÀDPER\DQWMIKE BARNES VSDFHIUHTXHQFLHVDQGLQWHUSODQHWDU\ZDUEOHV ++++
WKURXJKRXW ZKLOH WUDFNV OLNH 7KH 'RRUVĥ
Celebrating the 25th
B E ST TRACKS: The Barbarian, Tarkus, Fanfare HVTXH=RGLDF/XQJVHHPOLNHWKH\FRXOGKDYH
anniversary of the
For The Common Man RQO\EHHQFRQFHLYHGVWDULQJLQWRD¿UHRQYHU\
Californian’s grunge
strong acid. Though only singer/guitarist
masterpiece.
'DYH:\QGRUI UHPDLQV RI WKLV HDUO\ OLQHĥXS
,W¶VQRWEHHQDJRRGFRXSOHRI

SAXON
LW¶VKDUGQRWWRORRNEDFNDQGWKLQNWKH\ZHUH
WUXO\RQWRVRPHWKLQJVSHFLDO \HDUV IRU 6WRQH7HPSOH 3LORWV Ħ WKH\¶YH ORVW
AMIT SHARMA the only two singers they’ve ever had in
Solid Book Of Rock WUDJLF FLUFXPVWDQFHV 2ULJLQDO IURQWPDQ
DEMON MUSIC GROUP
B E ST TRACKS: Zodiac Lung, Pill Shovel,
6FRWW :HLODQG ZKR PDQ\ KRSHG ZRXOG

+++ Longhair, Black Mastermind UHWXUQ WR WKH DOWURFN KHURHV RYHUGRVHG RQ
his tour bus in 2015; and more recently
Stalwarts’ ‘difficult’ &KHVWHU%HQQLQJWRQWRRNKLVRZQOLIHDJHG
7KH/LQNLQ3DUNVLQJHUKDGEHHQIURQWLQJ

MOTÖRHEAD
years in a big box.
After the gold rush of the early WKH 6DQ 'LHJR TXDUWHW VLQFH :HLODQG¶V
¶V6D[RQ¶VIRUWXQHVSOXPPHWĥ GLVPLVVDO LQ  DQG WKRXJK KH¶G DPLFDEO\
HG7KH¶VHVSHFLDOO\ZHUHDQ Under Cover OHIW WR IRFXV RQ KLV GD\ MRE QHZV RI KLV
XQIRUJLYLQJWLPHIRUIURQWPDQ%Lɱ%\IRUGDQG MOTÖRHEAD MUSIC suicide left the members mourning “a beacon
crew. Solid Book Of Rock corrals the nine
DOEXPV WKH\ PDGH EHWZHHQ  DQG 
+++ RIOLJKWDQGKRSH´7KH\ZRXOGVD\WKHLUODVW
JRRGE\HV LQ VRQJ DW KLV IXQHUDO 5HZLQG WR
SOXV UHĥUHFRUGHG KLWV DQG ERQXV '9'V DQG Lemmy’s heroes plunder their 1992 debut and this was a band at the
UHGH¿QHV WKH H[SUHVVLRQ μIRU GLHĥKDUGV RQO\¶ the Sex Pistols, Rolling WRSRIWKHZRUOGFRQTXHULQJWKHFKDUWVDQG
)RU DQ\RQH HOVH LW¶V UHOHQWOHVVO\ KDUG ZRUN Stones, Metallica and DLUZDYHVZLWKVH[XDOO\FKDUJHGDQJVWĥULGGHQ
But there’s still something admirable about an Bowie song books. KDUGURFNDQWKHPV,Q:HLODQGWKH\KDGWKH
ROGĥVFKRRO PHDWĥDQGĥWZR YHJ PHWDO EDQG Lemmy’s tireless belief that XOWLPDWH IURQWPDQ Ħ D ZLOGO\ XQSUHGLFWDEOH
stoically singing about Attila The Hun while 0RW|UKHDG ZHUH QHYHU D PHWDO EDQG ZDV VQDNHĥKLSSHG FKDUDFWHU FXUVHG E\ GHPRQV
HYHU\RQH HOVH MXPSHG RQ WKH DOWURFN EDQGĥ always undermined by their gothic horror \HW EOHVVHG ZLWK DQ XQPLVWDNDEOH YRLFH WR
ZDJRQ3OXV6D[RQDOZD\VNQHZDJRRGWXQH LPDJHU\ DQG UXVW\ EXOOHWĥEHOWV %XW KH GLG H[SHO WKHP 7KLV WK DQQLYHUVDU\ HGLWLRQ
Ħ ¶V 6ROLG %DOO 2I 5RFN LV NQXFNOHĥVXFNĥ KDYHDSRLQW$WLWVEHVW0RW|UKHDG¶VPXVLF featuring an additional 36 live cuts and
LQJO\ QDɱ EXW DOVR TXLWH EULOOLDQW:DWFK RXW VZXQJ DOEHLW OLNH D ZUHFNLQJ EDOO FUDVKLQJ demos alongside remasters of the original 12
WRR IRU WKH ERQXV '9' IHDWXULQJ %\IRUG¶V LQWRDQLQGXVWULDOFKLPQH\UDWKHUWKDQ*OHQQ WUDFNV XQFRYHUV WKH UDZ EULOOLDQFH EHKLQG
FDPHRDV.LQJ$UWKXULQWKH6SDQLVKDUWKRXVH 0LOOHU EORZLQJ KLV KRUQ LQ D ZDUWLPH MD]] what is undoubtedly one of the greatest
PRYLH 3HUFHYDO <HV WKDW UHDOO\ KDSSHQHG FOXE 7KH 5DLQERZ DQG -XGDV 3ULHVW FRYHUV grunge albums ever made.
MARK BLAKE KHUH DUH XQGHQLDEO\ JRRG EXW LW¶V WKHLU AMIT SHARMA
YHUVLRQVRI7KH5ROOLQJ6WRQHV¶-XPSLQ¶-DFN
B E ST TRACKS: Solid Ball Of Rock, Stand Up )ODVKWKH6H[3LVWROV¶*RG6DYH7KH4XHHQ B E ST TRACKS: Sex Type Thing, Piece Of Pie,
And Be Counted, Never Surrender DQG D SUHYLRXVO\ XQUHOHDVHG WDNH RQ %RZLH¶V Dead & Bloated, Creep

110 P L A N E T R O C K
Academy Events present

CELEBRATING 25 YEARS OF GROOVUS MAXIMUS! NOVEMBER ACADEMY EVENTS by arrangement with IAA and ITB present
26 SHEFFIELD
LOCAL AUTHORITY E XC L U S I V E LO N D O N CO - H E A D L I N E S H OW
27 NEWCASTLE
THE CLUNY
28 GLASGOW
O2 ABC2
29 WOLVERHAMPTON
SLADE ROOMS
30 CHESTER
LIVE ROOMS
DECEMBER
02 PORTHCAWL
PLANET
PLUS ROCKSTOCK PLUS SPECIAL GUESTS
SPECIAL
GUESTS
03 NOTTINGHAM
RESCUE ROOMS
SUNDAY 11th MARCH 2018
O2 SHEPHERDS BUSH EMPIRE · LONDON
PRESENTED BY ACADEMY EVENTS, 04 LONDON
PLANET ROCK AND FRIENDS BY ARRANGEMENT
WITH THE FRESH START AGENCY THE UNDERWORLD

ACADEMY EVENTS by arrangement with X-RAY and FRESH START AGENCY presents
THURSDAY
9th NOVEMBER
WOLVERHAMPTON
THE SLADE
ROOMS
FRIDAY
10th NOVEMBER
SHEFFIELD
LOCAL
AUTHORITY
SUNDAY
12th NOVEMBER
PLUS
SPECIAL GUESTS
LONDON
O2 ACADEMY
ISLINGTON

TUESDAY
14TH
NOVEMBER

O2 ACADEMY
BRIXTON
LONDON
WEDNESDAY O2 ACADEMY2
AN ACADEMY EVENTS
& TIDAL CONCERTS PRESENTATION
6th DECEMBER ISLINGTON
BY ARRANGEMENT WITH LONDON
FACTORY MUSIC MANAGEMENT PLUS SPECIAL GUESTS
AND AGENCY LTD. A n A C A D E M Y E V E N T S P r e s e n t a t i o n b y a r r a n g e m e n t w i t h PA R A M O U R G R O U P

T U E S D AY
12 DECEMBER
LONDON
O2 ACADEMY PLUS SPECIAL GUESTS
ISLINGTON
S U N D AY
17 DECEMBER WINTER GATHERING
SHEFFIELD
O2 ACADEMY2 THURSDAY
WORLD TOUR 2017 T U E S D AY 14th DECEMBER 2017
19 DECEMBER
NEWCASTLE O2 FORUM
O2 ACADEMY2
KENTISH TOWN
ULIJONROTH.COM
LONDON
A N A C A D E MY E V ENTS PR ES ENTATI O N
NEWMODELARMY.ORG
A N A C A D E M Y E V E N T S P R E S E N TAT I O N

TICKETMASTER.CO.UK & ALL USUAL AGENTS


Jonesing for success:
Mick (second left)
strikes a characteristic
pensive pose.


