Sie sind auf Seite 1von 597

EDMUND HUSSERL

STUDIEN ZUR
STRUKTUR DES BEWUSSTSEINS

TEILBAND I

VERSTAND UND GEGENSTAND

TEXTE AUS DEM NACHLASS

(1909-1927)

HERAUSGEGEBEN VON

ULLRICH MELLE
UND

THOMAS VONGEHR
STUDIEN ZUR STRUKTUR DES BEWUSSTSEINS
TEILBAND I
VERSTAND UND GEGENSTAND
HUSSERLIANA
EDMUND HUSSERL
GESAMMELTE WERKE

BAND XLIII/1

STUDIEN
ZUR
STRUKTUR DES BEWUSSTSEINS

TEILBAND I
VERSTAND UND GEGENSTAND

Texte aus dem Nachlass


(1909–1927)

AUF GRUND DES NACHLASSES VERÖFFENTLICHT VOM


HUSSERL-ARCHIV (LEUVEN) UNTER LEITUNG VON

ULLRICH MELLE
EDMUND HUSSERL

STUDIEN
ZUR
STRUKTUR DES BEWUSSTSEINS
TEILBAND I
VERSTAND UND GEGENSTAND

Texte aus dem Nachlass


(1909–1927)

HERAUSGEGEBEN
VON

ULLRICH MELLE
UND
THOMAS VONGEHR

123
Edmund Husserl†

Hrsg.
Ullrich Melle Thomas Vongehr
Husserl Archives Husserl Archives
Leuven, Belgien Leuven, Belgien

Husserliana: Edmund Husserl – Gesammelte Werke


ISBN 978-3-030-35787-0 ISBN 978-3-030-35788-7 (eBook)
https://doi.org/10.1007/978-3-030-35788-7

Die Deutsche Nationalbibliothek verzeichnet diese Publikation in der Deutschen National-


bibliografie; detaillierte bibliografische Daten sind im Internet über http://dnb.d-nb.de abrufbar.

Springer
© Springer Nature Switzerland AG 2020
Das Werk einschließlich aller seiner Teile ist urheberrechtlich geschützt. Jede Verwertung, die
nicht ausdrücklich vom Urheberrechtsgesetz zugelassen ist, bedarf der vorherigen Zustimmung
des Verlags. Das gilt insbesondere für Vervielfältigungen, Bearbeitungen, Übersetzungen,
Mikroverfilmungen und die Einspeicherung und Verarbeitung in elektronischen Systemen.
Die Wiedergabe von allgemein beschreibenden Bezeichnungen, Marken, Unternehmensnamen
etc. in diesem Werk bedeutet nicht, dass diese frei durch jedermann benutzt werden dürfen.
Die Berechtigung zur Benutzung unterliegt, auch ohne gesonderten Hinweis hierzu, den
Regeln des Markenrechts. Die Rechte des jeweiligen Zeicheninhabers sind zu beachten.
Der Verlag, die Autoren und die Herausgeber gehen davon aus, dass die Angaben und
Informationen in diesem Werk zum Zeitpunkt der Veröffentlichung vollständig und korrekt
sind. Weder der Verlag, noch die Autoren oder die Herausgeber übernehmen, ausdrücklich
oder implizit, Gewähr für den Inhalt des Werkes, etwaige Fehler oder Äußerungen. Der
Verlag bleibt im Hinblick auf geografische Zuordnungen und Gebietsbezeichnungen in
veröffentlichten Karten und Institutionsadressen neutral.

Springer ist ein Imprint der eingetragenen Gesellschaft Springer Nature Switzerland AG
und ist ein Teil von Springer Nature.
Die Anschrift der Gesellschaft ist: Gewerbestrasse 11, 6330 Cham, Switzerland
INHALT

TEILBAND I

VERSTAND UND GEGENSTAND

EINLEITUNG . . . . . . . . . . . . . . . . . . . . . . . . li

i
zur intentionalität der objektivation im
urteilen, meinen und stellungnehmen

Nr. 1. Allgemeine Unterscheidungen bei allen Akten. Grund-


arten von Akten und Gegenständen . . . . . . . . . . . . 1
§ 1. Die Unterscheidung zwischen Intentionale, Objektionale
und Apparenziale. Der gebende Akt und sein Intentionale
als Erscheinung. Schlichte und höherstufige Akte . . . . . 1
§ 2. Schlichte und fundierte Akte – Gegenstände erster und hö-
herer Stufe . . . . . . . . . . . . . . . . . . . . . . 4
§ 3. Primäre Gegenstände und sekundäre Reflexionsgegen-
stände. Verschiedene Arten der Reflexion: die phanseologi-
sche Reflexion auf Akte und die Reflexion auf Bedeutungen
und Erscheinungen. Das reine Ich als ein reines Reflexions-
objekt . . . . . . . . . . . . . . . . . . . . . . . . 5
§ 4. Immanente und transiente (empirische) Gegenstände. Na-
turobjekte im primären und sekundären Sinn . . . . . . . 11

Nr. 2. Bewusstsein-von und das objektivierende Zum-Gegen-


stand-Machen im Urteilen . . . . . . . . . . . . . . . . . 15
§ 1. Das Erscheinende und sein Charakter. Impressionen als Un-
terlage eines objektivierenden Begreifens und Beurteilens.
Der Unterschied der Urteilsqualitäten . . . . . . . . . . 15
vi inhalt teilband i

§ 2. Objektivierende Setzung als Urteil im weitesten Sinn – Apo-


phansis als Urteil im engsten Sinn. Jedes Erlebnis kann
Grundlage eines apophantischen Urteilens werden . . . . 19

Beilage I. Die Urteilsbedeutung und die Bedeutung der unterliegen-


den Akte. Die Urteilsgeltung übergreift alle anderen Fälle von
Geltung. Die Bestimmung des Bewusstseins durch die Grundarten
der Bedeutungen . . . . . . . . . . . . . . . . . . . . . . 22

Beilage II. Das Urteil als ein Gebilde von eigenen Intentionen. Das
Urteilen ist ein erfülltes, wenn es sich nach einem gebenden Akt
richtet . . . . . . . . . . . . . . . . . . . . . . . . . . . 26

Beilage III. Das Verhältnis des vorprädikativen Vorstellens zum


Denken. Identifikation im eigentlichen Sinn findet nur im Denken
statt . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28

Nr. 3. Eigentliches und uneigentliches Urteilen . . . . . . . . 31


§ 1. Das theoretische Meinen und sein Substrat. Leeres Denken.
Das Herausmeinen aus einem leeren Akt ist Meinen und
keine Vergegenwärtigung . . . . . . . . . . . . . . . 31
§ 2. Das Urteil und seine retentionale Modifikation. Festhaltung
und Nachdauer der Meinung gegenüber Nachklang ohne
Festhaltung. Die wiedervergegenwärtigende Rückkehr zum
Festgehaltenen . . . . . . . . . . . . . . . . . . . . 34
§ 3. Die Regung eines Gedankens. Das nachlebende, abklin-
gende Urteil als Urteilsmodifikation gegenüber dem aktuell
sich vollziehenden Urteil. Das Entnehmen des Intentionalen
aus einem unlebendigen Phänomen in einem Zug . . . . . 36
§ 4. Unlebendiges, passives Urteilen als eine Modifikation des
lebendigen, aktiven Urteilens. Der Vollzug der Urteilssyn-
thesis und ihr Ergebnis . . . . . . . . . . . . . . . . . 38

Nr. 4. Thematisches und unthematisches Bewusstsein. Der Unter-


schied und das Verhältnis zwischen Rezeptivität und
schöpferischer Spontaneität . . . . . . . . . . . . . . . . 42
§ 1. Intentionale Erlebnisse im weiteren und engeren Sinn. Akte
im prägnanten Sinn als Erlebnisse, in denen ein einheitli-
ches Sich-Richten-auf-Gegenständliches statthat. Meinende
Zuwendung und ihre Modi . . . . . . . . . . . . . . . 42
inhalt teilband i vii

§ 2. Das thematische Meinen. Thema und Gegenstand. Themati-


scher Inhalt und Charakter. Thematisch schlichte Objektiva-
tion und sich darauf bauende synthetische Objektivationen 47
§ 3. Das passiv aufnehmende und entnehmende Betrachten und
Explizieren gegenüber dem schöpferischen Konstituieren.
Sinnliche gegenüber kategorialen Gegenständen. Zweierlei
gebendes Bewusstsein: sinnlich gebende und synthetisch ge-
bende Akte . . . . . . . . . . . . . . . . . . . . . . 53
§ 4. Die Schichtung in der Sphäre der Sinnlichkeit: physische
Sinnlichkeit und Gemütssinnlichkeit . . . . . . . . . . . 59
§ 5. Funktionell verflochtene Grundarten des Bewusstseins. Vor-
dergrund- und Hintergrundbewusstsein. Jeder Akt, dem sich
ein Gegenstand entnehmen lässt, bezieht sich auf diesen
Gegenstand. Die zu allen Akten gehörigen modalen Unter-
schiede . . . . . . . . . . . . . . . . . . . . . . . . 62

Beilage IV. Psychische Akte gegenüber psychischen Zuständen.


Meinen und Objektivieren. Der Satz von der Vorstellungsgrund-
lage und die Frage nach einem einheitlichen Vorstellungsbegriff 66

Beilage V. Lebendigkeit und ihre Grade beim Wünschen und beim


Urteilen. Lebendigkeit besagt nicht Evidenz und setzt sie nicht
voraus . . . . . . . . . . . . . . . . . . . . . . . . . . . 68

Beilage VI. Notiz über Stellungnahme und ihr Moment der Aktivität
einerseits und über Momente der Passivität und Aktivität in der
Wahrnehmung andererseits . . . . . . . . . . . . . . . . . 70

Nr. 5. Der thematische Inhalt und seine Charaktere . . . . . . 71


§ 1. Das thematische Bewusstsein mit seinen verschiedenen Qua-
litäten. Der thematische Blick als Bewusstsein vom Thema
und als Bezogensein auf den Gegenstand. Die Objektivie-
rung des Charakters als Prädikat eines thematischen Inhalts 71
§ 2. Das thematische Bewusstsein als unselbständige Schicht.
Stellungnahme und Thema bei den synthetischen Akten und
beim Gemütsbewusstsein . . . . . . . . . . . . . . . . 76
§ 3. Das Thema der Freude. Die Scheidung von Inhalt und Cha-
rakter als eine bloße Abstraktion. Die gedankenhafte Modi-
fikation der positionalen Charaktere. Ein mehrfacher Begriff
des Themas . . . . . . . . . . . . . . . . . . . . . . 80
viii inhalt teilband i

§ 4. Die Möglichkeit der Verwandlung jedes Themas in ein ob-


jektivierendes Thema. Der thematische Inhalt des Wunsches.
Inwieweit Gewissheit und Gewissheitsmodi bei allen Akten
auftreten können. Schwierigkeiten in der doxischen Sphäre 83
§ 5. Inwieweit und in welcher Hinsicht Urteil und Gedanke ein
gemeinsames Wesen haben . . . . . . . . . . . . . . . 87
§ 6. Ist die Vermutung in einem bloßen Gedanken fundiert oder
stehen sich alle Qualitäten und ihre gedankenhaften Modifi-
kationen einander gleich? . . . . . . . . . . . . . . . 90

Beilage VII. Die Beziehungen zwischen thematischem und doxi-


schem Bewusstsein. Prädikation über den Gegenstand und seine
Eigenschaften einerseits und über den Charakter der Wirklichkeit
und des Wertes andererseits. Die Möglichkeit der Objektivation
des Themas . . . . . . . . . . . . . . . . . . . . . . . . 95

Nr. 6. Das Meinen als Bewusstsein von einem Inhalt und von
einer gegenständlichen Einheit . . . . . . . . . . . . . . 98
§ 1. Das Meinen und sein Gemeintes als solches. Ein auf das Ge-
meinte gerichtetes Hinblicken und eine darauf gegründete
Denksetzung. Objektivieren niederer und höherer Stufe . . 98
§ 2. Das spezifische Meinen als Meinen von Einheit. Urteilen
über die gegenständliche Einheit und Urteilen über den
vergegenständlichten Inhalt. Der gemeinte Gegenstand
schlechthin und der gemeinte Gegenstand im Wie . . . . 101

Nr. 7. Cogitatio und ihr Korrelat. Der zur cogitatio gehörende


Ichstrahl. Das Korrelat als Vermeintheit schlechthin. Evi-
denz als höherstufiger Charakter von Korrelaten . . . . . 106

Beilage VIII. Der Blick des reinen Ich auf die Phänomene. Das Über-
gehen des Blickes vom Phänomen zu dem in ihm Erscheinenden 112

ii
zur analyse der explikativen und
prädikativen synthesen und ihrer fundamente

Nr. 8. Die Unterschiede und Verhältnisse zwischen Explikation,


beziehender Synthesis und Prädikation . . . . . . . . . . . 117
inhalt teilband i ix

§ 1. Partialerfassungen auf dem Grund einer Gesamterfassung.