He never shakes
0LFN -RQHV¶ VWRU\ Ħ UDWKHU WKDQ SLFWXUHV RI KLP ORRNLQJ SRHWLF DQG
KDXQWHGĦDQGWKHUH¶VPRUHRIWKDWVWRU\WKDQLVFRPPRQO\NQRZQ
0LFNXVHVXSSDJHVEHIRUHKHJHWVWR)RUHLJQHUH[SODLQLQJKRZ
this Woking schoolboy hustled his way into the burgeoning pop

off that feeling EXVLQHVV DQG HQGHG XS LQ )UDQFH EDFNLQJ -RKQQ\ +DOO\GD\ DND WKH


μ)UHQFK(OYLV¶-RQHVSRUWUD\VKLPVHOIDVDUHVWOHVVHYHQWURXEOHGVRXO
ZKRKDVWRZDLWXQWLOWKHPLGĥ¶VIRUKLVWLPHWRFRPH,WDUULYHVDIWHU
KHIRUPV)RUHLJQHULQDQGWKHLU¿UVWDOEXPVHOOVDPLOOLRQLQDIHZ

of foreboding... ZHHNV%XWVXFFHVVVRRQKDVLWVGUDZEDFNV³$OOWKHDFFODLPZHQWWRRXU
KHDGV´-RQHVZULWHV³7KHUHZDVDORWRIURFNVWDUPDGQHVV´
:KLOHWKHUH¶VSOHQW\RIWULYLDIRUWKHGLHKDUGVĦ
KRZ -RQHV DOPRVW FDOOHG WKH EDQG7ULJJHU KRZ KLV
DPS FDXJKW ¿UH ZKLOH WKH\ ZHUH MDPPLQJ +RW
G e n t l e m a n B r i t - ro c ke r ’s l i f e a n d BY MAR K B LAK E %ORRGHG Ħ KH QHYHU TXLWH VKDNHV Rɱ WKDW VHQVH RI

A FOREIGNER’S TALE
t i m e s i n a h a n d s o m e h a rd b a c k . XQHDVH LW¶V WKHUH HYHQ ZKHQ ¶V Foreigner 4 hits
PXOWLĥSODWLQXPVWDWXVDQGZKHQKH¶VSURGXFLQJ9DQ
NO ONE, not even the staunchest Foreigner +DOHQ¶VEHVWĥVHOOLQJ5150-RQHVMXVWFDQ¶WKHOSLW
devotee, needs 200 pages of photographs of a band 1DWXUDOO\LWDOOJRHVEHOO\ĥXSIRUUHDOLQWKHHDUO\
Mick Jones
whose image never graduated beyond fur coats and ¶V 1LUYDQD DUULYH DQG 0LFN KDV DQ H[LVWHQWLDO
Rocket 88
VLON VFDUYHV LQ WKH V DQG7XEEV¶Q¶&URFNHWWĥVW\OH FULVLV RQ D SULYDWH MHW RYHU *HUPDQ\ DQG UHDOLVHV
VXLWV DQG FDSĥVOHHYH 7ĥVKLUWV LQ WKH ¶V (YHQ WKH
FXUUHQWOLQHĥXSRIZKLFKJXLWDULVW0LFN-RQHVLVWKH
+++ )RUHLJQHU LV ¿QLVKHG Ħ DW OHDVW IRU WKH WLPH EHLQJ
Depression, divorce and an aortic bypass follow,
sole original member, is purely about the songs, those before he rebuilds the band and puts them back on
WHDUĥMHUNLQJSRZHUEDOODGVDQGGULYHĥWLPHURFNHUV WKHURDGLQWKHV
In some music biz circles, Foreigner’s mainman is )RUHLJQHU DUH FXUUHQWO\ RQ D WK DQQLYHUVDU\ WRXU
UHIHUUHG WR DV μWKH UHDO 0LFN -RQHV¶ WR GLVWLQJXLVK KLP ,W¶V DOO 0LFN -RQHV NQRZV KRZ WR GR Ħ RU wants WR GR
IURP KLV QDPHVDNH H[ RI 7KH &ODVK 7KH WURXEOH LV ³,FHUWDLQO\GRQ¶WZDQWWRHQGXSSOD\LQJJROILQ0LDPL´KH
)RUHLJQHU¶V0LFN-RQHVQHYHUORRNHGDVPXFKOLNHDURFN LQVLVWV¿QDOO\³,PHDQWRNHHSRQNHHSLQJRQ´%XWDWWLPHV
VWDUDVWKHRQHLQ7KH&ODVK$QGWKLVSUHVHQWVSXEOLVKHUV GXULQJ $ )RUHLJQHU¶V 7DOH \RX GR ZLVK KH FRXOG KDYH
5RFNHWZLWKDSUREOHP HQMR\HGWKHMRXUQH\DELWPRUH
7KHFRPSDQ\¶VSDVWZRUNVLQFOXGHFRɱHHĥWDEOHERRNV
on Nick Drake and Syd Barrett, two late musicians with B E ST B IT: When Jones and Foreigner bassist Rick Wills have
GETTY

GH¿QDEOH LPDJHV DQG P\WKLFDO OHJDFLHV ,Q FRQWUDVW DEXVWĦXSRYHUDJDPHRIFKHVVDPHWDSKRULWVHHPVIRUWKH


$ )RUHLJQHU¶V 7DOH¶V VWUHQJWK OLHV ODUJHO\ LQ ĥ\HDUĥROG JURXS·VG\VIXQFWLRQDOUHODWLRQVKLS

112 P L A N E T R O C K
Books & DVDs

LUCKY MAN: 0HWDOOLFD¶V LQWURGXFWLRQ WR WKH ZRUOG %XW


ZKLOHWKLVPD\EHWKHVWRU\IRUZKLFK6ODJHO Magic Ritual: Jane’s

THE AUTOBIOGRAPHY DQG KLV LQÀXHQWLDO UHFRUG ODEHO DUH EHVW


NQRZQWKH/$ĥEDVHGLPSULQWKDVSURYLGHGD
KRPHIRUPDQ\DKDUGFRUHPHWDODFWZKR¶YH
Addiction at the peak
of their powers.

Greg Lake
CONSTABLE BOOKS GUDJJHGWKHJHQUH¶VFHQWUHRIJUDYLW\LQWKHLU

++++
GLUHFWLRQ7KHEHVWH[DPSOHRIWKLVLV6OD\HU
DUFKLWHFWVRIDJHQUHWKDWZDVQRW\HWFDOOHG
Completed prior to the WKUDVKPHWDO6ODJHORɱHUHGWKH/$TXDUWHWDQ
ELP man’s passing to DOEXP GHDO DIWHU KHDULQJ RQO\ RQH VRQJ
cancer last December. $JJUHVVLYH 3HUIHFWRU GHVSLWH WKH IDFW KH
)URP (/3¶V VHFRQGĥHYHU JLJ ODFNHG WKH PHDQV WR IXOO\ ¿QDQFH VXFK D
SOD\LQJ WR  SHRSOH DW YHQWXUH)RUDQ\RQHLQWHUHVWHGLQDQRɱVSULQJ
WKH ,VOH 2I:LJKW )HVWLYDO LQ RI PHWDO RIW GHULGHG DQG HYHQ IHDUHG E\ WKH
 WR WKH EDQG ORVLQJ ORQJĥKDLUHGPDLQVWUHDPWKLVHQWHUWDLQLQJDQG
IJDZHHNRQRQH86RUFKHVWUDOWRXU SDVVLRQDWHDFFRXQWLVDJRRGVWDUWLQJSRLQW
/XFN\0DQLVIXOORIDVWRQLVKLQJVWDWV/DNH¶V IAN WINWOOD
IDVWĥPRYLQJ DQG XQXVXDOO\ JHQWOH PHPRLU
FKLSVDZD\DWFRPPRQO\KHOGQRWLRQVRI(/3

GUNS N’ROSES:
EHLQJHOLWLVWDQGSUHWHQWLRXVDQGLWFHUWDLQO\
SURYHVKHFRXOGODXJKDWKLPVHOI³:HORRNHG

THE LIFE AND TIMES OF


OLNH7KH%HH*HHVRQKROLGD\´KHUHPDUNVRI
WKH GHFLGHGO\ XQĥSURJ FRYHU RI ODWHĥSHULRG

A ROCK’N’ROLL BAND
WXUNH\Love Beach+LVPXVLQJVXSRQWKHURRW
FDXVH RI EDQGPDWH .HLWK (PHUVRQ¶V VXLFLGH
DUHKXJHO\PRYLQJDQGWKHUHDUHSOHQW\PRUH
UHYHODWLRQVDORQJWKHZD\:KRNQHZWKDWWKH
Paul Elliott
PALAZZO

JANE’S ADDICTION
ĥSLHFH RUFKHVWUD RQ /DNH¶V VROR VPDVK ,
%HOLHYH,Q)DWKHU&KULVWPDVZDVHQWHUWDLQHG ++++
SUHĥUHFRUGLQJ E\ D SURIHVVLRQDO EXUOHVTXH
GDQFHURUWKDWKHZDVDVHFUHWIDQRIWKH6H[ Lavishly illustrated
biog of former ‘Most $OLYH$W7ZHQW\Ħ)LYH
3LVWROV¶Never Mind The Bollocks…? MVD
JAMES MCNAIR Dangerous Band In
The World’.
*LYHQ WKDW WKUHHĥ¿IWKV RI
++++
*XQV1¶5RVHV¶FODVVLFOLQHĥ

FOR THE SAKE OF HEAVINESS:


LA legends revisit a masterpiece
XS KDYH SHQQHG WKHLU RZQ
on Blu-ray/DVD/CD set.
DXWRELRJUDSKLHV LQ UHFHQW \HDUV RQH PLJKW

THE HISTORY OF TXHVWLRQ WKH QHHG IRU \HW DQRWKHU ERRN RQ
WKH /$ EDQG %XW 3ODQHW 5RFN FRQWULEXWRU
FOR FANS this is
almost as good as

METAL BLADE RECORDS 3DXO(OOLRWWZDVRQHRIWKH¿UVWMRXUQDOLVWVWR


LQWHUYLHZ WKH TXLQWHW RQ DVVLJQPHQW IURP
it gets: Ritual De
Lo Habitual, the
rockers’ magnum
Brian Slagel With Mark Eglington 6RXQGVLQ0DUFKDQGFUXFLDOO\UHWDLQHG opus, performed
BMG WKHUHVSHFWDQGWUXVWRI,]]\6ODVK'XɱDQG with other favourites

+++ 6WHYHQ μ3RSFRUQ¶$GOHU DV WKHLU μODVW JDQJ LQ at California’s Irvine
Meadows Ampitheatre, the birthplace of
WKHJXWWHU¶GUHDPVZHUHFUXVKHGEHQHDWKWKH Lollapalooza. Filmed during 2015-’16’s
A life on the frontline of ZHLJKW RI $[O 5RVH¶V PHJDORPDQLD 7KLV Silver Spoon Anniversary Tour –
metal’s cutting edge VKDUSO\ ZULWWHQ ERRN LV EHVW ZKHQ (OOLRWW commemorating the 25th anniversary of
recounted in all its GHDOV ZLWK *15¶V YHUWLJLQRXV ULVH Ħ KH both the album and alt-rock festival – it’s
a sumptuous presentation.
testosterone- ¿UVW KHDUV URXJK PL[HV RI Appetite For
While the 4K resolution captures the
fuelled glory. Destruction RQ'Xɱ0F.DJDQ¶VJKHWWR sheen of Perry’s pimp-cum-gondolier
,QWKHVXPPHURID EODVWHU DW WKH EDQG¶V LQIDPRXV +HOOĥ tailoring and guitarist Dave Navarro’s
\RXQJ KXVWOHU FDOOHG KRXVH UHVLGHQFH LQ /$ WKHQ VHHV inky guyliner, the songs are rendered just
/DUV8OULFKPHWXSZLWK%ULDQ6ODJHODW WKHPPREEHGE\IDQVLQ'DOODVWKUHH as flawlessly. Three Days remains the
centrepiece, with Foo Fighters drummer
%LMRX UHFRUGLQJ VWXGLRV LQ +ROO\ZRRG ZHHNV EHIRUH WKH
Taylor Hawkins making a percussive
8OULFKKDGEHHQSURPLVHGDVORWRQ DOEXP WRSV WKH %LOOERDUG cameo. For sheer spectacle, however, the
6ODJHO¶V 0HWDO %ODGH 5HFRUGV  7XUEXOHQW KLVWRU\ LV sight of ladies hanging from hooks during
FRPSLODWLRQ DOEXP Metal EURXJKW XS WR GDWH ZLWK Ted, Just Admit It is hard to shake. As is
UHÀHFWLRQV RQ WKH 1RW the sense that the absence of original
Massacre 1 DOO WKH GUXPPHU
bassist Eric Avery, whose iconic playing
QHHGHGWRGRZDVIRUPDEDQG ,Q 7KLV /LIHWLPH WRXU helped define these songs, means this
DQGUHFRUGDVRQJ7KDWGRQH $Q LQVLJKWIXO isn’t quite as classic as it could be. It’s a
KH SURɱHUHG WKH WDSH RI +LW From the FDXWLRQDU\WDOH minor quibble, though.
gutter to
7KH /LJKWV ZKLFK EHFDPH PAUL BRANNIGAN JAMES HICKIE
the stars:
Axl Rose.
P L A N E T R O C K 113
Unsung Dramatic meeting: ‘The
Yuggles’ (from left) Alan
White, Geoff Downes,
Chris Squire, Trevor
Horn, Steve Howe.

Strange
Bedfellows
Showing some love to those underrated albums.
This issue: when the masters of prog rock met
The Buggles. By Mark Blake.

YES
Drama ATLANTIC, 1980

I T WA S April 1980 when BBC Friday Rock Show presenter Tommy


Vance announced that The Buggles had joined Yes. Even a pro like
Tommy couldn’t hide his shock. “It’s true!” he declared, like a doomsĥ
day preacher predicting the end of civilisation.
As quaint as it seems now, tribalism was rife among music fans at
the time. Heavy progressive groups like Yes didn’t recruit members of
HOHFWURĥSRSGXRVOLNH7KH%XJJOHV([FHSWWKH\KDG
Hand on heart: if you still liked Yes in 1980 you felt a bit like the
Hunchback of Notre Dame in a Close To The Edge 7ĥVKLUW EHLQJ
drummed out of town by angry Jam fans. There wasn’t much to like
either. Most of Yes’s last album, ’78’s Tormato, was as rotten as its titular arenas. But Chris Squire was apparently impressed by his daughter’s
IUXLWYHJHWDEOH DIWHU VL[ PRQWKV LQ WKH EDFN RI WKH IULGJH :KDW copy of The Police’s Reggatta De Blanc/3ĪWKHRQHZLWK:DONLQJ2Q
a shock, then, when ‘The Yuggles’ came up with Drama, the best Yes 7KH0RRQDQG0HVVDJH,Q$%RWWOHī<RXFDQKHDULWVLQÀXHQFHRQWKH
album in ages. jittery Run Through The Light, where Trevor Horn channels Jon
In April 1980, Yes were making a new record in time for an autumn Anderson and6WLQJĦQRWDVULGLFXORXVDVLWVRXQGV
86WRXU7KHQYRFDOLVW-RQ$QGHUVRQDQGNH\ERDUGSOD\HU5LFN:DNHĥ Unlike other Yes albums, Drama didn’t hang around and stopped
man left in the middle of the sessions. Yes’s wily manager Brian Lane after 35 minutes. Truth is, they’d run out of songs and had to get it out
suggested his fellow clients, The Buggles, step in. The in time for the tour. Aware perhaps of critics and Friday
deal was done before either party had the opportunity to Rock Show listeners sharpening their knives, the group
change their minds. hired their former sleeve artist Roger Dean to create a
The Buggles had enjoyed a big hit with Video Killed FRYHUWKDWPDGHLWORRNOLNHDμSURSHU¶ĪLHROGī<HVDOEXP
The Radio Star in September 1979. But keyboard player I once interviewed Chris Squire. Fresh from a long
*HRɱ'RZQHVDQGYRFDOLVW7UHYRU+RUQZHUHVWLOODORQJ DQGSRVVLEO\OLTXLGOXQFKKHZDV¿QHEXWGLVWDQWĦXQWLO
ZD\ IURP EHLQJ SRS UR\DOW\ ,Q FRQWUDVW <HV ĪEDVVLVW we got to Drama. He loved the album, and wouldn’t shut
Chris Squire, guitarist Steve Howe and drummer Alan up about it. However, by Yes standards, it didn’t sell, and
:KLWHīZHUHWLWOHGURFNDULVWRV7KLQNPDQVLRQVLQUXUDO The Yuggles wouldn’t last.
Surrey, bottles of vintage claret in the cellar… Musically, 7UHYRU+RUQZDVXQFRPIRUWDEOHRQĥVWDJHDQGKDQGĥ
however, they were spent. Yes needed some young blood; HGLQKLVQRWLFH+HZHQWRQWRRYHUVHH$%&¶VVXDYHĥSRS
HYHQLIGHVSLWHWKHLUVNLQQ\ĥWLHGQHZZDYHLPDJH7KH album The Lexicon Of Love EHIRUH UHWXUQLQJ WR FRĥ
TRACKS
Buggles weren’t much younger. SURGXFH<HV¶VPXOWLĥSODWLQXPRXWLQJ90125. A year later,
Machine Messiah,
White Car, Does It Really Horn would become the studio brains behind Frankie Goes
D R A M A WA S FUHDWHGLQDWKUHHĥPRQWKEOXULQVWXGLRV Happen?, Into The Lens, To Hollywood.
DURXQG /RQGRQ LQ VSULQJ  :LWK 86 GDWHV SHQGLQJ Run Through The Light, After Chris Squire’s death in 2015, the remains of Yes,
Tempus Fugit
WKHUH ZDV QR WLPH WR ZDVWH Ħ DQG LW VRXQGV OLNH DQ DOEXP LQFOXGLQJ*HRɱ'RZQHVSOD\HGDrama in full on tour. Horn
made by a group with a gun to their heads. PERSONNEL joined them for Tempus Fugit at the Royal Albert Hall date.
The whole thing vibrates with chemically enhanced Geoff Downes The song belted along for a couple of minutes before the
energy and nervous tension. The opener Machine Messiah’s (keyboards), Trevor Horn vocals were due to come in, leaving Trevor standing around
(vocals), Steve Howe
PLJKW\ULɱVXJJHVWVDZDWHU\SUHKLVWRULFEHDVWULVLQJIURP (guitars), Chris Squire with a bemused grin on his face, looking like a man who
WKHGHHSDQGOXPEHULQJRQWRGU\ODQG7KHJUDYLW\ĥGHI\LQJ (bass), Alan White ZLVKHG KH ZDV EDFN LQ WKH VWXGLR UDWKHU WKDQ RQĥVWDJH ,W
runs and tremorous basslines on Does It Really Happen? (drums) was a reminder that he was a better producer than a
and Tempus Fugit do suggest the old Yes, but after a shot of PRODUCER frontman, but also that The Buggles had once given Yes
GETTY