Das Im-Griff-Behalten des thematischen Ganzen. Das Son-
dererfasste kann selbst zum Thema werden . . . . . . . 117
§ 2. Das Fungieren der Partialakte im Prozess der Kenntnis-
nahme. Die Bereicherung der Gesamtobjekterfassung durch
die Einzelerfassungen. Die explikative Synthesis als Grund-
lage der Prädikation . . . . . . . . . . . . . . . . . . 121
§ 3. Der Übergang von der Explikation zur Prädikation. Die
Prädikation als Wiederholung des explikativen Prozesses in
geänderter Einstellung. Die prädikative Synthesis als schöp-
ferische Erzeugung des Sachverhalts. Die Sachverhaltsrefle-
xion . . . . . . . . . . . . . . . . . . . . . . . . . 124
§ 4. Das Verhältnis zwischen prädikativer und beziehender Syn-
these. Das in der Erfassung und in der Explikation waltende
Absehen. Die Analogie mit dem Abzielen und Erzielen im
Willensgebiet . . . . . . . . . . . . . . . . . . . . . 130
§ 5. Schlichter thematischer Akt. Unterschiede thematischer
Richtung schon vor der Explikation: singuläre und plurale
thematische Intentionen . . . . . . . . . . . . . . . . 134
§ 6. Der Unterschied zwischen den Explikationen, deren Expli-
kate selbständige Themata sind, und solchen, deren Expli-
kate nicht als für sich geltende Gegenstände gesetzt sind 138
§ 7. Die Explikation als bestimmendes Übergangsbewusstsein.
In ihr ist der Sachverhalt schon vorhanden, aber noch nicht
synthetisch erfasst. Explikation und beziehende Synthese
stehen nicht auf gleicher Stufe. Der Unterschied zwischen
Explikation von Eigenschaften und der beziehenden Syn-
thesis von Ganzem und Teil . . . . . . . . . . . . . . . 141

Beilage IX. Schlichte explikative Betrachtung gegenüber prädikati-


ver Synthesis. Die Übergangssynthese als Grundlage der Prädika-
tion . . . . . . . . . . . . . . . . . . . . . . . . . . . . 148

Beilage X. Die Übergangssynthesen: Das Subjekt braucht nicht der


Ausgangspunkt zu sein. Die Übergangssynthesen sind noch keine
prädikative Bestimmung . . . . . . . . . . . . . . . . . . 153

Beilage XI. Bloße Übergänge und ihre phänomenologischen Cha-


raktere gegenüber den Übergangssynthesen . . . . . . . . . . 154
x inhalt teilband i

Beilage XII. Die unterschiedliche Weise der Deckung von Eigen-


schaften mit dem Gegenstand und von Teilen mit dem Ganzen.
Der Unterschied zwischen explizierender und beziehender Ein-
stellung . . . . . . . . . . . . . . . . . . . . . . . . . . 155

Beilage XIII. Kenntniserweiternde gegenüber kenntniserläuternder


Explikation (innerer Explikation) . . . . . . . . . . . . . . 156

Beilage XIV. Prädikative und vorprädikative Übergangssynthesen.


Schlicht Abgesehenes und Abgesehenes im Übergang. Die Über-
gangsformen. Die Form des Bestimmbaren überhaupt gegenüber
der Form des Substrats . . . . . . . . . . . . . . . . . . . 157

Beilage XV. Schlichte und beziehende thematische Betrachtung. Wie


das beziehende Betrachten sich zum Bestimmen in der prädikati-
ven Synthesis wandelt . . . . . . . . . . . . . . . . . . . 161

Nr. 9. Analysen zur Explikation . . . . . . . . . . . . . . . . 166


§ 1. Hauptexplikanden und dienende Explikanden. Die mögli-
che Eigengeltung der Explikate. Die Beziehung zwischen
Ganzem und Teil als explikative Synthese von zwei substan-
tivischen Objekten . . . . . . . . . . . . . . . . . . . 166
§ 2. Die Frage nach dem Fundament des Relationsbewusstseins.
Die sinnlichen Einheitsformen sind keine Relationen. Der
Unterschied zwischen Kontrast- und Relationsprädikaten 169

Nr. 10. Die Weisen der Erfassung und ihrer Synthesis . . . . . 175
§ 1. Die Konstitution einer gegenständlichen Einheit vor ihrer
Erfassung. Das Verhältnis zwischen der Gesamterfassung
eines Gegenstandes und der Sondererfassung seiner Teile
und Momente. Die Hinwendung zum Gegenstand mit und
ohne Explikation . . . . . . . . . . . . . . . . . . . 175
§ 2. Thematisches Meinen und Interesse. Das Sich-Näherbringen
einer Gruppe von selbständigen Objekten durch Einzelerfas-
sung ihrer Glieder . . . . . . . . . . . . . . . . . . . 179
§ 3. Verdeutlichungsstellen als Residuen von vorherigen Partial-
erfassungen. Die Frage, ob sich Auffassungsartikulationen
von Residuen unterscheiden lassen . . . . . . . . . . . 184
§ 4. Die Einheit der Zusammennehmung gegenüber der Einheit
des Bewusstseins von kontinuierlicher Totalerfassung und
schrittweisen Partialerfassungen bei der Explikation . . . 188
inhalt teilband i xi

§ 5. Die schöpferische Konstitution des Inbegriffs im Zusammen-


nehmen und seine ihn zum Gegenstand machende Objekti-
vation . . . . . . . . . . . . . . . . . . . . . . . . 194

Beilage XVI. Unterschiede der Aufmerksamkeit. Die Artikulatio-


nen der Erfassung . . . . . . . . . . . . . . . . . . . . . 195

Beilage XVII. Rezeptive Zuwendung und Zuwendung zu einer syn-


thetischen Einheit in und mit ihrer Erzeugung . . . . . . . . . 196

Nr. 11. Die Konstitution von Sachverhalten und ihren Formen


in Explikationen und darauf gründenden prädikativen Denk-
synthesen und Denkformungen . . . . . . . . . . . . . . 199
§ 1. Die bestimmende Prädikation als eigenschaftliche und als
relative. Das absolut Adjektivische gegenüber dem relativ
Adjektivischen . . . . . . . . . . . . . . . . . . . . 199
§ 2. Die Frage nach den kategorialen Grundformen von Prädi-
katen. Ist die Bestimmung durch Teile eine Sonderform des
eigenschaftlichen Bestimmens? . . . . . . . . . . . . . 202
§ 3. Einstufige Explikation. Die schon in der bloßen Explikation
auftretenden Formen gegenüber den spezifisch prädikativen
Denkformungen . . . . . . . . . . . . . . . . . . . . 205
§ 4. Die Frage nach dem Unterschied und Verhältnis zwischen
den beiden Sachverhaltsformen „S ist p“ und „S hat P“ . . 209
§ 5. Das der Erfassung des relationellen Sachverhalts zugrunde
liegende Übergehen. Die dem Gegenstand durch den bezie-
henden Übergang erwachsende Bestimmung bedarf zu ihrer
Erfassung keiner Explikation mehr . . . . . . . . . . . 211
§ 6. Die Erfassung innerer und relativer Merkmale. Die Vorhan-
denheit und Erfassbarkeit relativer Merkmale setzt ein be-
ziehendes Übergehen voraus. Die Erfassung der Merkmale
ist noch keine Erfassung des Sachverhalts. Merkmal und Teil 213

Nr. 12. Die schöpferische Erzeugung von Sachverhalten, ihre Ob-


jektivierung und ihre Explikation . . . . . . . . . . . . . 218
§ 1. Auffassung, Sich-Aufdrängen und Richtung-auf im Erfassen 218
§ 2. Blinde und von Erfassung durchleuchtete Gegenstands-
phänomene. Affektives Zuhandensein gegenüber dem Zu-
handensein aus schöpferischer Spontaneität. Das Ergreifen
und Explizieren der durch Synthesis konstituierten Gegen-
stände . . . . . . . . . . . . . . . . . . . . . . . . 221
xii inhalt teilband i

§ 3. Schlichtes Ergreifen und sich daran anschließende schritt-


weise Explikation eines Dinges bzw. eines Vorgangs gegen-
über der schrittweisen Erzeugung des Sachverhalts im Urteil 224
§ 4. Der Unterschied beim Sachverhaltsbewusstsein zwischen
der Zuwendung zum Thema und der Richtung auf den Ge-
genstand. Die Zuwendung zum Sachverhalt im Wie gegen-
über der nominalisierenden Reflexion als Richtung auf den
Sachverhalt schlechthin . . . . . . . . . . . . . . . . 227
§ 5. Explikation und Verdeutlichung des Sachverhalts durch Wie-
dererzeugung. Die doppelte Art des Sachverhaltsbewusst-
seins. Die beiden Arten von Originarität bei synthetischen
Akten . . . . . . . . . . . . . . . . . . . . . . . . 230

Beilage XVIII. Rezeptive und produktive Objektivation. Das


schlichte Erfassen eines sinnlich-rezeptiv Vorgegebenen gegen-
über dem Erfassen im Erzeugen einer neuen Materie in höheren
Objektivationen . . . . . . . . . . . . . . . . . . . . . . 233

Beilage XIX. Sinnliche Erscheinungen vor und in der Zuwendung.


Die Spontaneität des Durchlaufens gegenüber der schöpferischen
Spontaneität des Denkens. Gibt es analoge Unterschiede zwischen
Zuwendung und synthetischer Erzeugung im Gemüt? . . . . . 238

Nr. 13. Zuwendung und Denken. Die Frage des Substrats . . . 242
§ 1. Die formende Spontaneität des prädikativen Meinens gegen-
über dem bloßen Erscheinen und Erfassen. Das Erkennen
als Erscheinungscharakter . . . . . . . . . . . . . . . 242
§ 2. Im anschaulichen Urteil „erscheint“ ein Sachverhalt. Ein
Sachverhalt kann in verschiedener Weise bewusst und Ge-
genstand der Zuwendung sein . . . . . . . . . . . . . 245
§ 3. Die stetige Konstitution der dinglichen Einheit im Fortgang
des Erscheinungsabflusses. Die dem Abfluss einer Erschei-
nungsreihe einwohnende Zuwendung gegenüber dem retro-
spektiven Blick auf die herabgesunkene Erscheinungsreihe
und die durch sie konstituierte Einheit . . . . . . . . . . 248
§ 4. Beim Sachverhaltsbewusstsein gibt es keine vorgebenden
Erscheinungen. Vergegenwärtigung und Vorschweben als
wesensverschiedene Arten von Nicht-Ursprünglichkeit. Ver-
worrenes Urteilen gegenüber Verworrenheit in der Wahr-
nehmung . . . . . . . . . . . . . . . . . . . . . . . 252
inhalt teilband i xiii

§ 5. Sinnliche gegenüber kategorialer Erfassung. Der auf das


verworren Gemeinte gerichtete Blick der Zuwendung ge-
genüber dem im eigentlichen Urteilen lebenden Blick. Das
verworrene Denken gehört in die Sphäre der Passivität . . 257
§ 6. Affektion und Funktion. Die Spontaneität der Ich-Akte als
freie Akte gegenüber den eigentlichen Willensakten . . . 261
§ 7. Akzeptionen gegenüber spontanen Akten als Vernunftakten
im prägnanten Sinn. Akt und Zustand – Aktivität und Passi-
vität – Sinnlichkeit und Verstand (Vernunft). Die Konstitu-
tion der Vernunftgegenstände in spontanen Vernunftakten 265
§ 8. Objektivation im Sinn der Zuwendung, des Zuwendungs-
substrats und der Subjektion. Nur intentionale (gegenstands-
konstituierende) Erlebnisse als Objektivationen im prägnan-
ten Sinn können Substrate von Zuwendungen sein . . . . 268

Nr. 14. Stücke, Verbindungen und Eigenschaften. Zur Lehre von


der Objektivation und von den verschiedenen Bestimmungs-
weisen eines Gegenstandes . . . . . . . . . . . . . . . . 272
§ 1. Stücke als selbständige Teile gegenüber Verbindungen und
Eigenschaften als unselbständige Momente . . . . . . . 272
§ 2. Die unterschiedliche Gegebenheit von Stücken und Eigen-
schaften in der Explikation. Die Verwandlung des eigen-
schaftlich bestimmenden in ein relationell bestimmendes Be-
wusstsein . . . . . . . . . . . . . . . . . . . . . . . 276
§ 3. Die relative Bestimmung eines Gegenstandes als Übergangs-
synthese zu einem zweiten substantivischen Gegenstand.
Absolute und relative Adjektivität. Relationen als Kollektiv-
Komplexe mit Kollektiv-Prädikaten. Der Unterschied zwi-
schen Verbindungs- und Vergleichungsrelationen. Psychi-
sche Eigenschaften und die unzerstückbare Einheit des Ich 281

Beilage XX. Eigenschaftliche gegenüber relationellen Bestimmun-


gen: die Frage nach ihren Fundamenten, den Möglichkeiten der
Nominalisierung und des Habens. Der Unterschied zwischen Ver-
bindungs- und Vergleichungsrelationen . . . . . . . . . . . . 285

Nr. 15. Sachliche Einheiten der Verschmelzung und der Ver-


bindung als Substrate für identifizierende und relationelle
Synthesen. Zur Lehre von den Prädikationsformen. Grundle-
gendes zur Relationstheorie . . . . . . . . . . . . . . . . 291
xiv inhalt teilband i

§ 1. Sinnlich-sachliche Einheit der Verschmelzung, sukzessiv-zu-


sammenhaltende Synthesis und spontane Erkenntnisakte 291
§ 2. Die universelle Funktion von Identifikation und Prädikation.
Identifizierende Synthesis als Quelle neuer relationeller Prä-
dikation . . . . . . . . . . . . . . . . . . . . . . . 297
§ 3. Grundformen der Relationen und Sachverhalte . . . . . 301

Beilage XXI. Die verschiedenen Begriffe von Relationsfundament


bei den Gleichheits- und Ähnlichkeitsrelationen . . . . . . . . 307

Beilage XXII. Der Unterschied zwischen den Beziehungen der Ver-


träglichkeit und Unverträglichkeit einerseits und denjenigen der
Gleichheit und Verschiedenheit andererseits: Ersteren liegt eine
gestiftete Einheit zwischen Ansatzintention und Erfüllung bzw.
Enttäuschung, Letzteren eine sinnliche Einheit zugrunde . . . . 309

iii
zur analyse der stellungnahmen
in ihren modi und fundierungen

Nr. 16. Die Verhältnisse zwischen Erscheinung, belief und Set-


zung im Hinblick auf die dreigliedrige Struktur des Bewusst-
seins . . . . . . . . . . . . . . . . . . . . . . . . . . . 311
§ 1. Setzung und Substrat. Schlichte und explikative Setzung. Die
funktionelle Abhängigkeit der auf dem Grund einer Erschei-
nung zu vollziehenden Setzungen voneinander . . . . . . 311
§ 2. Inwiefern Unterschiede der Auffassungsform und der belief-
Charaktere den Erscheinungen vor der Zuwendung angehö-
ren können . . . . . . . . . . . . . . . . . . . . . . 314
§ 3. Die funktionelle Abhängigkeit der belief-Qualitäten der Prä-
dikation von den belief-Qualitäten der als Substrat fungie-
renden Apparenz. Urteilen aufgrund einer Phantasieerschei-
nung als Phantasie-Prädikation oder als wirkliche Aussage
über das Erscheinende als solches . . . . . . . . . . . . 316
§ 4. Explikation und Exhibition. Die Scheidung der Qualifizie-
rung im Substrat von der Qualifizierung der Meinung. Das
durch das denkende Meinen erzeugte synthetische Gebilde
als Erscheinung höherer Stufe mit eigener belief-Qualität
kann zum Substrat neuer theoretischer Meinungen werden 320
inhalt teilband i xv

§ 5. Gemüts- und Willensakte als Substrate theoretischer Mei-


nungen. Die Gemütserscheinungen selbst haben belief-Cha-
rakter. Die Modalitäten des belief als zu allen intentionalen
Erlebnissen in gleicher Weise gehörig . . . . . . . . . . 324
§ 6. Sind emotionale und volitionale Setzungen Analoga der
theoretischen Setzung? Besteht die Struktur des Bewusst-
seins in einer genauen Entsprechung zwischen niederem und
höherem Bewusstsein in Intellekt, Gemüt und Wille? . . . 327

Beilage XXIII. Die Scheidung der Akte in Grundklassen (Regio-


nen). Die Qualität als Grundklassencharakter. Die modalen Be-
sonderungen der Gewissheit als zu jeder Grundklasse gehörig 330

Beilage XXIV. Zur Klärung der Begriffe Aktqualität, Aktmaterie


und Setzungssubstrat . . . . . . . . . . . . . . . . . . . . 331

Beilage XXV. Meinen als Setzung und Meinen als Aufmerken. Die
Frage nach dem Begriff des Urteils . . . . . . . . . . . . . . 333

Beilage XXVI. Stehen das Wünschen und Werten dem Setzen der
Doxa gleich? Gibt es vor dem sich richtenden Wünschen und
Werten schon ein blindes, sich nicht richtendes? Die elektive ge-
genüber der schöpferischen Funktion der Akte. Inwiefern haben
Phänomene in der Sphäre der Vorgemeintheit Wesensgemein-
schaft mit setzenden Phänomenen? . . . . . . . . . . . . . . 337

Nr. 17. Zuwendung und Setzung. Richtungen der Zuwendung 340


§ 1. Bloße Zuwendung zu einem Erscheinenden gegenüber der
theoretischen Setzung. In den Urteilsfunktionen der Setzung
erwachsen neue Erscheinungen . . . . . . . . . . . . . 340
§ 2. Lust und Unlust als Erscheinungscharaktere. Verschiedene
Richtungen der Zuwendung bei einer qualifizierten Erschei-
nung. Jede Zuwendung als Erfassung kann zur theoretischen
Setzung werden . . . . . . . . . . . . . . . . . . . . 343
§ 3. Ist jede Zuwendung eine Setzung, mit der sich ein Gegen-
stand als seiend konstituiert? Das schon im schlichten Zu-
wenden waltende Meinen mit seinen Glaubensmodi. Kann
ich anders als glaubend meinen? Das Ansetzen . . . . . . 347

Nr. 18. Die Arten und der Aufbau der Stellungnahmen . . . . 351
xvi inhalt teilband i

§ 1. Stellungnahmen: ihre Klassifikation und ihre Modifikatio-


nen. Die anaxiontische Modifikation . . . . . . . . . . 351
§ 2. Aktuelle gegenüber potenziellen Stellungnahmen. Das po-
tenzielle Bewusstsein des Gewissseins des Gefallenscharak-
ters im aktuellen Gefallen . . . . . . . . . . . . . . . 353

Beilage XXVII. Seinscharakter und Stellungnahme. Stellungnah-


men und ihre Modi der Gewissheit. Das Korrelat jeder Stellung-
nahme als mögliches Objekt einer doxischen Stellungnahme . . 357

Beilage XXVIII. Die Charakterisierung jedes Erlebnisses und seines


Vermeinten als seiend im inneren Bewusstsein. Jedes Bewusstsein
gibt seinem Korrelat eine doxische Charakteristik. Die axiotischen
Charaktere und ihre Schichten . . . . . . . . . . . . . . . . 358

Nr. 19. Gattungen und Arten, Fundierungsweisen und Modi der


Stellungnahmen . . . . . . . . . . . . . . . . . . . . . 362
§ 1. Gewissheit ohne Gegenmotive gegenüber der Entscheidung
für eine Seite im Streit von einander hemmenden Intentio-
nen . . . . . . . . . . . . . . . . . . . . . . . . . 362
§ 2. Stellungnahme in der Weise der Vermutung. Gewisse gegen-
über gehemmter Vermutungsentscheidung. Gewissheit und
Ungewissheit als zu jeder Stellungnahme gehörende Modi 365
§ 3. Fundierte Stellungnahmen, die aus der Verbindung von Stel-
lungnahmen und Gegenstellungnahmen erwachsen: Anset-
zung und Gegenansetzung, Entscheidung für und gegen,
Zweifel . . . . . . . . . . . . . . . . . . . . . . . . 367

Beilage XXIX. Das Ins-Wanken-Geraten und Überwogenwerden


einer Anmutung durch das Auftauchen neuer Motive. Die Ent-
scheidung für das Für-anmutlicher-Vermeinte. Stellungnahme
ohne Entscheidung. Der potenzielle belief und seine Aktualisie-
rung . . . . . . . . . . . . . . . . . . . . . . . . . . . . 371

Beilage XXX. Stellungnahme im prägnanten Sinn als Entschei-


dung . . . . . . . . . . . . . . . . . . . . . . . . . . . 372

Beilage XXXI. Einschichtigkeit und Mehrschichtigkeit von Akten in


Korrelation zur einfachen und mehrfachen axiologischen Charak-
terisierung des intentionalen Gegenstandes . . . . . . . . . . 373
inhalt teilband i xvii

Nr. 20. Bloße Vorstellung (bloße Attention) und Stellung-


nahme . . . . . . . . . . . . . . . . . . . . . . . . . . . 375
§ 1. Das Zustandekommen der bloßen Vorstellung als bloßer
Attention durch den Nicht-Vollzug der Stellungnahme . . 375
§ 2. Die zu jedem intentionalen Erlebnis gehörenden Möglich-
keiten der Reflexion auf das in einem intentionalen Erlebnis
Vermeinte. Bloße Vorstellung vom Aktsubstrat und seiner
Charakterisierung durch die Ausschaltung des Glaubens der
Reflexion . . . . . . . . . . . . . . . . . . . . . . . 379
§ 3. Zum Substratbewusstsein gehört notwendig und unmittelbar
eine vollzogene oder unvollzogene doxische Stellungnahme.
Die fundierten Stellungnahmen. Der Aufbau des Substrat-
bewusstseins . . . . . . . . . . . . . . . . . . . . . 382

Beilage XXXII. Die Beschreibung der Erscheinung unter Absehung


von Sein und Nichtsein der erscheinenden Gegenstände. Phanta-
sieurteile mit Phantasie-Stellungnahmen gegenüber Urteilen über
das Phantasierte als solches. Fingierte Objekte getrennter Phan-
tasien erhalten ihre Einheit durch die Quasi-Setzungen der Phan-
tasie-Stellungnahmen . . . . . . . . . . . . . . . . . . . . 385

Beilage XXXIII. Das Urteilen aufgrund bloßer Vorstellung als Be-


schreibung des Erscheinungsgehalts ohne Setzung des Seins des
Vorgestellten gegenüber dem vollen, seinssetzenden Urteilen . . 393

Beilage XXXIV. Das Sich-Richten der Aufmerksamkeit ist kein Akt


höherer Stufe. Zu jedem Akt wesentlich gehörend: die Substrat-
komponente und die Komponente der Stellungnahme . . . . . 399

Beilage XXXV. Die Modi des Vollzugs und Nichtvollzugs. In jedem


Akt kann sich ein kenntnisnehmendes doxisches Stellungnehmen
etablieren. Die doppeldeutige Rede von Inaktualität . . . . . . 400

Beilage XXXVI. Die Unterscheidung zwischen vollzogenen und


nicht vollzogenen stellungnehmenden Erlebnissen. Sind alle nicht-
stellungnehmenden Erlebnisse sinnliche Substrate? Kein Verstand
ohne Sinnlichkeit. Die sich auf die sinnlichen Akte gründenden
synthetischen Akte gegenüber den spezifischen Verstandesfunk-
tionen . . . . . . . . . . . . . . . . . . . . . . . . . . . 404
xviii inhalt teilband i

Nr. 21. Das bloße Sich-Denken als bloße Betrachtung gegen-


über dem stellungnehmenden Bewusstsein . . . . . . . . . 407
§ 1. Das bloße Sich-Denken als aufmerksame Zuwendung auf
das Substrat ohne Vollzug einer Stellungnahme. Die Konsti-
tution neuer Gegenständlichkeiten durch die Stellungnahme 407
§ 2. Die stellungnehmende oder die bloß vorstellende Konstitu-
tion eines Sachverhalts in der Reflexion auf einen stellung-
nehmenden Akt: die durch das axiontische Prädikat charak-
terisierte Substratgegenständlichkeit. Die Versuchung, je-
dem Akt eine Vorstellung unterzulegen . . . . . . . . . 411

Nr. 22. Stellungnahme und Aufmerksamkeit. Positionalität, In-


teresselosigkeit für Sein oder Nichtsein und Neutralität . . 415
§ 1. Im schlichten Wahrnehmen und Urteilen besteht keine Un-
terscheidung zwischen Inhalt und Seinscharakter. Das Auf-
merken auf den Inhalt als Modifikation des schlichten Aktes.
Die Abwandlung von vollzogenen Thesen in Quasi-Thesen 415
§ 2. Das Sich-Enthalten und erneut Vollziehen einer Seinsset-
zung. Die Irrelevanz der Geltung für das ästhetische Inter-
esse. Das Bewusstsein der Position gegenüber dem Bewusst-
sein der Neutralität . . . . . . . . . . . . . . . . . . 419
§ 3. Der Unterschied zwischen der Phantasieeinstellung und der
ästhetischen Einstellung. In der ästhetischen Einstellung
setzt das wache Ich das Fiktum im Wie seiner Erscheinungs-
weisen . . . . . . . . . . . . . . . . . . . . . . . . 422

iv
analysen zu den vollzugsmodi der
aufmerksamkeit, zu erkenntnisstreben
und erkenntniserwerb, zu
ausdruck und verstehen und zu
vorgegebenheit und affektion

Nr. 23. Vorstellung als Grundlage für ein aufmerkendes und


stellungnehmendes Gerichtetsein. Der universale Modus der
Hintergründlichkeit . . . . . . . . . . . . . . . . . . . 427
inhalt teilband i xix

Beilage XXXVII. Der Anfang der intentionalen Analyse: die Typik


des wachen menschlichen Lebens. Unterscheidungen innerhalb
der allgemeinen Form des spontanen Ichlebens . . . . . . . . 433

Beilage XXXVIII. Die Gradualität der Hingabe in der Aufmerksam-


keit. Die Einigkeit des Ich in der Einheit des Interesses . . . . 435

Nr. 24. Urteilende Bestimmung, Kenntniserwerb und Kenntnis-


fixierung . . . . . . . . . . . . . . . . . . . . . . . . . 437
§ 1. Objektivierende und wertende Akte und (aktive) Urteils-
akte . . . . . . . . . . . . . . . . . . . . . . . . . 437
§ 2. Das Begreifen des Gegenstandes in Kenntnis stiftenden Ur-
teilen. Erkenntniserweiterung und Erkenntniserläuterung
gegenüber dem bloß analytischen Urteilen . . . . . . . . 438
§ 3. Das theoretische Interesse . . . . . . . . . . . . . . . 440
§ 4. Urteilen und aussagendes Behaupten . . . . . . . . . . 441

Beilage XXXIX. Das Absehen auf bleibendes Wissen. Das Im-Griff-


Behalten als Willensgriff. Höherstufiges Begreifen und allgemei-
nes Erkennen vermöge der Wissensfixierung . . . . . . . . . 443

Nr. 25. Aussagen und Verstehen . . . . . . . . . . . . . . . 445


§ 1. Die uneigentliche Rede und das passive Verstehen. Das
Quasi-Mitmeinen im Verstehen der Meinung des Anderen
im Lesen und Hören . . . . . . . . . . . . . . . . . . 445
§ 2. Das aussagende Meinen. Alles Sprechen will durch den
Sprachleib hindurch in der Bedeutung terminieren. Zum
Ausdruck kommt nur thematisch gemeinter Sinn . . . . . 447

Beilage XL. Subjektive Ausdrücke von Gemütsphänomenen (Ge-


mütsinhalten). Ausströmungen des Ich im Gemütsverhalten . . 452

Nr. 26. Zur Phänomenologie der Vorgegebenheit und der Affek-


tion . . . . . . . . . . . . . . . . . . . . . . . . . . . . 454
§ 1. Affektion als eine auf das Ich hingehende Tendenz auf the-
matischen Vollzug. Inwiefern das Hintergrunderleben eine
Vergegenwärtigung ist. Hemmungen der Gewissheit im Voll-
zug thematischer Aktion und die neue Affektion und Ten-
denz auf Herstellung der Gewissheit . . . . . . . . . . . 454
xx inhalt teilband i

§ 2. Die mit einem Einfall verbundene Aufforderung zu seinem


thematischen Vollzug. Übernahme und Miturteilen gegen-
über Enthaltung. Epoché als allgemeine Abwandlung von
thematischen Akten . . . . . . . . . . . . . . . . . . 459
§ 3. Die Struktur des Reiches der Vorgegebenheiten: das Reich
der einstimmigen Erfahrungsfortgeltung, das Reich der Ein-
fälle und das Reich der Zumutungen von anderen . . . . 463

Beilage XLI. Der intentionale Erwerb als eine Vorgegebenheit und


die Intention auf Wiedererzeugung. Die in der Vergegenwärtigung
liegende Zumutung, den reproduktiven Glauben mitzuvollziehen.
Die Hemmung der Intention auf Mitglauben . . . . . . . . . 466