%RWR[DQGDIDFHSHHO Eddie Offord D OLIHĥVDYLQJ VKRW LQ WKH DUP :KR NQRZV" 0D\EH HYHQ
Punk passed Yes by; they were too busy selling out Tommy Vance would have agreed.

114 P L A N E T R O C K
T h e B u y e r s’ G u i d e

Scorpions in 1984:
(from left) Francis
Buchholz, Rudolf
Schenker, Matthias
Jabs, Klaus Meine.

THE ONE WITH THE WHISTLING SONG. THE CLASSIC LIVE ALBUM.
SCORPIONS

THE LP WITHTHAT COVER. BUT WHICH ONE IS BEST?


Paul Elliott turns ze spotlight on the German hard rock maestros’ five-decades-deep discography.

I N 1 9 6 5 , a young German rock group led by +HQGUL[ĥREVHVVHG 8OL -RQ 5RWK ZKR VHUYHG XQWLO
ĥ\HDUĥROGUK\WKPJXLWDULVW5XGROI6FKHQNHUSOD\HG  %XW DIWHU 0LFKDHO PDGH D ÀHHWLQJ UHWXUQ
LWV¿UVWSDLGJLJ6FRUSLRQVKDYHVLQFHVROGPLOĥ GXULQJ WKH PDNLQJ RI WKH  DOEXP Lovedrive Ħ
OLRQ UHFRUGV LQ WHUPV RI SXUHO\ *HUPDQLF ULYDOULHV EHIRUH TXLWWLQJ DJDLQ WR ODXQFK 7KH 0LFKDHO
WKDWPHDQVWKH\¶YHWURXQFHG.UDWIWZHUNLIQRWWKH 6FKHQNHU *URXS Ħ WKH JLJ ZHQW WR 0DWWKLDV -DEV
LQLPLWDEOH %RQH\ 0 $QG QRZ DOO RI  \HDUV RQ ZKRVHVFRUFKLQJVRORVZHUHDSHUIHFWPDWFKIRU5Xĥ
WKH\¶UH VWLOO URFNLQJ WKHP OLNH D KXUULFDQH Ħ WKH GROI ¶VFUXQFK\UK\WKPVDSDUWQHUVKLSXQEURNHQLQ
EDQG¶VIDUHZHOOWRXURULJLQDOO\VFKHGXOHGWRHQGLQ WKHGHFDGHVVLQFH
KDVEHHQH[WHQGHGLQGH¿QLWHO\ ,W ZDV LQ WKH ¶V WKDW 6FRUSLRQV UHDFKHG WKH
7KHU JURXS¶V UHFRUGLQJ FDUHHU EHJDQ EDFN LQ KHLJKWRIWKHLUVXFFHVVLQ$PHULFDDQGWKURXJKRXW
EXWRQO\5XGROIDQGVLQJHU.ODXV0HLQHKDYH WKHUHVWRIWKHZRUOG$QGZKLOHDGHFOLQHIROORZHG
UHPDLQHGFRQVWDQWV7KHOHDGJXLWDULVWRQWKHEDQG¶V Ħ  DOEXP Eye II Eye WKH SRSĥRULHQWHG QDGLU Ħ
GHEXWDOEXPLonesome CrowZDV5XGROI ¶V\RXQJHU WKHLUOLYHSRZHUKDVVXVWDLQHGWKHP
EURWKHU 0LFKDHO ZKR ZDV SURPSWO\ SRDFKHG E\ )RUFODVV\KDUGURFNDQGZKDWZDVRQFHPHPRĥ
GETTY

%ULWLVKURFNJURXS8)27KHUHSODFHPHQWIRUμ0DG¶ UDEO\ GHVFULEHG DV ³7HXWRQLF WRSĥVWULQJ WRUWXULQJ´


0LFKDHO 6FKHQNHU ZDV DQRWKHU HFFHQWULF WKH ORRNQRIXUWKHU«

116 PLANET ROCK


Sting In The Tail In Trance Crazy World Virgin Killer Taken By Force

I0 9 8 7 6
Sony, 2010 RCA, 1975 Vertigo, 1990 RCA, 1976 RCA, 1977

The best of the There were flashes The band’s last album If ever a great album The band’s last studio
band’s late-career of brilliance on the of the ’80s, Savage was undone by its title album with Roth was
albums, Sting In first two Scorpions Amusement, had only and its cover art, it also their first with
The Tail was aptly albums: on Lonesome one great track, was this. The original drummer Herman ‘Ze
named. Its title Crow, the beautiful Rhythm Of Love. For design – since German’ Rarebell,
track is a hum- ballad In Search Of a new decade, replaced by a who would write lyrics
dinger, driven by The Peace Of Mind; Scorpions dumped regulation band shot for a number of key
the kind of propulsive, on 1974’s Fly To The Dieter Dierks to work with – featured a photograph of Scorpions songs. His
choppy riff that has always Rainbow, Uli Jon’s Roth’s American producer Keith a naked prepubescent girl contribution to Taken By
been Rudolf Schenker’s debut, the high-octane Olsen (Fleetwood Mac, beneath a pane of glass Force was a bemused
trademark. Raised On Rock rocker Speedy’s Coming Whitesnake). The result was shattered over her crotch. statement on transsexualism,
has echoes of two Scorpions and the long and trippy title a more rounded collection, In the band’s defence, the He’s A Woman – She’s A
anthems from the ’80s: a track. But it was with third with Tease Me Please Me song Virgin Killer was an Man. But elsewhere on the
riff and lyric evoking Rock album In Trance, the first all swagger, the title track eco-warrior protest against album was a more elevated
You Like A Hurricane, and of many with producer a throwback to the badass Man’s rape of the Earth. But mindset in the artistry of
talk-box guitar recalling Dieter Dierks, that the vibes of the Uli Jon Roth the attendant controversy Roth’s The Sails Of Charon
The Zoo. And in The Good band’s early style was years, and whistle-enhanced has overshadowed this and and the epic We’ll Burn The
Die Young they delivered a defined: the heavy fire in power ballad Wind Of other fine songs here, such Sky. And in the pneumatic
monumental power ballad in Dark Lady and Robot Man, Change a post-Cold War as Pictured Life, Polar Nights drill intro to Steamrock
which Meine sings with ex and a powerful emotive anthem, and the biggest hit and the supercharged Catch Fever was a foreshadowing
Nightwish star Tarja Turunen. quality in the title track. of the band’s career. Your Train. of industrial metal.