Beilage XLII. Das Fragen als Urteilsstreben. Die das Fragen fundie-
rende Glaubensmodalität. Die Neutralitätsmodifikation . . . . 468

v
texte zu landgrebes typoskript der
„studien zur struktur des bewusstseins“

Nr. 27. Gedankengang der Einleitung und der I. „Studie“ . . . 469


§ 1. Zur Einführung. Sinn und Möglichkeit einer reinen Psycho-
logie . . . . . . . . . . . . . . . . . . . . . . . . . 469
§ 2. Die Brentano’schen Grundbegriffe als Ausgangspunkt.
Kennzeichnung ihrer hauptsächlichen Unklarheiten und der
sich daran knüpfenden Fragen . . . . . . . . . . . . . 474
§ 3. Die Strukturen der auf einen „Inhalt“ bezogenen Intentio-
nalität als Thema. Frage nach der Wesenstypik des mannig-
faltigen Bewusstseins als Bewusstsein vom Selben . . . . 475
§ 4. Das zeitliche Sein der Erlebnisse. Reelle und irreelle Eigen-
heiten . . . . . . . . . . . . . . . . . . . . . . . . 477
§ 5. Die Probleme der Richtung-auf. Waches Ich und Hinter-
grund . . . . . . . . . . . . . . . . . . . . . . . . 481
§ 6. Akt, Aufmerksamkeit, Stellungnahme . . . . . . . . . . 484

Beilage XLIII. Die unvermeidliche Naivität des Verfahrens der an-


fangenden Wissenschaft vom Bewusstsein. Als positive Wissen-
schaft soll die Psychologie erkenntnistheoretische Bedenken hin-
sichtlich der Möglichkeit einer Bewusstseinswissenschaft auf sich
beruhen lassen . . . . . . . . . . . . . . . . . . . . . . . 488
inhalt teilband i xxi

Beilage XLIV. Zum Problem der Klassifikation der intentionalen Er-


lebnisse . . . . . . . . . . . . . . . . . . . . . . . . . . 491

Beilage XLV. Die Unterordnung der reellen Analyse der Erlebnisse


unter die Analyse ihrer Sinn leistenden Funktionen im Leben eines
Ich . . . . . . . . . . . . . . . . . . . . . . . . . . . . 493

Beilage XLVI. Zum Anfang und zum allgemeinsten Begriff der in-
tentionalen Erlebnisse. Die Einklammerung jeden Dafürhaltens
und die Verwandlung aller uns geltenden Gegenständlichkeiten in
Phänomene . . . . . . . . . . . . . . . . . . . . . . . . 495

Beilage XLVII. Fragen zur Intentionalität im Ausgang von Brenta-


nos Bestimmungen und sich an die Synthesis knüpfende Fragen 497

Beilage XLVIII. Allgemeinste Wesenseigenheiten eines intentiona-


len Erlebnisses . . . . . . . . . . . . . . . . . . . . . . . 498

Beilage XLIX. Kontinuierliche Explikation und Bestimmung eines


Substrats. Die sich am Substrat niederschlagende Kenntnis. Die
Enthüllung des schon Bekannten als Reaktivierung schon gestif-
teter Geltung . . . . . . . . . . . . . . . . . . . . . . . 501

Beilage L. Bewusstsein als intentionales Erlebnis im Verhältnis zum


„Meinen“ . . . . . . . . . . . . . . . . . . . . . . . . . 502

Beilage LI. Zu der Interpretation der thetischen Modalitäten . . . 504

Beilage LII. Das primäre und sekundäre Dabeisein (patentes Be-


wussthaben) gegenüber Wahrnehmungserlebnissen, in denen das
Ich in keiner Weise dabei ist (latentes Bewussthaben) . . . . . 505

Beilage LIII. Passive und aktive Konstitution. Die aufmerkende Zu-


wendung als niederste Stufe der Spontaneität. Rezeptivität und
Sinnlichkeit. Das Festhalten im Modus der Spontaneität gegen-
über der passiven Retention . . . . . . . . . . . . . . . . . 507

Beilage LIV. Die merkwürdige Rückwirkung in der Dingwahrneh-


mung der impressionalen Erscheinung auf die retentionalen Er-
scheinungen . . . . . . . . . . . . . . . . . . . . . . . . 508
xxii inhalt teilband i

Nr. 28. Disposition der I. Studie (zugleich als Leitfaden für die
Umarbeitung) von Ludwig Landgrebe, mit Annotationen und
Korrekturen von Edmund Husserl . . . . . . . . . . . . . 512
§ 1. Einleitung . . . . . . . . . . . . . . . . . . . . . . 512
§ 2. Erste vorläufige Aufweisung der zu klärenden Phänomene 512
§ 3. Anknüpfung an die traditionelle Scheidung von Vorstellung
und Stellungnahme. – Fixierung des echten Begriffs der Stel-
lungnahme als Spontaneität und Aufklärung der Problema-
tik des „bloßen Betrachtens“ . . . . . . . . . . . . . . 513
§ 4. Thema als Korrelat der Stellungnahme. Zwei Begriffe von
Thema . . . . . . . . . . . . . . . . . . . . . . . . 517
§ 5. Spontaneität als Vordergrundbewusstsein und ihr Verhältnis
zum Hintergrund . . . . . . . . . . . . . . . . . . . 518
§ 6. Rezeptivität als Unterstufe der Spontaneität . . . . . . . 520
§ 7. Die schöpferische Spontaneität und die Unterscheidung von
„Sinnlichkeit und Verstand“ . . . . . . . . . . . . . . 521
TEILBAND II

GEFÜHL UND WERT

i
werten und wert. zur wertlehre

§ 1. Sachbestimmtheiten und Wertbestimmtheiten . . . . . . 1


§ 2. Empirische Apperzeption und Gemütsapperzeption. Stehen
Glauben und Gefallen auf einer Stufe? . . . . . . . . . 3
§ 3. Wollen ist keine Wertapperzeption. Die Bewertbarkeit des
Wollens . . . . . . . . . . . . . . . . . . . . . . . 11
§ 4. Gemütsmotivation im Unterschied zur empirisch-assoziati-
ven Motivation . . . . . . . . . . . . . . . . . . . . 13
§ 5. Werten als im Wahrnehmen fundierter Akt. Erfüllung der
Wertmeinung. Unmittelbare und mittelbare Werte . . . . 22
§ 6. Empfinden und apperzeptive Objektivation in Akten des
Wahrnehmens und Gefallens . . . . . . . . . . . . . . 32
§ 7. Das Verhältnis von Freude, Wunsch und Wollen zum Werten.
Die Fundierung des Wollens im Wünschen . . . . . . . . 40

Beilage I. Die Fundierung der Gemütsakte als Gemütsapperzeption


und Gemütsmeinung . . . . . . . . . . . . . . . . . . . . 47

Beilage II. Gibt es spontane Gemütsakte als eine von den theoretisch
bestimmenden Denkakten unterschiedene Klasse von Vernunft-
akten? . . . . . . . . . . . . . . . . . . . . . . . . . . . 49

Beilage III. Das sinnliche Gefühl als immanente Zeiteinheit ist kein
auf den Empfindungsinhalt bezogener Akt . . . . . . . . . . 50
xxiv inhalt teilband ii

ii
die von gegenständen ausgehende erregung
von gefühlen gegenüber der auf die
gegenstände hinzielenden wertung. die frage
nach dem gefühlscharakter des wertens

§ 1. Die Intensitätsunterschiede im affizierten Gefühl und im


Gefühlslicht gegenüber den Unterschieden des Wertes. Die
Erregung von Gefühlsakten durch wertcharakterisierte Ob-
jekte . . . . . . . . . . . . . . . . . . . . . . . . . 53
§ 2. Sinnliche Gefühle als Gefühle, deren Erregung kein Wer-
ten des Objekts zugrunde liegt. Ist das Werten ein erregtes
Fühlen? . . . . . . . . . . . . . . . . . . . . . . . 57
§ 3. Die Verschmelzung des Empfindungsgefühls mit dem Emp-
findungsinhalt. Der Gefühlston. Die Unterscheidung zwi-
schen der Geschmackslust und der dadurch motivierten
Freude am Haben der Geschmackslust. Der Übergang der
Freude in die frohe Stimmung . . . . . . . . . . . . . 59
§ 4. Das Schwelgen in der Phantasie – die Freude an wissen-
schaftlicher Forschung: Erlebnislust als Voraussetzung der
Freude als wertendes Gefallen. Das wertende Gefallen als
Gefühlsapprehension . . . . . . . . . . . . . . . . . 66

Beilage IV. Empfindungsgefühl und Gegenstandsgefühl . . . . . 70

iii
die analogie zwischen denkakten und
axiologischen akten. rezeptivität und
spontaneität bei der konstitution
von seins- und wertobjektivitäten

§ 1. Affektion, Auffassung, Zuwendung und schöpferischer Ver-


standesakt . . . . . . . . . . . . . . . . . . . . . . 73
§ 2. Theoretische Zuwendung und Gemütszuwendung . . . . 85
§ 3. Zuwendung als Modus der Lebendigkeit, Erfassung und
Denksetzung. Die Konstitution empirischer und axiologi-
scher Abhängigkeiten . . . . . . . . . . . . . . . . . 87
§ 4. Gefühlssinnlichkeit und Intentionalität . . . . . . . . . 92
inhalt teilband ii xxv

iv
die arten der gemütsintentionalität

§ 1. Ding- und Wertapperzeption. Gefühls-, Begehrungs- und


Willenseigenschaften als objektive, apperzipierte Eigen-
schaften . . . . . . . . . . . . . . . . . . . . . . . 97
§ 2. Wertapperzeption und Gefühlsapperzeption. Die Frage nach
der Intentionalität der Stimmung . . . . . . . . . . . . 101
§ 3. Das Begehren des Schlechten. Objektiver Wert und hedoni-
scher Wert . . . . . . . . . . . . . . . . . . . . . . 105
§ 4. Die Intentionalität des Gefühlsaffekts. Gefühlsausbreitung
und miterregte Gefühle. Objektive und übertragene Gefühle 108

Beilage V. Die Unterscheidung zwischen Affekten und ihren Aus-


strahlungen einerseits und der größeren oder geringeren Leben-
digkeit und Hingabe bei den Gemütsakten andererseits . . . . 115

v
die konstitution der gemütscharaktere

§ 1. Freude aufgrund von Anschauungen und aufgrund von Ur-


teilen . . . . . . . . . . . . . . . . . . . . . . . . . 117
§ 2. Schlichte Wertapperzeption und Stellungnahmen des Ge-
müts . . . . . . . . . . . . . . . . . . . . . . . . . 118
§ 3. Gefühlszuwendung und Erregungsstrom. Die Gegebenheit
der Gemütscharaktere im Gemütsakt und in der setzenden
Erfassung . . . . . . . . . . . . . . . . . . . . . . . 121
§ 4. Gemütscharaktere als ontische Charaktere . . . . . . . . 131
§ 5. Subjektive Richtung-auf und Stellungnahme bei den Er-
scheinungen und bei den Gemütscharakteren . . . . . . 134
§ 6. Empirische Apperzeption und Wertapperzeption . . . . . 136
§ 7. Die Empfindungsunterlage der Sondergefühle und der Ein-
heitsform der Gefühle . . . . . . . . . . . . . . . . . 141
xxvi inhalt teilband ii

vi
gefühlsbewusstsein – bewusstsein von
gefühlen. gefühl als akt und als zustand

§ 1. Über die Beobachtung von Gefühlen. Lektüre von und Kom-


mentar zu Moritz Geigers Abhandlung in der Lipps-Fest-
schrift . . . . . . . . . . . . . . . . . . . . . . . . 143
§ 2. Meinendes Vorstellen und meinendes Fühlen . . . . . . 150
§ 3. Thema, Aufmerksamkeit und Interesse in der Sphäre der
Vorstellungen und Gemütsakte . . . . . . . . . . . . . 157
§ 4. Gefallen als Akt und der Affekt der Freude als Zustand . . 165
§ 5. Sinnliche Lust, Genuss, Stimmung und intentionale Wertge-
fühle . . . . . . . . . . . . . . . . . . . . . . . . . 171
§ 6. Unterschiede und Zusammenhang zwischen Wertbewusst-
sein und intentionalem Freudegefühl . . . . . . . . . . 177

Beilage VI. Wertbewusstsein und Genuss . . . . . . . . . . . . 183

Beilage VII. Das Sich-Aufdrängen eines Objekts als Reiz zur Zu-
wendung . . . . . . . . . . . . . . . . . . . . . . . . . . 188

vii
passivität und aktivität in intellekt und gemüt

§ 1. Das aktive Wahrnehmen . . . . . . . . . . . . . . . . 191


§ 2. Urdoxa und Modalisierung. Die Ichbeteiligung bei der Mo-
dalisierung . . . . . . . . . . . . . . . . . . . . . . 193
§ 3. Latente Intentionalität, das Wachwerden des Ich und die
Leistung des aktiven Ich . . . . . . . . . . . . . . . . 198
§ 4. Passive Lust und aktives Gefallen. Lust als Gegenstand und
Lust als Wert. Die Aktrichtungen der Intellektion und Emo-
tion . . . . . . . . . . . . . . . . . . . . . . . . . 203
§ 5. Der Bewusstseinsstrom ist durch und durch Objektivation
und Synthesis. Die konstitutive Funktion der Lust . . . . 207

Beilage VIII. Objektivation und wertendes Gefühl . . . . . . . . 210


inhalt teilband ii xxvii

Beilage IX. Die notwendige Vorstellungsgrundlage eines Gemüts-


akts. Fundierte Qualifizierungen: Sinnesstrukturen und entspre-
chende Aktschichtungen . . . . . . . . . . . . . . . . . . 214

Beilage X. Die in verschiedenen Stufen gegebenen Vorgegebenhei-


ten für das Werten. Wertung in der Möglichkeit als eine Modalität
des Wertens. Explikation des Wertes in den Gemütsakten . . . 216

Beilage XI. Sachliche und axiotische Affektion. Die Scheidung zwi-


schen Empfindungsdaten und Gefühlsempfindungen in der Sphäre
ursprünglicher Affektion. Wie verhalten sich sinnliche Gefühle
zum Gefallen? . . . . . . . . . . . . . . . . . . . . . . . 218

Beilage XII. Sachen und Werte. Gefühlsbewusstsein als doxisches


Bewusstsein von einem Wert und als Gemütsverhalten zu einem
in einem doxischen Akt gegebenen Gegenstand . . . . . . . . 220

viii
reine werte gegenüber praktischen
werten. die frage nach der
absoluten willenswahrheit

§ 1. Reine Werte und ihre Rangordnungen. Werten als das Erle-


ben reiner Freude . . . . . . . . . . . . . . . . . . . 225
§ 2. Begehrungswerte als existenziale Werte. Auf reine Schönhei-
ten im rein wertenden Erschauen gerichtete Begehrungen 228
§ 3. Wertung von Wertobjekten als mögliche Begehrungsziele.
Wertung des Wertgenusses. Praktische Werte als Schönheits-
werte einer neuen Stufe. Die Frage nach einer von der Schön-
heitswertung noch zu unterscheidenden Willenswahrheit 231
§ 4. Formale Wertlehre und formale Praxis. Reine absolute Werte
gegenüber individuell relativen praktischen Werten. Der uni-
versale kategorische Wille als ein praktisches Gut . . . . . 233

Beilage XIII. Die Willensrichtigkeit als Schönheitswert. Muss jedes


Wollen auf einen Wert gehen? . . . . . . . . . . . . . . . . 237

Beilage XIV. Hat der Wille im Gerichtetsein auf das praktisch Gute
seine eigene Richtigkeit? . . . . . . . . . . . . . . . . . . 238
xxviii inhalt teilband ii

Beilage XV. Lust und Wert . . . . . . . . . . . . . . . . . . 240

Beilage XVI. Freude als Modus des Genusses. Freude an der reinen
Idee. Ideenschönheit. Auf Schönes gerichtetes Wollen und Begeh-
ren . . . . . . . . . . . . . . . . . . . . . . . . . . . . 241

Beilage XVII. Das Reich der reinen Schönheitswerte als Reich des
Genusses gegenüber den absoluten Gewissenswerten. Das Ver-
nunftgesetz der Wahl des Besten unter dem Erreichbaren gilt nur
für die hedonischen Werte . . . . . . . . . . . . . . . . . . 242

Beilage XVIII. Ist jede Freude ein Für-wert-Halten und ist jedes
Werten ein positives Gefühl? Ist Werten eine eigene Art der
Stellungnahme? . . . . . . . . . . . . . . . . . . . . . . 245

ix
das gefallen am schönen
und der schönheitswert

§ 1. Das nicht durch einen Glauben motivierte, uninteressierte


Gefallen am Schönen gegenüber dem Gefallen am Wesen
als Seienden . . . . . . . . . . . . . . . . . . . . . 247
§ 2. Das Schön-Gefallen als inhaltliches Gefallen. Inwieweit ist
ein Glauben Motivationsgrundlage für ein Schön-Gefallen?
Das Gefallen an einem Ding wegen seiner schönen Erschei-
nungen . . . . . . . . . . . . . . . . . . . . . . . . 250
§ 3. Das Gefallen am Schönen als Gefallen an der Erscheinung
und das Missfallen am Hässlichen als qualitativer Gegensatz.
Schönheitswert als Wert der Erscheinung gegenüber Güter-
wert als Wert des Erscheinenden als Seiendem. Gibt es bloße
Begehrungswerte? . . . . . . . . . . . . . . . . . . . 253

Beilage XIX. Die Selbstgegebenheit des Guten in der Freude am


Dasein gegenüber der Selbstgegebenheit des Schönen in der Freu-
de an der bloßen Erscheinung. Das Schöne, um seiner Schönheit
willen begehrt, wird zum reinen Guten . . . . . . . . . . . . 256
inhalt teilband ii xxix

Beilage XX. Die Selbstgegebenheit eines Schönheitswertes in der


Anschauung des Eigenwesens eines Gegenstandes. Die Fundie-
rung eines Gutwertes in einer Seinsmodalität. Gegenstandswesen
und Erscheinungswesen als das Reich des spezifisch Ästhetischen.
Freude an der Selbsthabe eines Gegenstandes . . . . . . . . . 257

ERGÄNZENDE TEXTE

a
wert und billigung

Nr. 1. Billigung, Wert und Evidenz . . . . . . . . . . . . . . 261

Nr. 2. Wertnehmung und Billigung . . . . . . . . . . . . . . 269


§ 1. Die Frage nach der Konstitution und Erfassung des Wertes 269
§ 2. Durchführung der Analogie zwischen intellektiver und Ge-
mütssphäre . . . . . . . . . . . . . . . . . . . . . . 270
§ 3. Zwei Arten von Billigungen . . . . . . . . . . . . . . 272
§ 4. Der Doppelsinn des Bewertens . . . . . . . . . . . . . 273

Nr. 3. Das wertkonstituierende Gefühl als zum Gegenstand ge-


hörendes, in seinem Wesen gründendes Gefühl. Die Klarheit
des Gefühls als Analogon der Evidenz . . . . . . . . . . 276

Nr. 4. Erfüllt sich der Wunsch in der Freude? Das doppelte


Gerichtetsein des Wunsches auf Befriedigung und auf ein
wahrhaft Gutes. Der Doppelsinn von Erfüllung: Auswertung
und Befriedigung . . . . . . . . . . . . . . . . . . . . . 287

Nr. 5. Konvenienz der Gemütsakte . . . . . . . . . . . . . . 293

Nr. 6. Ästhetische Wertung: Schönheit aufgrund des perzeptio-


nalen Inhalts und Schönheit aufgrund der Darstellung . . 297

Nr. 7. Wertverhalte und die Objektivität der Werturteile . . . 307

Nr. 8. Billigung als sekundäres Gefühl auf Richtigkeit gehend.


Doppelsinn des Billigens und Wertens . . . . . . . . . . . 313
xxx inhalt teilband ii

b
intellekt und gemüt. sind gemütsakte
objektivierende akte? – gemütsakte
und ihre beziehung auf objekte

Nr. 9. Die verschiedenen Bewusstseinssphären und die allgemei-


nen, alle Sphären betreffenden Bewusstseinsformen . . . . 321

Nr. 10. Wunsch und Wunschverhalt. Wunschaussagen als unmit-


telbarer Ausdruck von Wünschen. Freude, Lust und Wün-
schen in ihrem Verhältnis zum Werten. Wert und Sollen . . 324

Nr. 11. Das Gefallen (Freude) als Zustand. Seine Erregung


durch ein phantasiertes Objekt oder eine Tatsache. Doxische
Prädikate der propositionalen Materie gegenüber Gemütsprä-
dikaten als Prädikaten von Tatsachen . . . . . . . . . . . 330

Nr. 12. Intellektive und emotionale Akte: Unterschiede in der


Art der Intentionalität und der Fundierung. Sinnengegen-
stände und Gefühlsgegenstände . . . . . . . . . . . . . . 332

Nr. 13. Haben Gefühlsprädikate bloß subjektive Geltung, indem


die Gefühlsakte objektiviert und dem erscheinenden Gegen-
stand zugedeutet werden? . . . . . . . . . . . . . . . . . 339

Nr. 14. Die wesentliche Verschiedenheit zwischen Gemütsakten


und objektivierenden Akten in der Weise der gegenständli-
chen Beziehung. Meinen als Doxa und Meinen als Hinwen-
dung . . . . . . . . . . . . . . . . . . . . . . . . . . . 341

Nr. 15. Gefühlscharakter und Wertprädikat. Entspricht jeder


Aktart eine bestimmte Charakterisierung ihrer Gegenstände? 346

Nr. 16. Seinsobjektivation und Wertobjektivation. Gehören Wert-


prädikate zum Wesen des Dinges? . . . . . . . . . . . . . 350

Nr. 17. Die Rede von Färbung bei Gemüts- und Wunschakten. Ist
die gegenständliche Beziehung der Gemüts- und Wunschakte
keine echte Objektivation? . . . . . . . . . . . . . . . . . 361
inhalt teilband ii xxxi

Nr. 18. Die Unterschiede in der Fundierung von prädikativen Ak-


ten und von Gemütsakten . . . . . . . . . . . . . . . . . 365

Nr. 19. In welchem Sinn alle Akte eine Vorstellung zur Grund-
lage haben. Seinswertungen und Gemütswertungen. Nochma-
liges Überdenken der Darstellung in den Logischen Unter-
suchungen . . . . . . . . . . . . . . . . . . . . . . . . 369

Nr. 20. Sinnliches und wertendes Bewusstsein gegenüber dem


Verstand als logisches Vermögen . . . . . . . . . . . . . 378

Nr. 21. Intellekt und Gemüt. Die Unterscheidung zwischen nie-


deren und höheren Bewusstseinsstufen. Empirische Funktion
und Wertungsfunktion. Das Meinen als das eigentliche Ob-
jektivieren . . . . . . . . . . . . . . . . . . . . . . . . 380

Beilage XXI. Die Vieldeutigkeit des Begriffs Meinung . . . . . . 387

Beilage XXII. Affektion, blinde Funktion und Spontaneität in Ver-


stand, Gemüt und Wille . . . . . . . . . . . . . . . . . . 388

Nr. 22. Resultate: Vorstellungsapperzeption und Gemütsapper-


zeption. Verstandesobjektivation und Gemütsobjektivation 392

c
zur phänomenologie des fühlens,
begehrens und wünschens

Nr. 23. Einige Grundpunkte zur Lehre vom Gefühl. Empfin-


dungslust und Gefallensapperzeption. Direktes und indirek-
tes Gefallen . . . . . . . . . . . . . . . . . . . . . . . 395

Nr. 24. Sachanschaulichkeit und Wertanschaulichkeit . . . . . 406


§ 1. Das Sich-Sättigen einer mittelbaren in einer unmittelbaren
Lust . . . . . . . . . . . . . . . . . . . . . . . . . 406
§ 2. Die Unterscheidung zwischen urteilender Werterkenntnis
und fühlendem Werthalten . . . . . . . . . . . . . . . 407
§ 3. Die Sättigungsunterschiede in der emprischen Wahrneh-
mung und in der Wertnehmung . . . . . . . . . . . . . 408
xxxii inhalt teilband ii

§ 4. Die Bedeutung der Sättigung für das Wünschen und Begeh-


ren . . . . . . . . . . . . . . . . . . . . . . . . . . 414

Nr. 25. Willenswerte, die nicht durch bloße Gefallenswerte be-


stimmt sind: Der höhere Wert des Wollens des fremden Gutes 417

Nr. 26. Die Frage nach der Vorstellungsgrundlage des Wun-


sches . . . . . . . . . . . . . . . . . . . . . . . . . . . 419

Nr. 27. Die mit der dinglichen Apperzeption Hand in Hand ge-
hende Gefühlsapperzeption: Es bedarf keiner von den Emp-
findungen unterschiedenen Gefühlsempfindungen . . . . . 420

Nr. 28. Das Genießen als Wahrnehmung des Gefallenswertes.


Der Unterschied zwischen direktem und indirektem Gefal-
len. Mängel der Fülle in der Freude als Anlass für Wünsche 421

Nr. 29. Worin besteht der Unterschied zwischen existenzialen


und nicht-existenzialen Gefühlen? . . . . . . . . . . . . 423

Nr. 30. Die Bestimmung der Gefühlsmodi durch die Modi des im-
pressionalen Aktes . . . . . . . . . . . . . . . . . . . . 425

Nr. 31. Der Unterschied zwischen Empfindungsgefühl, Inhalts-


gefühl und Gegenstandsgefühl . . . . . . . . . . . . . . 427

Nr. 32. Die Fundierung eines Gefallens in der Materie der Vor-
stellung. Die Bestimmung des Charakters des Gefallens und
Begehrens durch die Setzungscharaktere . . . . . . . . . 433

Nr. 33. Vollkommenheitsgrade der Sättigung eines Wunsches


und die der unterschiedlichen Höhe des Genusswertes ent-
sprechenden Grade der erfüllenden Freude . . . . . . . . 436

Nr. 34. Unterschiede der Reinheit und Unreinheit der Gefühle.