Tokyo Tapes Animal Love At First Blackout Lovedrive

5 2 I
RCA, 1978 Magnetism Sting Harvest/EMI, 1982 Harvest/EMI, 1979

4 3
In the ’70s and ’80s, Harvest/EMI, 1980 Harvest/EMI, 1984 During the making Here, as with Blackout,
the live album was a So many legendary Following their big of Blackout, Scorpions adversity brought out
big deal for heavy hard rock and heavy breakthrough in the were in crisis – Klaus the best in the band.
bands whose metal records were US with 1982’s Meine, suffering Lovedrive was created
reputations were released in 1980 Blackout, capped by damaged vocal cords, amid chaos, as Matthias
made on-stage. – Back In Black, an appearance at the feared he might never Jabs and Michael
And there was Ace Of Spades, US Festival in be able to sing again. Schenker swapped
added cachet if this British Steel, et al California before an But an Austrian doctor, places as lead guitarist.
recording was taped in the – that Animal Magnetism audience of 350,000, these whose patients included But from this confusion
exotic Far East, a trend set has been largely written out guys just couldn’t miss with none other than Luciano came the greatest of all
by Deep Purple’s Made In of history. It is, however, an Love At First Sting. It was a Pavarotti, restored Meine’s Scorpions albums – a pivotal
Japan, and followed by indisputable classic in its collection built on anthems: voice to full power. And he work in which a more
Scorpions with Tokyo Tapes. own right, with brilliant Rock You Like A Hurricane, needed all of it on an album modern and accessible
As Uli Jon Roth’s swansong, tracks in Make It Real, the Big City Nights, Bad Boys where the title track and sound was developed in
this double album has delicate ballad Lady Running Wild, Coming Dynamite had a manic the slick groove of Loving
definitive versions of many Starlight and, most famous Home. And it climaxed intensity, and songs such You Sunday Morning and
of the band’s early classics, of all, The Zoo, an homage with the ultimate Scorpions as No One Like You had in two classic ballads,
and a magical atmosphere. to New York City in which power ballad, Still Loving high melodies to stretch Holiday and Always
1985’s self-explanatory a throbbing riff and Jabs’ You. In sync with the rise of even a singer of Meine’s Somewhere. And in the
World Wide Live was a growling talk-box solo hair metal, Love At First lofty calibre. His perfor- titanic Coast To Coast –
bigger seller, but this is captured the pulse and the Sting became the band’s mance was heroic on what an instrumental anthem –
undoubtedly the Scorps’ sleaze of the Big Apple’s biggest-selling album in was the band’s most there was surely a touch
best live document. street life. the States. explosive studio set. of pure genius.

P L A N E T R O C K 117
In sync: Dusty Hill
and Billy Gibbons
making it look
spontaneous.
Live Wire

Jesus Just Left


“Let’s hear it for the drummer,” croaks
Gibbons, as Frank Beard takes a few drags on
a cigarette before striking up the intro to
Gimme All Your Lovin’. ZZ Top have got this
act down so pat they could do it in their sleep,
though the torpid expression on Beard’s face

Maidstone...
VRPHWLPHV VXJJHVWV KH¶V KDOIZD\ WKHUH Ħ QRW
that he ever misses a beat.
Tonight’s show is a canny mix of the songs
WKDWPDGHWKHPVXSHUVWDUVĪEDVLFDOO\DQ\WKLQJ
Rɱ ¶V Eliminatorī D IHZ FRYHUV DQG WKH
honking blues they’ve returned to in their
The Texan trio bring a ray of sunshine to a muddy field in Kent. dotage. ZZ’s last album, 2012’s La Futura,
included I Gotsta Get Paid, their best work
LQGHFDGHV%XWLWVPDFKLQHĥJHQHUDWHGEXPS

ZZ TOP
and grind is tricky to reproduce live, with Hill
rambler is on their feet, head bobbing, working a keyboard and Gibbons doing the
VKXɹLQJIURPVLGHWRVLGH heavy lifting out front alone.
S U N D AY J U LY 3 0 , 2 0 1 7
2QĥVWDJH WKH\¶UH RQ VDIHU JURXQG ZLWK
S O T O ZZ Top, then. The Texan trio’s last songs about cars and women, like I’m Bad I’m
Ramblin’ Man Fair, Mote Park, UK festival date was an underwhelming Nationwide, where Billy celebrates “easin’
Maidstone performance at Glastonbury 2016. That day, down the highway in a new Cadillac” with “a
bassist Dusty Hill had to play keyboards after ¿QHIR[LQIURQW´DQG³WKUHHPRUHLQWKHEDFN´
N OW I N its third year, Ramblin’ Man Fair breaking his shoulder. As Hill also once shot ĦDQGWKHDXGLHQFHWDNHRYHUWKHFKRUXV
faced its biggest challenge yet, with bad himself in the stomach with a Derringer While the other two are regular Joes,
weather on the Saturday and a headliner, VWDVKHGLQKLVFRZER\ERRWWKDWZHQWRɱE\ Gibbons is the source of ZZ Top’s eternal
Extreme, who shouldn’t have been headlining accident, some wondered if he’d make it P\VWLTXH DQ LQVFUXWDEOH ĥ\HDUĥROG ZKR
at all. Thankfully, Mother Nature and the through Ramblin Man’ without requiring a plays sublime guitar, wears what appears to be
patron saint of booking agents took pity, and paramedic. But he does. a bejewelled shower cap under his regular hat
Sunday brings clear skies UFO and ZZ Top to 8.35pm and a robotic voice declaring, “It’s and looks like he’d keel over in the lightest
WKHWRZHULQJ3ODQHW5RFNPDLQĥVWDJH party time…”, announces the main act’s breeze. You wonder, where does Billy Gibĥ
One word sums up Ramblin’ Man: easy. arrival. What ZZ Top bring to any festival bill bons go and what does he do when he’s not
It’s intimate enough to stroll comfortably LV KXPRXU VKRZEL] ÀDLU DQG SOHQW\ RI KLWV being ‘Billy Gibbons of ZZ Top’?
between three stages and a blues/country They roll out Got Me Under Pressure, Waitĥ 7KHUH¶VDPLGĥVHWOXOOZKHUHWKH\LQGXOJH
tent. But if you want a break from all that, ing For The Bus and Jesus Just Left Chicago themselves with covers of Buck Owens’s Act
you can just kick back, sip your beer, chow in quick succession, Hill and guitarist Billy Naturally, among others. It’s time that might
down on an ostrich burger and watch the *LEERQV SHUIRUPLQJ WKRVH VORZĥPRWLRQ have been better spent on Tube Snake Boogie,
world go by. dance steps in unison, while making it look Heard It On The X, or Rough Boy even?
&RPHODWHDIWHUQRRQWKH¿HOGLQIURQWRI spontaneous and unrehearsed. Gibbons plays out of his skin, but by the end
the main stage is a sea of bandannas and black 7KUHH VRQJV GRZQ WKH\ ¿QDOO\ SDXVH WR the queue for the Portaloos are huge.
leather, but also foldaway chairs and picnic ÀDVKWKHLU+ROO\ZRRGWHHWKDQGVWURNHWKHLU 7KDW VDLG ==7RS DUH WRR ZHOOĥWUDYHOOHG
blankets. At times, it looks as if the cast of beards, as the crowd roars its appreciation. to ever lose an audience, and quickly pull it
Sons Of Anarchy have taken back with Cheap Sunglasses
a road trip to the nearest and a thumping Just Got Paid.
garden centre. From here on, it’s the home
As the sun settles over stretch: Sharp Dressed Man,
the yardarm, UFO vocalist /HJV/D*UDQJH7XVK«$¿QDO
Phil Mogg leads his fellow romp through Elvis’s Jailhouse
revellers on to the stage and 5RFN VHDOV WKH GHDO Ħ DQG WKHQ
straight into Lights Out. they’re gone, into the dark
“Is that their old keyboard Maidstone night before the
player?” marvels one audiĥ cheers have subsided.
ence member, squinting at For ZZ Top, another day,
another big bag of dollars. For
ĥ\HDUĥROG 3DXO 5D\PRQG
Ramblin’ Man, a welcome victoĥ
a gentleman who appears to
ry at the end of a long weekend.
have been cryogenically
Stock up on foldaway chairs and
frozen around the time Jim
picnic blankets, it’ll be back
Callaghan was Prime Minisĥ next year. MARK BLAKE
PAUL HARRIES

ter. Yes it is. Wisely, UFO


only play one song from this B E ST MOM E NT: Dusty Hill and
century. And by the time Billy Gibbons’ synchronised
Lights out: the sun
they bow out with Doctor ZREEO\ĦNQHHGGDQFHPRYHLQ6KDUS
goes down on a
Doctor, even the laziest victorious ’Top. Dressed Man. Corny but fun.

P L A N E T R O C K 119
Live Wire

Rising Power
track and Killing Time both suggest fans of
VWUDLJKWĥVKRRWLQJURFNHUVOLNH$HURVPLWKDQG
$&'&ĪZLWKDWZLVWRI6RXQGJDUGHQīVKRXOG
be getting very excited.
Appearing on the same stage some 24
hours later, Blackwater Conspiracy are
similarly transparent about their heroes, with
Meanwhile, further down the Ramblin’ Man bill, the future stars of rock… 5ROO 7KH 'LFH VKRZFDVLQJ 3KLO &RQDODQH¶V
own tribute to Acca Dacca in the form of his
%RQ6FRWWĥHVTXHVQDUO)RUDOOWKHLUVXFFHVVIXO
G\QDPLFPRPHQWVLWSURYHVPRUHGLɷFXOWWR
appreciate the delicate

BEST OF THE
ones, though that’s not
UHDOO\ WKH EDQG¶V IDXOW Ħ
Penny For Your Dirty Mind

OTHER STAGES
is marred somewhat by
a sound clash with the
neighbouring ‘Wall of
Ramblin’ Man Fair Death’ motorbike show.
S AT U R D AY & S U N D AY, Thankfully there are no
J U LY 2 9 & 3 0 , 2 0 1 7 such impediments to
enjoying Tyler Bryant &
W H I L E I T ’ S Z Z To p , The Shakedown. Given
Extreme and other ‘heritage’ that this is the Tennessee
acts who understandably take TXDUWHW¶VIRXUWKDSSHDUDQFH
top billing at Ramblin’ Man, RQ WKHVH VKRUHV LQ 
what of the newer generation PRQWKV Ħ WKLV VKRZ EHLQJ
RI DVSLULQJ DUVHĥNLFNHUV" their sole reason for getting
Thankfully, situated among RQDSODQHĦLW¶VVDIHWRVD\
the real ale tents and other WKHLU ORYH DɱDLU ZLWK WKH
attractions, the smaller stages Bon Scott snarl: UK is genuine. They’re on
Blackwater
RɱHU D ZHDOWK RI UHDVRQV WR Conspiracy.
¿JKWLQJ IRUP WRR WKRXJK
feel reassured that rock’s that’s perhaps unsurprising
future is in safe hands. given that they’ve played
Some bands are more VHYHUDOGDWHVRQ¶VPRVW
naturally vocal about their burgeoning greatĥ in the traditional position, the other turned DQWLFLSDWHG ĪDQG VFUXWLQLVHGī MDXQW *XQV
ness than others. Take Xander And The WR DFW DV D ÀRRU WRP Ħ WKDW DOORZ IRU VRPH N’Roses’ epic Not In This Lifetime tour.
Peace Pirates IRU H[DPSOH ZKRVH VHOIĥ truly cacophonous beats. Meanwhile, Fynn’s ³, GRQ¶W NQRZ LI ,¶G KDYH NQRZQ DERXW
proclaimed ‘New Saviours of Guitar’ mission WDON RI KDYLQJ SOD\HG YHQXHV ³VPDOOHU WKDQ URFN¶Q¶UROOLILWZDVQ¶WIRUWKHEOXHV´ĥ\HDUĥ
statement can’t help but grab attention and WKLV VWDJH´ ZKHUH WKH\ ³DOZD\V JLYH  SHU old Tyler confesses, mindful that despite the
raise expectation. If that claim didn’t build a FHQW´IHHOVOLNHDQRGGO\HDUQHVWLQWURGXFWLRQ ERPEDVWLF ULɱV DQG FRFNVXUH FRXSOHWV Ī³,I
URGIRUWKHLURZQEDFNVWKHQVLQJHUĥJXLWDULVW to a song called Zero Fucks Given. GHVLUHFRXOGNLOO,WZRQ¶WEHORQJ¶WLO,¶PGHDG´ī
Keith Xander’s revelation that they wouldn’t $ODUJHDPRXQWRIHɱRUWKDVFOHDUO\JRQH they are, in fact, playing the Blues Stage. As if
be here if another act hadn’t cancelled probaĥ into what Aaron Buchanan & The Cult proving his credentials, the frontman regales
bly does. Thankfully, the Liverpudlians justify Classics lay on, given that the music is as the packed tent with the tale of a blues
the faith that’s been shown in them. Keith, sharply turned out as Aaron himself, resplenĥ education earned working at a guitar shop in
who has a prosthetic ‘hook’ for a right hand dent in a dandyish silver embroidered blazer Paris, Texas where he was introduced to the
adapted to hold a plectrum, proves a superbly and purple shirt. Despite the esteemed musiĥ music of BB King, Lightning Hopkins and
dexterous player on Dancing In The Light, cal company appearing this weekend, it’s hard Muddy Waters. A version of Got My Mojo
ZLWKDQLFHVWUHDNRIVHOIĥGHSUHFDWLQJKXPRXU to imagine many songs matching All The Working, popularised by the latter, proves
Ī³&ODS\RXUKDQGVLI\RX¶YHJRWWKHP´ī Things You’ve Said And Done for sheer unĥ they’re emulating the masters in muscular
Never mind the Pirates’ name, it’s actually DGXOWHUDWHG UDEEOHĥURXVLQJ 7KRVH ZDWFKLQJ style, and shows why Tyler is a guitarist comĥ
The Picturebooks that appear more likely certainly agree, judging by the number of alĥ fortable sharing stages with a legend like
WRSOXQGHUJROGĦDQGQRWSHDFHIXOO\MXGJLQJ bums snapped up when Aaron appears afterĥ Slash. Easy Target, a monolithic cut from the
by dastardly tunes such as Wardance. The wards to greet fans and sell his band’s wares. band’s new album, due in October, suggests a
*HUPDQ GXR PDGH XS RI EHDUGHG VLQJHUĥ <RXZRQ¶W¿QGPXFKPXVLFE\Wayward future in bigger venues and under their own
PAUL HARRIES

JXLWDULVW )\QQ &ODXV *UDENH DQG VLPLODUO\ Sons out there as they only made their live banner beckons. JAMES HICKIE
hirsute drummer Philipp Mirtschink, unleash debut this summer. The band, led by Toby
a bluesy stomp as raw as sashimi. Jepson of Little Angels and Dio’s Disciples B E ST MOM E NT: Tyler Bryant’s set earning the
It’s bolstered in no small part by Philipp’s fame, release their debut album Ghosts Of Yet KLJKHVWKRQRXUWKHVHIHVWLYDOĦJRHUVFDQEHVWRZħ
NLWZKLFKLVPDGHXSRIWZREDVVGUXPVĦRQH To Come in September. Its impressive title IROGHGFDPSLQJFKDLUVKHOGDORIWLQDSSUHFLDWLRQ

120 P L A N E T R O C K
Fighting form: Tyler
Bryant (front)121
with
Shakedown guitarist
Graham Whitford.
Live Wire

And The Band Played On


Biff Byford’s evergreen British metal legends display their unbending steel on a wet Welsh farm.