Der Charakter der Gefühle fundiert in den Gewissheitsmodi
und den Modi der Anschaulichkeit der unterliegenden Vor-
stellung. Die Wesensbeziehung von Wunsch und Freude . . 439
inhalt teilband ii xxxiii

Nr. 35. Wertsteigerung, Bevorzugung und Intensitätsunter-


schiede bei Lust und Unlust . . . . . . . . . . . . . . . . 443

Nr. 36. Das Gefallen des Besseren. Das Vorziehen als Gefallen
zweiter Stufe. Sinnliche und ästhetische Werte . . . . . . 445

Nr. 37. Das Vorziehen als ein in Gefallensakten fundierter be-


ziehender Akt. Ist das Vorziehen ein Gemütsakt? . . . . . . 448

Nr. 38. Eigentliche und uneigentliche Gefühle. Das Vorziehen


aufgrund uneigentlicher Vorstellung und Wertung. Vorzie-
hen im Gefallen und Wünschen. Das Problem der als richtig
charakterisierten Liebe . . . . . . . . . . . . . . . . . . 449

Nr. 39. Freude an eigenem und fremdem Schmerz. Neid als


Schmerz über die Freuden eines anderen . . . . . . . . . . 461

Nr. 40. Das Gefallen in der Phantasie und unter Assumtion. Das
ästhetische Gefallen . . . . . . . . . . . . . . . . . . . 463

Nr. 41. Wirkliche Gemütserlebnisse in der Phantasie. Freude an


der Phantasie. Phantasiewirklichkeit als Einheit der Kon-
sequenz von Verstandes- und Gemütsapperzeptionen in der
Phantasie . . . . . . . . . . . . . . . . . . . . . . . . . 468

Nr. 42. Die Frage nach der Entstehung des Unlustgefühls des
Mangels in Auseinandersetzung mit Hermann Schwarz . . . 474

Nr. 43. Gründet sich das Wünschen auf ein assumtives Gefallen? 478

Nr. 44. Triebgefühl, Gefühl des Mangels, Begehren und


Wunsch . . . . . . . . . . . . . . . . . . . . . . . . . . 482

Nr. 45. Wünschen und Begehren. Die fundierenden Akte des


Wünschens . . . . . . . . . . . . . . . . . . . . . . . . 491
§ 1. Die notwendigen Zusammenhänge zwischen intellektiven
Stellungnahmen, Gemütsakten und dem Wünschen . . . . 491
§ 2. Die Bezogenheit des Wunsches auf eine aktuelle Glückslage 495
§ 3. Wünschen als Vermissen und als Begehren . . . . . . . . 500
xxxiv inhalt teilband ii

d
schönwert und gutwert.
wertkonstitution und gefühl

Nr. 46. Das Sich-Verlieben als innere Entscheidung aus den Tie-
fen des Ich. Aktives Gefallen und Wertapperzeption. Die Ent-
scheidung für einen Vernunftwert . . . . . . . . . . . . . 507

Nr. 47. Genuss und Habe. Sinnliche und geistige Werte und Gü-
ter . . . . . . . . . . . . . . . . . . . . . . . . . . . . 513
§ 1. Sinnliche Lust und Genuss an lustbringenden Gegenständen.
Die Verfügungsfreiheit über einen Gegenstand hinsichtlich
der Realisierung seiner Lusteigenschaft. Gemeingüter . . 513
§ 2. Die kallistische Apperzeption. Die Eröffnung einer Region
von Sonderschönheiten durch ein künstlerisches Problem.
Das Verlangen nach neuen Problemen und neuen Typen
von Schönheit. Schönheit als eine Idee ist eine Sphäre der
Vernunft und des schöpferischen Handelns . . . . . . . . 516

Nr. 48. Schönheit als der allgemeine Wertbegriff. Wahrheit als


eine Sphäre von Schönheiten. Das von der Wissensfreude ge-
leitete Vernunftstreben gegenüber der bloßen Tendenz auf
Erfüllung . . . . . . . . . . . . . . . . . . . . . . . . 520

Nr. 49. Das wertende Gefallen als Wertapperzeption gegenüber


der durch den gewerteten Gegenstand erregten sinnlichen
Lust und ihrer sinnlichen Resonanz . . . . . . . . . . . . 522

Nr. 50. Der doppelte Sinn, in dem Gegenstand Wert hat: als Wert
in sich habend und als mittelbaren Wert habend wegen der
möglichen Realisierung der wertgründenden Momente. Gut
und Wert . . . . . . . . . . . . . . . . . . . . . . . . . 524

Nr. 51. Werten, Fühlen und Begehren. Schönwerten und Gut-


werten. Gutwerten, ohne sich am Gut zu freuen . . . . . . 527

Nr. 52. Werterfassung trotz Hemmung des Gefühls . . . . . . 530


inhalt teilband ii xxxv

Nr. 53. Die originale Konstitution des Wertes im originalen Akt


des Wertnehmens. Originalbewusstsein und Evidenz. Die Ver-
gegenwärtigungsmodifikation der Wertimpression als origina-
ler Grund für die Erfassung der Möglichkeit eines konkreten
Wertes . . . . . . . . . . . . . . . . . . . . . . . . . . 532

Nr. 54. Das Schöne als ideal identischer „Schein“ in Impression


und Phantasie. Die realisierende Objektivierung des Schönen
macht es zu einem geistig bedeutsamen Realen . . . . . . . 534

Nr. 55. Freude in ihrem Verhältnis zu Wunsch und Wille. Die


Frage nach den Aktklassen und ihrer Einheit . . . . . . . 536

Nr. 56. Zu den Äquivokationen des Wortes Wert . . . . . . . . 538

Nr. 57. Gefühl und Wertkonstitution. Das Problem der Ge-


fühlsqualitäten . . . . . . . . . . . . . . . . . . . . . . 540
§ 1. Das Genießen als originäre Wertgegebenheit und seine Mo-
dalitäten. Antizipationen des Gefühls: das Fühlen als Be-
wusstsein-von. Ist der konkrete Wert ein reines Vorstellungs-
gebilde und ist das Ich nur als gewahrendes aktiv? . . . . 540
§ 2. Die Frage nach den Gefühlsqualitäten . . . . . . . . . . 544

Nr. 58. Die Wertapperzeption als Konstitution des vorgegebenen


Wertgegenstandes. Das Verhältnis von Aktivität und Passivi-
tät bei der Wertkonstitution. Unterschiedliche Wertschich-
ten. Das Auswerten als Leistung des Intellekts gegenüber
den Gefühlsbegründungen . . . . . . . . . . . . . . . . 547

Nr. 59. Sachliche und axiologische Eigenschaften . . . . . . . 550

Nr. 60. Wertprädikate als nicht-relationelle Prädikate. Der


Unterschied der Wertprädikate von den doxischen Modali-
täten . . . . . . . . . . . . . . . . . . . . . . . . . . . 551
TEILBAND III

WILLE UND HANDLUNG

i
die handlung als willentlicher vorgang

§ 1. Die Phasen der Handlung: schöpferische Willenshandlung


und physischer Folgeablauf . . . . . . . . . . . . . . . 1
§ 2. Einheit und Vielheit des Willens: Ziel und Weg. Mechanische
und „achtsame“ Handlungen. Entschluss und Handlung 5
§ 3. Ist das setzende fiat in einer anschaulichen Vorstellung des
gewollten Vorgangs fundiert? . . . . . . . . . . . . . . 13
§ 4. Die anschauliche Erwartung von Vorgängen. Allgemeine
Analyse des Erinnerungs- und Erwartungsbewusstsein . . 15
§ 5. Empirisch und willentlich motivierte Erwartungen . . . . 20

ii
das wesen des schlichten handelns

§ 1. Das in Wahrnehmung fundierte Wollen als Handeln und das


Wollen als fiat. Die Willenskontinuität in jeder Phase der
Handlung . . . . . . . . . . . . . . . . . . . . . . . 23
§ 2. Voluntäre Form und Materie. Die stetige Erfüllung der lee-
ren Willensintention durch das kreative Wollen . . . . . . 27

iii
unterschiede in der willensmeinung

§ 1. Der Wille im Vorsatz, im Entschluss und im handelnden Tun 33


§ 2. Einfache und zusammengesetzte Handlungen. Weg und
Ziel . . . . . . . . . . . . . . . . . . . . . . . . . 38
§ 3. Mittel und Zweck . . . . . . . . . . . . . . . . . . . 43
inhalt teilband iii xxxvii

iv
willenskausation und physische kausation

§ 1. Wille und Handlung. Handlung und Hemmung . . . . . . 47


§ 2. Das Wollen als Ablauf in der immanenten Sphäre ist kein
Naturvorgang . . . . . . . . . . . . . . . . . . . . . 48
§ 3. Die Abhängigkeit der Bewusstseinsinhalte vom Leib. Me-
chanische Naturkausalität und funktionale psychophysische
Beziehungen . . . . . . . . . . . . . . . . . . . . . 50
§ 4. Inwieweit ist das Hervorgehen der Tat aus dem Willen als ein
Abhängigkeitsverhältnis zwischen Tatsachen zu bestimmen? 54

v
naturkausalität und willenskausalität.
zur analyse der primären
schöpferischen handlung 59

vi
passivität und spontaneität im
doxischen gebiet und im willensgebiet

§ 1. Wollen, Trieb, Tendenz, ichliche Zuwendung und die Paral-


lelen im Urteilsgebiet . . . . . . . . . . . . . . . . . 67
§ 2. Die Bedeutung des Zeithorizontes für die Handlung . . . 72
§ 3. Ob alles spezifisch Logische aus der Sphäre der Spontaneität
stammt. Tendenzen, die vor aller willentlichen Zuwendung
des Ich liegen . . . . . . . . . . . . . . . . . . . . . 75
§ 4. Trieb als Wille einer tieferen Stufe . . . . . . . . . . . 80
xxxviii inhalt teilband iii

vii
praktische möglichkeiten und praktischer
bereich. die modi willentlichen geschehens

§ 1. Praktische Möglichkeiten als reine und als reale. Die Be-


grenzung meines Tunkönnens in einem empirischen Mög-
lichkeitsbereich. Das personale Ichliche und der seelische
Naturuntergrund . . . . . . . . . . . . . . . . . . . 87
§ 2. Die Frage nach der Freiheit kinästhetischer Verläufe. Das
bloß außerwillentliche, sachliche Geschehen gegenüber dem
willentlichen Geschehen. Im willentlichen Bereich die Schei-
dung des willkürlichen vom unwillkürlichen Tun . . . . . 92

viii
das bewusstsein des „ich kann“ als
voraussetzung jeder willensthesis.
die konstitution von willenswegen
und tätigkeitsfeldern aus
unwillkürlichen ichtätigkeiten 99

ix
die entwicklung „praktischer
apperzeptionen“ (des willens).
doxische und praktische affektion

§ 1. Attentionale Affektion als Trieb zur Zuwendung und prak-


tische Affektion. Die Auswirkung der praktischen Affektion
als praktische Rezeptivität . . . . . . . . . . . . . . . 109
§ 2. Praktische gegenüber theoretischer Möglichkeit. Das „Ich
tue“ als Urmodus des Willens. Das „Ich kann“ als eine
Modalität des „Ich will“ . . . . . . . . . . . . . . . . 112
§ 3. Die Affektion in der doxischen Sphäre und ihre Parallele
in der Praxis. Die Frage nach dem Verhältnis des Nicht-
Primitiven zum Primitiven in der praktischen Sphäre . . . 114
§ 4. Zuwendung als Übergang in ein cogito in allen Aktsphären.
Tendenz und Ichstreben als Modi jeden Bewusstseins. Die
assoziativ-praktische Antizipation, ichloses Tun und das Ur-
wollen . . . . . . . . . . . . . . . . . . . . . . . . 116
inhalt teilband iii xxxix

x
zur willensanalyse: das wirken des ich als
inneres und äusseres tun und erzeugen.
die aus dem vollzug von stellungnahmen
erwachsenden idealen bestimmungen des ich

§ 1. Bleibende Hexis als ideale Eigenheit des Ich. Veränderung


des Ich durch Veränderung seiner Überzeugungen. Das Sich-
selbst-treu-Bleiben. Das Ich in beständiger Entwicklung
durch Vollzug neuer Stellungnahmen . . . . . . . . . . 121
§ 2. Weltapperzeption als Habitus. Affektion und Zuwendung.
Ich-Tendenz als Hingerissenwerden des Ich und das sich
im realisierenden Tun erfüllende Ich-Streben. Jeder Gegen-
stand als habitueller Besitz aus „Erzeugung“ . . . . . . . 125
§ 3. Das äußere Erzeugen von Werken. Das Werk als bleibendes
Sein einer bleibenden Absicht. Der erledigte und der preis-
gegebene Wille. Willensgesinnung und wertende Gesinnung.
Der auf eine Idee und ihre realisierende Selbstgebung gerich-
tete Wille . . . . . . . . . . . . . . . . . . . . . . . 129
§ 4. Erkenntniswerte und -werke. Das theoretische Interesse als
Interesse am Optimum der Fülle . . . . . . . . . . . . 133
§ 5. Passivität des Ich – „mechanisch“ hingezogen von Reizen,
„mechanisch“ genießend – gegenüber freier Stellungnahme
im aktiven Glauben, Werten und Tun. Urteilswahrheit, Wer-
tewahrheit und Willenswahrheit . . . . . . . . . . . . 135
§ 6. Freie Ich-Akte als Aktualisierungen und Stiftungen von Ge-
sinnungen. Aktives Streben als Vernunftstreben auf Evidenz
der Wahrheit im weitesten Sinn gerichtet. Jeder Akt des Ich
als seine bleibende Bestimmung, solange er nicht durch neue
Akte entwurzelt wird . . . . . . . . . . . . . . . . . 138
§ 7. Das Wirken des Ich auf andere Subjekte durch soziale Akte.
Die Person als ein Ich, das mit anderen Ich in Willensge-
meinschaft steht. Personale Liebe . . . . . . . . . . . . 140
xl inhalt teilband iii

xi
vorstellen, denken und handeln

§ 1. Willentliche Erzeugung von Vergegenwärtigungen und von


Gedanken. Mechanisches Rechnen. Das auf reales Dasein
gerichtete Realisieren gegenüber dem Erzeugen von Ur-
bildern. Die Erzeugung im Kenntnis nehmenden Erfahren
eines äußeren Gegenstandes gegenüber dem Erzeugen des
darstellenden Erlebnisses . . . . . . . . . . . . . . . 145
§ 2. Das Denken als Handeln mit dem praktischen Ziel der Wahr-
heit. Das Streben nach Evidenz. Die Logik als Wissenschaft
von der praktischen Vernunft im Erkenntnishandeln . . . 151

xii
das allgemeine des strebens und
seine verschiedenen richtungen

§ 1. Das wertende Verhalten in der Erkenntnis und das wertende


Verhalten im Begehren. Sind objektivierendes und werten-
des Bewusstsein gegensätzliche Aktklassen? . . . . . . . 157
§ 2. Affektion durch den Wert. Das theoretische Interesse und
der Eigenwert der Erkenntnis. Die zwei Strebenssysteme.
Streben nach Erkenntnis und Streben nach Realisierung des
Gegenstandes um seines Wertes willen . . . . . . . . . 161

xiii
zur lehre von der intentionalität im hinblick
auf die genesis der weltkonstitution.
der strebenscharakter des aktlebens

§ 1. Das nicht durch einen Glauben motivierte, uninteressierte


Gefallen am Schönen gegenüber dem Gefallen am Wesen
als Seienden . . . . . . . . . . . . . . . . . . . . . 173
§ 2. Werte als im fühlend-wertenden Bewusstsein konstituierte
Einheiten. Der Wert als Seinsthema . . . . . . . . . . . 177
inhalt teilband iii xli