SAXON
GLɱHUHQW ĪZLWK 5LYDO 6RQV DQG ,URQ 0DLGHQ 0H)HHO<RXU3RZHU%LɱDQGWKHER\VEHJLQ
bassist Steve Harris’s side band British Lion a marauding rampage through the best of
LQWKHVXSSRUWLQJFDVWWKLVHYHQLQJīWKHUH¶VD their back catalogue, including perennial live
S U N D AY, J U LY 3 0 , 2 0 1 7 welcome familiarity to the occasion. favourites Motorcycle Man, Princess Of The
Steelhouse Festival, Ebbw Vale Saxon’s own journey from NWOBHM Night and Wheels Of Steel.
trailblazers to internationally appreciated
S O M E V E RY British things: tea and godfathers of hard rock/heavy metal has been M A N O F WKH SHRSOH WKDW KH LV %Lɱ ¶V
biscuits. Bangers and mash. Denim and leathĥ an epic adventure, and their presence topping investment in connecting with the Steelhouse
er. All these were present and accounted for tonight’s bill is a testament to a resurgence crowd is made clear early on when he says, “If
high atop a mountain in South Wales as the LQ IRUWXQHV IRU WKH <RUNVKLUH TXLQWHW WKDW you’re gonna get wet, I am gonna get wet with
6WHHOKRXVH )HVWLYDO VHW XS RQ +DIRGĥ<ĥ'DIDO their frontman freely admits, has taken even you!” And he does. While guitarists Paul
Farm for a seventh successive outing. Though him by surprise. Quinn and Doug Scarratt, together with bassĥ
the nearby Ebbw Vale steelĥ LVW1LEEV&DUWHUĦWRQLJKWVSRUWĥ
works now lies silent, the comĥ ing a pirate hat passed up from
munity it nurtured remains Battering rain: Biff WKHFURZGĦWDNHVSRUDGLFWXUQV
tightly knit and durable, as is gives it some welly walking down the stage’s ‘ego
in the downpour. UDPS¶ %Lɱ VSHQGV WKH JUHDWHU
clearly evident in the family
units braving the unholy part of the set out there, getting
trifecta of wind, rain and mud soaked along with his audience.
KHUH RQ WKH ¿QDO ZHHNHQG LQ One highlight of the set comes
July. Everyone at Steelhouse when he’s handed an umbrella,
seems to know everyone else, which rather suits his commandĥ
and those who don’t, soon do. ing presence as he surveys his
“Rain is a big leveller!” damp, but happy minions.
ODXJKV %Lɱ %\IRUG VLWWLQJ Understandably, much of
backstage ahead of Saxon’s %Lɱ ¶V RQĥVWDJH EDQWHU IRFXVHV
scheduled headline slot on the on the deluge pummelling the
weekend’s closing evening. It’s mountaintop. He introduces
 \HDUV VLQFH WKH <RUNVKLUH And The Bands Played On with
band made their debut on the a short preamble, explaining,
festival circuit, their appearĥ “We’re gonna change some of
ance at the inaugural Monsters the lyrics for ya and from now
Of Rock festival at Donington on we’re gonna dedicate this
Park racetrack in the summer song to Steelhouse!”, then
of 1980 helping usher the proceeds to change “We’re sat in
nascent New Wave Of British the sun” to “We’re sat in the
+HDY\ 0HWDO WR FHQWUHĥVWDJH rain”. Well played, sir, well
)URP %Lɱ %\IRUG¶V YDQWDJH played…
point, not a whole lot has $VWKH¿QDOQRWHVRI'HQLP
changed for rock festivals in And Leather ring out across the
the ensuing four decades. Welsh hills, it’s obvious to everyĥ
“The facilities are better, one here that Saxon remain
EXWZKHQLWUDLQVLW¶VQRGLɱHUĥ D IRUFH WR EH UHFNRQHG ZLWK Ħ
ent,” he notes. “Now it’s more of a quality “We sort of got really big again without proud possessors of both a back catalogue to
time for the punters. Back in the day there XV QRWLFLQJ´ ODXJKV %Lɱ ³:H¶UH KHDGOLQLQJ GLHIRUDQGDFUHZRIURDGĥKDUGHQHGPXVLFLDQV
used to be a lot of vans and campers…” IHVWLYDOVDFURVV(XURSHDQGRXUSUR¿OHLVKLJK who have the potential to pull it out of the
DARREN GRIFFITHS

If in 2017 sleepovers in vans and campers in America, so I think it’s a good time now to bag for many years to come. In 2017, they are
have been exchanged for more upmarket be in Saxon.” both a true hard rock institution and a very
accommodation, Steelhouse has retained On the evidence of tonight’s performance, %ULWLVK WKLQJ Ħ MXVW OLNH IHVWLYDOV DQG UDLQ
DSOHDVLQJO\ROGĥVFKRROYLEH-XVWDVZLWKWKH there has rarely been a better time to see DARREN REDICK
RULJLQDO0RQVWHUV2I5RFNVHWĥXSWKHUH¶VRQH 6D[RQ 6WDUWLQJ Rɱ ZLWK %DWWHULQJ 5DP WKH
arena with just one stage; and while, Saxon title track of the band’s most recent studio B E ST MOM E NT: 7KDWPLVFKLHYRXVFURZGĦ
aside, the names on the event posters are DOEXPĦWKHLUVWĦWKHQWKHWUDFN/HW pleasing lyric change in And The Bands Played On.

122 P L A N E T R O C K
Seeing the lights shining:
a triumphant Biff, flanked
by Scarratt (left) and Quinn.
Showtime

TEN GIGS TO SEE


THIS MONTH
FOR MORE
INFO AND
TICKETS GO TO

5
PLANETROCK.COM

3
2 4
Intimate
dates:
Metallica.

1
W.A.S.P.
THE DARKNESS
The Sunset Strip survivors
revisit 1992’s The Crimson
Idol album – an ambitious
Their arena-headlining days rock opera chronicling the

LIVING might be behind them, but


few bands deliver a more
rise and fall of a rock star
named Jonathan – on the

COLOUR entertaining balls-out


rock’n’roll evening than The
Re-Idolized tour. The band
will also screen a 50-minute

PHIL RUDD BAND


Having cancelled Darkness. See Justin film detailing the story, and
two previously Hawkins flashing his toothy chuck in a greatest hits
scheduled UK pinewood smile on this trio set to boot.

METALLICA
It’s been a turbulent couple
tours, New York’s of dates in Ireland. Don’t go for: a naked of years for one of rock’s
Black Rock The best old song you’ll woman on a rack. Those most reliable timekeepers,
Coalition leaders Though the world’s biggest hear: Get Your Hands Off days are over what with losing his drum
are finally metal band are annual My Woman (mother**ker) Do go for: a rare opportunity seat in AC/DC and being
returning to our visitors to the UK, they The best new song you’ll to scream, ‘I f**k like a beast’, accused of attempting to
sceptred isle, with a stunning haven’t actually toured hear: All The Pretty Girls without getting arrested procure a murder, a charge
new album, Shade (reviewed Britain since their World subsequently dropped.
When: October 13-15 When: October 12-27
on page 106) in tow. Expect Magnetic trek in February/ Expect the odd ’DC classic
funk, soul, heavy, heavy blues March 2009. Given that to pop up between songs
and jaw-dropping fretboard the San Francisco quartet from his 2016 solo album
pyrotechnics from the usually play stadiums and Head Job. SCARLET PAGE, PAUL HARRIES, ROSS HALFIN
incomparable Vernon Reid. headline festivals, these
Don’t shout out for: AC/
Planet Rock faves Stone five arena dates represent
DC’s Jailbreak, smartarse
Broken open. relatively ‘intimate’ shows.
Noisy Norwegians Duckwalk across the
Expect to hear: the
Kvelertak support. venue for: the quintet’s
irresistible Cult Of
high voltage take on
Personality James Hetfield will: give
Powerage deep cut
Pretend to know: last repeated lengthy shouts out
Up To My Neck In You
year’s killer reworking of to the Metallica familehhhhh
When: September 14-21,
The Notorious B.I.G.’s Lars Ulrich will: wear short
then October 13-21
Who Shot Ya? shorts he out-grew in
When: September primary school
26-October 7 When: October 22-30

Parallax sound:
Alter Bridge.

124 P L A N E T R O C K
Strewth!:
Airbourne
hit Pompey.

6 7 8 THE KENTUCKY
HEADHUNTERS
Founded in 1968 as Itchy
Brother – surely one of the
worst band names ever – the
veteran Headhunters bring
their Southern rock charms
AIRBOURNE
Ahead of a nine-date UK
tour in November, the
brothers O’Keeffe drop in
for a sweaty hellraising
one-night stand at
Portsmouth Pyramids Centre.
Fists will be pumped, beers
will be hurled, good times
ALTER BRIDGE
Myles Kennedy’s post-
grunge arena-fillers show
their class on this all-too-
brief UK visit, including two
dates at London’s Royal
Albert Hall, where the
quartet will be accompanied
by the 52-piece Parallax
10 ANATHEMA
Scouse prog rock adventurers
Anathema are one of the
UK’s most criminally
underrated bands. Bathe your
ears in the Cavanagh
brothers’ rich, luxuriant
soundscapes as they air
choice cuts from June’s

INGLORIOUS
back to our shores for eight
will be had. Orchestra, conducted by superb The Optimist album.
dates in support of last year’s
Simon Dobson. Look out for: a beautiful
fine On Safari album. Expect: lots and lots of
Producer Kevin Shirley (Iron songs featuring the words Sing yourself hoarse to: take on Portishead’s timeless
Hope to hear: a rollicking
Maiden/Black Country rock’n’roll Blackbird Glory Box
take on the peerless
Communion) has hailed Norman Greenbaum hit Look out for: guitarist Mark Don’t hold your breath for:
Don’t expect: ballads
brawny rock’n’roll Spirit In The Sky Tremonti taking lead vocals anything from the band’s
newcomers Inglorious as When: September 27
on the stirring Waters Rising doomy debut Serenades
“the best British band since Don’t (rebel) yell for:
Freebird When: October 2-8 When: September 22-30
Led Zeppelin”. No pressure
then, lads. This 11-date trek, When: October 3-10
incorporating shows in
Northern Ireland, Wales,
Scotland and the Republic
of Ireland, will give cocksure
frontman Nathan James the
chance to prove there’s
genuine substance behind
the hype.
Most impressive David
Coverdale impression: the
bawdy High Class Woman.
Keep an eye out for:
super-fan Baron Andrew
Lloyd Webber, who has
called James “the best
rock singer I’ve heard
since Ian Gillan”.
When: September
30-October 20

Eternal
optimists:
Anathema.
TO ADVERTISE TEL: Ross Odell on 01733 363201

WWW.HEAVYMETALDATING.COM

GOT ANY
RECORDS?