§ 3. Stellungnehmende Akte als eigentliche Ichakte und ihre


passiven Vorformen. Das erfahrend Gerichtetsein als eine
Strebenstendenz gerichtet auf die Realisierung des Seienden
in seinem Seinsgehalt. Der Willensmodus des Urteilens . . 181

Beilage I. Seiendes als erworbene Habe und Korrelat einer habitu-


ellen Zugangspraxis . . . . . . . . . . . . . . . . . . . . 185

Beilage II. Wahres Sein und wahrer Wert. Wert und Stimmung. Die
auf die ganze Lebenszukunft bezogene Stimmung: Lebensgefühl
und Lebenssorge . . . . . . . . . . . . . . . . . . . . . . 186

Beilage III. Die Vorfreude als eine Gefühlsantizipation und ihre Er-
füllung im Genuss. Der im Genuss selbsterfühlte Wert . . . . . 190

ERGÄNZENDE TEXTE

a
neigung, vermutung, anmutung, zweifel im
urteilsgebiet und in der sphäre des gemüts

Nr. 1. Vernunft und Neigung. Urteilsneigung . . . . . . . . . 195

Nr. 2. Anmutung als Neigung zu Vermutung oder Glaube. Ur-


teilsneigung und Urteilshandlung . . . . . . . . . . . . 200

Nr. 3. Anmutung und Vermutung. Blinde und durch Gewicht


verleihende Motive begründete Annahmen . . . . . . . . . 203

Nr. 4. Urteilsneigung und Vermutung, Frage, Zweifel . . . . . 213

Nr. 5. Begründung in der Sphäre der emotionalen Akte. Schwan-


ken und Entscheidung. Die mit dem Urteil verbundene Wert-
intention und ihre Erfüllung durch die Einsicht . . . . . . 221

Nr. 6. Aktmotivation, Neigung und Tendenz. Das Willentliche in


allen Akten . . . . . . . . . . . . . . . . . . . . . . . 226
xlii inhalt teilband iii

Nr. 7. Die Willensrichtung auf Wahrheit. Denken als eine Tätig-


keit . . . . . . . . . . . . . . . . . . . . . . . . . . . . 240

b
zur phänomenologie des
wollens und der handlung

Nr. 8. Analysen zur Triebhandlung, zu unterschiedlichen Fäl-


len des einem Trieb Folgeleistens sowie zum freien und un-
freien Wollen . . . . . . . . . . . . . . . . . . . . . . . 245

Nr. 9. Zusammenstellung der Unterscheidungen bei der Analyse


der Handlung . . . . . . . . . . . . . . . . . . . . . . . 251

Nr. 10. Das Gefallen aufgrund der Vorstellung als Grundlage


des Wunsches. Das Verhältnis von Wunsch und Wille . . . 253

Nr. 11. Die parallele Unterscheidung zwischen Anmutung, Ur-


teilsneigung und Urteilsentscheidung einerseits sowie
Wunsch, Willensneigung und Willensentscheidung anderer-
seits . . . . . . . . . . . . . . . . . . . . . . . . . . . 256

Nr. 12. Inwieweit das fiat die Vorstellung der Handlung vor-
aussetzt . . . . . . . . . . . . . . . . . . . . . . . . . 262

Nr. 13. Das fiat als praktische Zustimmung und das Willensmo-
ment in der Ansatzphase der Handlung . . . . . . . . . . 264

Nr. 14. Fiat und Vorsatz . . . . . . . . . . . . . . . . . . . 266

Nr. 15. Aufmerksamkeit und Wille, theoretisches und prakti-


sches Interesse . . . . . . . . . . . . . . . . . . . . . . 268

Nr. 16. Willensintention und ihre Erfüllung als Realisierung.


Verworrenheit und Klarheit im Wollen . . . . . . . . . . 271

Nr. 17. Der Unterschied zwischen Gefühlsprädikaten und dem


Charakter der Willentlichkeit . . . . . . . . . . . . . . 273
inhalt teilband iii xliii

Nr. 18. Das Willensvorkommnis des Widerstandes und seiner


Überwindung. Geht der Wille bei der Leibesbewegung nicht
primär auf die Schicht der subjektiven Empfindungen? . . . 278

Nr. 19. Empirische Motivation und Willensmotivation. Erwar-


tung als Komponente des Willens . . . . . . . . . . . . . 281

Beilage IV. Gibt es eigene Erwartungsphänomene in der Gemüts-


und Willenssphäre? . . . . . . . . . . . . . . . . . . . . . 285

Nr. 20. Analogien zwischen Urteil und Wille . . . . . . . . . 287


§ 1. Der vielfache Sinn der hypothetischen Rede und der hypo-
thetische Wille . . . . . . . . . . . . . . . . . . . . 287
§ 2. Affirmation und Negation beim Urteil und beim Willen . . 291

c
zur lehre von der tendenz und ihrer
auswirkung: die spannung der erwartung und
aufmerksamkeit, theoretisches interesse,
tendenz und erfüllung, tendenz und wille

Nr. 21. Der unterschiedliche Charakter der Erscheinungswei-


sen bei gegebenen Dingen und bei der Erzeugung einer Ob-
jektveränderung. Aufmerksamkeit auf das Erscheinende und
Vollzug der Stellungnahme. Der Seinscharakter vor der Ak-
tualisierung der Stellungnahme . . . . . . . . . . . . . . 297

Nr. 22. Zur Abgrenzung von Tendenz und Wille. Ist das Tendie-
ren ein Willensmodus? . . . . . . . . . . . . . . . . . . 304

Nr. 23. Tendenz als „Form“ der Akte. Die Doppelseitigkeit der
Intentionalität: Tendenz und Bewusstsein-von. Die zum inne-
ren Bewusstsein gehörende Tendenz gegenüber dem Begeh-
ren und Wollen als Tendieren auf eine Freude . . . . . . . 308

Nr. 24. Tendenz und Aufmerksamkeit. Im Akt leben. Das Inter-


esse. Vollzug intentionaler Erlebnisse . . . . . . . . . . 312
xliv inhalt teilband iii

Nr. 25. Ist Glauben in analogem Sinn Intention wie Tendenz und
Begehren? Das Verhältnis von Bekräftigung und Erfüllung.
Intention als Stellungnahme und als Tendenz . . . . . . . 315

Nr. 26. Die Spannung der Erwartung gegenüber der Spannung


der Aufmerksamkeit. Die zur Aufmerksamkeit gehörenden
Tendenzen . . . . . . . . . . . . . . . . . . . . . . . . 319

Beilage V. Attentionale Wandlungen . . . . . . . . . . . . . . 327

Beilage VI. Zur Spannung und Entspannung bei Erwartung und Auf-
merksamkeit. Die Erwartung als vorerinnernde Aufmerksamkeit.
Quasi-Erwartung und Quasi-Aufmerksamkeit in der Phantasie 328

Beilage VII. Die Intensität der Aufmerksamkeit . . . . . . . . . 331

Nr. 27. Die Erfüllung von Intentionen gegenüber der Entspan-


nung von Tendenzen . . . . . . . . . . . . . . . . . . . 333

Nr. 28. Aufmerksamkeit als Zuwendung und als Tendenz. Die


vom Gegenstand ausgehenden Tendenzen zur Betrachtung
und Tendenzen auf Explikation und synthetische Setzung 335

Nr. 29. Theoretisches Interesse als Tendenz zur Betrachtung.


Ist Interesse am Gegenstand ein Gefühl? . . . . . . . . . . 338

Nr. 30. Passivität und Aktivität im Begehren und Wollen. Die zum
Begehren und Wollen gehörenden Tendenzen . . . . . . . 341

Nr. 31. Der Trieb als ursprüngliches Willensphänomen. Der Wi-


derstand gegen den Trieb als Willensenttäuschung . . . . 346

Nr. 32. Wille und Trieb. Triebe als sich von innen her auswir-
kende Kräfte gegenüber Wunsch- und Begehrungsintentio-
nen . . . . . . . . . . . . . . . . . . . . . . . . . . . . 347

Nr. 33. Die Tendenz auf Vollzug eines Aktes und ihre Auswir-
kung in der Sättigung gegenüber dem Begehren . . . . . . 349
inhalt teilband iii xlv

Nr. 34. Implikation der Doxa. Die Vorzugsstellung der objekti-


vierenden Akte . . . . . . . . . . . . . . . . . . . . . . 355

Nr. 35. Verschiedene Begriffe von Aufmerksamkeit und Mei-


nung. Tendenz, in ein Meinen überzugehen, und Tendenz im
Meinen . . . . . . . . . . . . . . . . . . . . . . . . . . 360

Nr. 36. Zuwendung zum Gegenstand um seiner selbst willen und


um des Gefühls willen. Das willkürliche Verfolgen eines
theoretischen Interesses um seiner selbst willen und als Mit-
tel. Das durch die „Lust am Bemerken“ motivierte theoreti-
sche Interesse . . . . . . . . . . . . . . . . . . . . . . . 362

Beilage VIII. Freude an der Forschung, Freude an der Erkenntnis.


Aufmerksamkeit und theoretisches Interesse . . . . . . . . . 369

Beilage IX. Doppelsinn des cogito. Das Im-Griff-Behalten während


der Ablenkung . . . . . . . . . . . . . . . . . . . . . . . 372

Nr. 37. Bejahung in der Willenssphäre und in allen Aktsphären 374

Nr. 38. Tendenz und cogito. Aufmerksamkeit als Spannung . . . 376

Nr. 39. Tendenzen auf Klärung und auf Berechtigung . . . . . 378

Nr. 40. Tendenzen und tätige Verläufe in der ichlosen Wahrneh-


mung und im „Ich tue“ . . . . . . . . . . . . . . . . . . . 383

Nr. 41. Intention und Erfüllung. Die Erwartung und ihre Ge-
fühlsspannung. Der Unterschied zwischen statischen und ki-
netischen Intentionen . . . . . . . . . . . . . . . . . . . 387

d
phänomenologie der willensaffirmation
und -negation, modalitäten des wollens

Nr. 42. Die Schwierigkeiten der Willensanalyse. Passivität, Re-


zeptivität und Spontaneität in der doxischen Sphäre. Reiz und
Zuwendung . . . . . . . . . . . . . . . . . . . . . . . . 391
xlvi inhalt teilband iii

Nr. 43. Sollensbewusstsein in der Willenssphäre. Gibt es ein ei-


genes Sollensbewusstsein in der Urteilssphäre? . . . . . . 397

Nr. 44. Auf Vergangenes gerichtete Wünsche. Das Verhältnis


von Begehren und Wollen . . . . . . . . . . . . . . . . . 399

Nr. 45. Willensanmutung gegenüber dem Bewusstsein prakti-


scher Möglichkeit. Die Erfassung von Handlungen. Das aus
dem Wollen entquellende Gewiss-Sein . . . . . . . . . . . 401

Beilage X. Wie steht eine Handlung als praktische Möglichkeit vor


Augen? . . . . . . . . . . . . . . . . . . . . . . . . . . 406

Nr. 46. Das willkürliche Eingreifen in ein von selbst ablaufen-


des triebmäßiges Geschehen am Beispiel des Atmens: Hem-
mung, Beschleunigung und Verlangsamung. Die Frage nach
dem Verhältnis von Wille und Tendenz . . . . . . . . . . 408

Nr. 47. Unbestimmter, zielloser gegenüber zielgerichtetem


Trieb. Triebbetätigung gegenüber Willkürtätigkeit. Das Ver-
hältnis des Begehrens zur Schicht der tätigen Impulse in der
Kontinuität des Tuns . . . . . . . . . . . . . . . . . . . 415

Nr. 48. Schlichtes Wollen und Entschluss. Triebwille und


triebhaftes Tun . . . . . . . . . . . . . . . . . . . . . . 419

Nr. 49. Liegt in jedem eigentlichen Wollen ein Werten? Tenden-


zen und Gegentendenzen: das passive Folgen gegenüber dem
wollenden Bevorzugen . . . . . . . . . . . . . . . . . . 422

Nr. 50. Die Frage nach dem Wert des blinden, aber richtigen
Urteilens. Die Idee göttlicher Erkenntnis. Der Unterschied
zwischen Erfüllung und Berechtigung in der Glaubens- und
Willenssphäre . . . . . . . . . . . . . . . . . . . . . . 424

Nr. 51. Die Bewertung des Urteilens im Hinblick auf seine durch
prinzipielle Einsicht ausgewiesene Richtigkeit. Das Werten
gegenüber dem existenzial interessierten Gemütsverhalten.
Die Stiftung des ethischen Gewissens und Charakters durch
den ethischen Grundwillen . . . . . . . . . . . . . . . . 430
inhalt teilband iii xlvii

Nr. 52. Der ursprüngliche Wille in Hemmung und Förderung von


kinästhetischen Verläufen . . . . . . . . . . . . . . . . 437

Nr. 53. Unmittelbares Tun gegenüber willkürlichem Tun als se-


kundärem Tun, dem eine als Reiz fungierende Vorstellung
vorausgeht. Die Erfahrung der Hemmung als Vernunftmotiv
für eine Willensverneinung . . . . . . . . . . . . . . . . 440

Beilage XI. Wie geht der Wille auf die Handlung? . . . . . . . . 442

Nr. 54. Die Objektivität der Natur und die Voraus-Bestimmtheit


des Erfahrungsverlaufs. Die apriorischen Voraussetzungen
einer Willensthesis. Die Auszeichnung von idealen Möglich-
keiten des Wollens als praktische Möglichkeiten nach be-
stimmten Erfahrungsthesen . . . . . . . . . . . . . . . . 444

e
modi des strebens, formen der affektion und
freie ichakte. hemmung und modalisierung

Nr. 55. Die Erfüllungsgestalten des positiven und negativen


Strebens. Spannungszustände und ihre Lösung. Prozesse der
Lustabnahme, Lusterhaltung und Luststeigerung und das da-
mit verbundene positive und negative Streben . . . . . . . . 451

Nr. 56. Der Trieb und seine Modi. Die Realisierung als Triebmo-
dus ist keine Stellungnahme. Der Entschluss als praktisches
Ja oder Nein zu einem praktischen Anschlag als das eigentli-
che fiat. Entschluss und eigentliche Handlung . . . . . . 456

Nr. 57. Überlegung. Zum Unterschied zwischen Triebgefühlen


und Wertgefühlen . . . . . . . . . . . . . . . . . . . . 459

Nr. 58. Rationales Handeln gegenüber Handeln aus Neigung.