+Are you thinking of selling your prized record collection?


+I am looking to buy top quality collections of most genres
+Condition is everything
+Cash waiting for the right vinyl’s!
+Give me a call and lets discuss - ask for Garry
+I will come to you by appointment
www.gotanyrecords.com | 01243 870375 / 07966519247

Super Quality Affordable T shirts & Hoodies


A-Z: AC/DC to Rob Zombie

www.rock-shirtz.com
TO ADVERTISE TEL: Ross Odell on 01733 363201
T-SHIRTS
HOODIES
JACKETS
JERSEYS
TANK TOPS
SWEATERS
LONG SLEEVES
SHORTS
BABYWEAR
HATS
BEANIES
JEWELRY
BACKPACKS
BAGS
POSTERS
COLLECTIBLES
TOYS
FLAGS
PATCHES
PINS
BUTTONS
STICKERS
WALLETS
KEY CHAINS
DVDS
VINYL
AND MORE
For more than 30 years, Rockabilia has offered the largest selection of music merchandise available in the world.
For a free catalog, visit rockabilia.com, call 001-952-556-1121 or write: PO Box 39 Dept. PLANET - Chanhassen, MN 55317 USA
TEL: 0333 666 7 999 WWW.SPIRAL.UK

3-D
BAG NEW
NEW
*Bear only

FRANKENTED DEATH RE-RIPPED


TO ADVERTISE TEL: Ross Odell on 01733 363201

£34.99 £44.99

NEW KEEPER OF THE


FORTRESS

SKULLS N ROSES
£18.99
£16.99 TOP SELLER $//29(535,17
(9,(
TRIBAL PANTHER +22'('
JAX SKULL £24.99 287),7
9(67
TEE

NEW NEW

£16.99 £29.99
Crossword

BLACK SABBATH’S
TEN YEAR WAR BOX SET

All eight Ozzy-fronted Sabs vinyl albums,


remastered, in a box with a crucifix USB
stick you can wear. You want it, don’t you?
Then complete this crossword…

ENTRIES IN BY OCTOBER 21, 2017 ACROSS DOWN


1 Ships should steer clear of this Buckethead 1 Iggy Pop once lived in the Zombie variety (9)
How to enter Got a pen? No? Well, go to the
album (7,8) 2 Iron Maiden considered this 2006 album
drawer in the kitchen and get one. Good. Now fill in
the answers to the questions opposite – without 5 Roger Waters solo album (5,1,1,1,1) - ------ -- ---- And Death (1,6,2,4)
using google, sneaky, don’t think we won’t know! 8 Record label and Sex Pistols song (1,1,1) 3 Orlando rock band fronted by Myles Kennedy
Then whack it over by snail mail to Planet Rock 9 Jimi Hendrix’s Peter Gunn disaster (11) (5,6)
Magazine, Sabbath Crossword, Academic House, 4 Audioslave came out of this on their second
24-28 Oval Road, London NW1 7DT 10 First name of frontman who keeps his Balls To
The Wall (3) album (5)
Terms and conditions One entry per person. Entries must 11 Paul Di’Anno sang of Murders In The _ _ _ 6 They brought Lightning To The Nations (7,4)
be received before October 21, 2017 or will not be valid. One Morgue, on Iron Maiden’s Killers album (3) 7 Explosive debut single from Stiff Little Fingers
winner will be selected at random. Competition promoted by 12 Saxon hefted a Battering --- (3) (7,6)
Bauer Consumer Media Limited t/a Planet Rock (“Planet 8 Mercury Rev song, ------ ----- (Son House In
14 Dave Grohl’s Fighters (3)
Rock”). Planet Rock’s choice of winner is final and no Excelsis) (6,5)
correspondence will be entered into in this regard. The winner 15 First name of late Deftones bassist (3)
CROSSWORD SET BY: JASON ARNOPP

9 Pink Floyd declared themselves this degree of


will be notified by email seven days after the competition ends. 16 The Oedipal climax to The Doors self-titled Numb (11)
Entrants must be over 18, resident in the UK and not be debut album (3)
employed by Bauer Media. The prize is non-negotiable with no 13 Notoriously fastidious Def Leppard, AC/DC
17 _ _ _ Bottomed Girls, as celebrated in song by producer (4,5)
cash alternative. Entrants agree to the collection of their
Queen (3)
personal data in accordance with Planet Rock’s privacy policy: 19 (Take Your ----- Out Of The Soup) You’re
http://www.bauerdatapromise.co.uk/. Bauer reserves the right 18 First word of the opening track on Sweet’s Sitting On The Chicken, insisted Ian Dury (5)
to amend or cancel these terms or any aspect of the Sweet Fanny Adams (3)
competition (including the prize) at any time if required for 19 Classic Judas Priest track eternally paired with
reasons beyond its control. Any questions, please email mail@ The Hellion (8,3)
planetrock.com. Complaints will not be considered if made TE L L U S WHAT
20 Motorhead wove --- Magic on their final studio YO U TH I N K O F
more than 30 days after the competition ends. Winner’s details
record (3) P L AN ET R O C K
available on request (after the competition ends) by emailing MAGA Z I N E AN D WI N £500! G O TO
mail@planetrock.com. For full Ts&Cs see bauerlegal.co.uk/ 21 Dio detected ---- On ----- Street (4,5)
P L AN ETR O C K.CO M / S U R VEY
competition-terms. 22 Early Prince gem from Dirty Mind (4,3,4,4)

P L A N E T R O C K 129
WHO THE HELL ARE THESE gUYS?

Where we’re going


we don’t need roads...
Not every rock band dreams of
driving a Rolls-Royce into a
Beverly Hills swimming pool.
Simpler pleasures often suffice.
With the benefit of hindsight,
these lads may have been
tempting fate by posing in a
scrapyard, but back in the early
’80s who honestly knew the
road that lay ahead for them?
Do you know who they are?
PETE CRONIN

Or better still, were you a


member of this plucky,
tastefully permed outfit?
Answers to mail@planetrock.
com; see page 26 for last
issue’s correct answer.

130 P L A N E T R O C K
INSIDE ISSUE THREE OF THE NEW MAGAZINE FROM THE MAKERS OF
MOJO AND PLANET ROCK, BRITAIN’S GREATEST ROCK RADIO STATION

ALBUMS
OVERLOAD
Your guide to all
the music you need
STARRING
BACK TO
SCHOOL’S OUT QUEENS OF THE
STONE AGE
BLACK COUNTRY
“We appealed COMMUNION
to the outsiders. OH SEES

I WAS THEIR LEADER .


FOO FIGHTERS
a n d m o re

They were
our gang…” ZZROCK
TOP
RAMBLIN’

ALICE
MAN FAIR
PLUS!
TYLER
BRYANT
& THE
SHAKEDOWN

COOPER
AND
The rising acts
you need to catch
right now!

SOUNDGARDEN AIRBOURNE ALTER BRIDGE RICK WAKEMAN


BADMOTORFINGER ON THE ROAD. WHAT’S ROCKING IN THE COURT
REVISITED… IN YOUR FACE! MYLES’ WORLD? OF A PROG KING

STONE SOUR Co rey Taylo r Co o ks Up A Storm THE DARKNESS Af ter Da rk…


MICHAEL SCHENKER T he Mad Axe m a n Re t u r n s ! SAXON Stor m Stee lhou se
DIAMOND HEAD The Tr ue Stor y Of Me ta llica ’s He roes. ..