Rationale wertnehmende Liebe und ihre Kraft. Willens-
schwäche: das für das Gute gelähmte Willens-Ich . . . . . 460

Nr. 59. Das Streben nach Lust. Das Haben und das Genießen der
Lust . . . . . . . . . . . . . . . . . . . . . . . . . . . 462
xlviii inhalt teilband iii

Nr. 60. Die Wesenstypen des dumpfen und wachen Lebens. Instink-
tive und freie Akte. Leben als unaufhörliches Streben. Hin-
und Wegstreben – die Fülleformen der Lust und Unlust . . 464

Nr. 61. Der Trieb in der Gestalt des Ichstrebens gegenüber „me-
chanisch“ ablaufenden tendenziösen Verläufen. Die Hem-
mung eines Strebensverlaufs durch einen Widerstand. Die
Frage nach der Bedeutung der Widerstandserfahrung für die
Konstitution einer Dingwelt . . . . . . . . . . . . . . . . 467

Nr. 62. Das Streben nach Selbsterhaltung als Streben nach


Lust. Positives Hin- und negatives Wegstreben. Konkurrenz
der Strebungen. Spontanes und affektives Tun . . . . . . . 473

Nr. 63. Die Neugier als Trieb zur Kenntnisnahme gegenüber dem
allgemeinen Trieb zur Zuwendung. Die Neugier im Verhältnis
zu anderen Gefühlen und ihrer Motivkraft. Phänomenologi-
sche Unterschiede zwischen Neuem und Bekanntem . . . . 476

Nr. 64. Erkennen als zielgerichtete Tätigkeit. Das durch das ver-
meinende Werten im Gefühl hindurchgehende Streben. Ein
Ding als Gut in Bezug auf die Möglichkeit des Besitzes und
der genießenden Wertrealisierung. Die Verflechtung der
Bewusstseinsfunktionen . . . . . . . . . . . . . . . . . . 482

Nr. 65. Freiheit und „Ichakt“. Freie Entscheidung aufgrund


freier Überlegung. Entscheidungen unter Zwang. Die Frei-
heit der Vernunft: Entscheidung auf Grund einer Überle-
gung, die auf Wahrheit abzielt . . . . . . . . . . . . . . . 487

Beilage XII. Der zur Rezeptivität gehörende Streit der Apperzep-


tionen. Das aktive Annehmen und das aktive Wahrnehmen als
Ich-Tun . . . . . . . . . . . . . . . . . . . . . . . . . . 490

Nr. 66. Die Freude an der Erkenntnis. Das unendliche Reich der
mathematischen Erkenntnis als eine eigene praktische Güter-
welt. Deren methodische Beherrschbarkeit als eine eigene
praktische Vernunft und ein erstes Bild eines rationalen
Lebens . . . . . . . . . . . . . . . . . . . . . . . . . . 493
inhalt teilband iii xlix

Nr. 67. Affektion und Attention als Modi des Gegenstandsbe-


wusstseins. Streben als allgemeine Modalität des Bewusst-
seins. Hintergrundaffektion und attentionale Affektion: vor-
attentionales und attentionales Streben . . . . . . . . . . 499

Nr. 68. Praktische Affektion . . . . . . . . . . . . . . . . . 505

Nr. 69. Der Gegenstand in der Hingabe und im Interesse. Freie


Stellungnahme und Entscheidung. Das Streben nach Einstim-
migkeit durch Überwindung der Hemmungen. Die Modi des
Strebens . . . . . . . . . . . . . . . . . . . . . . . . . 511

Nr. 70. Das „Ich kann“. Hemmung als praktische Negation. Die
Durchstreichung des fiat bei einer unüberwindlichen Hem-
mung. Die Modalisierung des Tuns und Könnens bei einer
vorübergehenden Hemmung . . . . . . . . . . . . . . . . 517

Nr. 71. Erfahrung als kontinuierliche Identifikation im aktiven


Streben. Das wiederholende Durchlaufen im „Ich kann“. Die
Modalisierung der Geltung. Der Erkenntniswille . . . . . 520

Nr. 72. Das strebende Gerichtetsein des Ich auf bleibende Stel-
lungnahmen. Geltungsmodalisierungen als Hemmungen des
Ich und Störungen in seinem habituellen Sein . . . . . . . 524

Nr. 73. Freier Wille, freies Können und Willenshemmung. Phan-


tasieabwandlungen von Willensmöglichkeiten in Bezug auf
die wirkliche Situation unter Einschluss meiner geltenden
Motive und Interessen . . . . . . . . . . . . . . . . . . . 529

Nr. 74. Wahrnehmungsanalyse der Handlung . . . . . . . . . 533


TEILBAND IV

TEXTKRITISCHER ANHANG

Zur Textgestaltung . . . . . . . . . . . . . . . . . . . . . . 1

Beschreibung der Konvolute . . . . . . . . . . . . . . . . . 7

Textkritische Anmerkungen zu Teilband I . . . . . . . . . . . 47

Textkritische Anmerkungen zu Teilband II . . . . . . . . . . . 167

Textkritische Anmerkungen zu Teilband III . . . . . . . . . . 269

Zeittafel der Manuskripte . . . . . . . . . . . . . . . . . . 361

Nachweis der Originalseiten und Angaben zur Rekonstruktion 369

Nachweis der Originalseiten und Angaben zur Rekonstruktion


Teilband I . . . . . . . . . . . . . . . . . . . . . . . . . 371

Nachweis der Originalseiten und Angaben zur Rekonstruktion


Teilband II . . . . . . . . . . . . . . . . . . . . . . . . 429

Nachweis der Originalseiten und Angaben zur Rekonstruktion


Teilband III . . . . . . . . . . . . . . . . . . . . . . . . 485

Namenregister . . . . . . . . . . . . . . . . . . . . . . . . 537
EINLEITUNG

Wohl im unmittelbaren Anschluss an seine Promotion im März


1927 begann Ludwig Landgrebe im Auftrag von Husserl eine große
Anzahl von dessen stenographischen Manuskripten mit intentio-
nal-analytischen Untersuchungen zusammenzustellen, um auf der
Grundlage dieser Zusammenstellung ein umfangreiches, in drei Ab-
schnitte gegliedertes Typoskript mit dem Titel „Studien zur Struktur
des Bewusstseins“ anzufertigen.1 Die vorliegende Edition bringt die
diesem Typoskript zugrundeliegenden Manuskripte weitgehend voll-
ständig zur Veröffentlichung. Weitere, von Landgrebe nicht berück-
sichtigte Manuskripte zur konkreten Bewusstseinsforschung wurden
hinzugefügt, um auf diese Weise Husserls bewusstseinsanalytische
Forschungsarbeit umfassend zu dokumentieren.
Im Folgenden soll zunächst Husserls phänomenologische Bewusst-
seinsforschung in ihrer Eigenart, in ihren wichtigsten Ausgangspunk-
ten, in ihrem Verhältnis zur Philosophie und in ihrem Forschungscha-
rakter sowie ihre Entwicklung kurz charakterisiert werden. Im darauf
folgenden Abschnitt der Einleitung wird dann das als Ausgangspunkt
der Edition dienende Typoskript von Landgrebe näher beschrieben,
sein Entstehungskontext beleuchtet und über Husserls Beschäftigung
mit dem Typoskript berichtet. Im dritten Abschnitt wird der Aufbau
und die Gliederung der Edition erläutert. Zum Abschluss werden im
vierten Abschnitt als Hilfe zur Orientierung einige Hinweise auf den
Inhalt und die sachliche Bedeutung der Texte in den drei Teilbänden
gegeben.

Das Bewusstsein ist für Husserl ein Feld konkreter deskriptiver


Forschung, in der es zunächst gilt, die Bewusstseinsphänomene zu
klassifizieren, um sie dann in ihren konkreten Strukturen, ihren Fun-

1 Siehe hierzu Landgrebes im Textkritischen Anhang (Husserliana XLIII/4, S. 9 f.)

wiedergegebene Skizze seines Lebenslaufs.


lii einleitung

dierungsverhältnissen, Implikationen und Modifikationsweisen, ih-


ren synthetischen Zusammenhängen, ihren zeitlichen Verlaufs- und
Einheitsformen und ihren Motivationsweisen in genauer analytischer
Deskription zu erfassen. Diese Deskription hat auf der Grundlage
einer methodisch gegen alle naturalistische Verfälschung gesicherten
rein immanenten Erfahrung zu erfolgen mit dem Ziel, das Eigenwe-
sen des Bewusstseins in einer rein phänomenologischen Forschung
im vollen Reichtum seiner Phänomene zu bestimmen.
Husserls phänomenologische Bewusstseinsforschung erwächst aus
einer kritischen Aneignung und Auseinandersetzung mit der deskrip-
tiven Psychologie Brentanos, wobei drei Lehrstücke von grundlegen-
der Bedeutung für Husserls eigene Forschung sind: erstens die Lehre
von der Intentionalität als definierende Eigenschaft der psychischen
Phänomene, d. h. der intentionalen Erlebnisse, zweitens die Klassi-
fikation der intentionalen Erlebnisse in Vorstellungen, Urteile und
die nicht-kognitiven Akte des Fühlens und Wollens und drittens die
mit dieser Klassifikation verbundene These von der Vorstellungs-
grundlage aller Akte. Aus der Kritik an diesen Grundpfeilern von
Brentanos deskriptiver Psychologie entfaltet sich Husserls eigene Be-
wusstseinsforschung. Grundlegend für diese ist, dass Intentionalität
keine definierende Eigenschaft, sondern eine Leistung des Bewusst-
seins ist, zuunterst eine Auffassungsleistung, die nicht-intentionales
Empfindungsbewusstsein voraussetzt. Was die Klassifikation der in-
tentionalen Erlebnisse betrifft, so gehören für Husserl Vorstellungen
und Urteile gemeinsam in die Klasse der Verstandesakte und müs-
sen die Gemüts- und Willensakte in zwei verschiedene Aktklassen
aufgeteilt werden. Und schließlich muss Husserl zufolge der Vorstel-
lungsbegriff neu gefasst werden. Das reine setzungslose Vorstellen
Brentanos gibt es nur als ein abstraktes Aktmoment, nicht als einen
selbstständigen konkreten Akt. Diese kritischen Neubestimmungen
von Brentanos Intentionalitäts- und Vorstellungsbegriffs und von
dessen Klassifikation der Akte führen zu weiteren grundlegenden
Strukturierungen des Bewusstseinsfeldes. Von fundamentaler Bedeu-
tung für Husserls Bewusstseinsforschung ist hierbei die zunächst bei
den Verstandesakten getroffene Unterscheidung zwischen sinnlichen
und kategorialen Akten, für die Husserl dann versucht, Analoga in
den beiden anderen Aktklassen zu finden, was ihn schließlich zu der
für alle Aktklassen geltenden allgemeinen Unterscheidung zwischen
einleitung liii

Passivität und Aktivität führt. Die genaue Beschreibung und Diffe-


renzierung passiver Vollzüge und Leistungen in ihrem Unterschied
und Verhältnis zu den aktiven, im eigentlichen Sinn schöpferischen
Leistungen des Bewusstseins, die Beschreibung der Übergangsfor-
men, wie passives Geschehen in aktives Leisten übergehen kann
oder durch aktives Leisten angeeignet wird und wie aktives Leisten
zurück in passives Geschehen versinkt, dies wird zu einer Haupt-
aufgabe der Bewusstseinsforschung in allen Aktsphären. Was das
aktive Bewusstsein betrifft, so gilt es dem Unterschied zwischen einer
Aktivität der Rezeption in Weisen der Zuwendung, des Erfassens und
Aufmerkens und einer im eigentlichen Sinn schöpferischen Aktivität
im Denken, Entscheiden und Handeln Rechnung zu tragen. Ebenso
gibt es in der Passivität Abstufungen des „mehr oder weniger“, mit
der untersten Stufe der vollkommenen Passivität des inneren Zeitbe-
wusstseins.
Das Bewusstsein ist eine vielfältig und vielschichtig verflochtene
Einheit. Die grundlegenden Weisen wie Bewusstsein mit Bewusstsein
verbunden ist, sind die Fundierung, die intentionale Implikation und
die Synthesis, desweiteren passive und aktive Weisen der Motiva-
tion. Dies sind dementsprechend weitere wichtige Titel für Husserls
Bewusstseinsforschungen.
Wie weit Husserl in seinen Bewusstseinsforschungen auch über
Brentanos deskriptive Psychologie hinausgegangen ist, wieviel reich-
haltiger und detaillierter sie im Vergleich zu Brentanos Beschrei-
bungen sind, alle noch so subtilen deskriptiven Befunde Husserls
ordnen sich derselben dualen Polarität unter, die schon Brentanos
Bewusstseinsbegriff kennzeichnet, der Dualität von Vorstellung und
Stellungnahme bzw. Gegebenheit und Stellungnahme: Etwas ist dem
Bewusstsein gegeben, zu dem es bzw. das Ich dieses Bewusstseins sich
stellungnehmend verhält. Diese Gegebenheit allerdings erweist sich
in Husserls phänomenologischer Forschung als Resultat einer mehr
oder weniger komplexen und hochstufigen Leistung in Form von
passiven oder aktiven Vollzügen eben dieses Bewusstseins, und die
Stellungnahme selbst erzeugt ihrerseits neue Gegebenheit für neue
Stellungnahmen.
Die phänomenologische Philosophie als absolute Wissenschaft
gründet ihre Wissenschaftlichkeit auf phänomenologische Bewusst-
seinsforschung, die in ihrer Reinheit durch die phänomenologische
liv einleitung

Methode gesichert ist. Diese Reinheit bezieht sich in erster Linie


auf die Abwehr jeglicher Naturalisierung des Bewusstseins, d. h. der
Leugnung seines Eigenwesens. Sie bezieht sich aber auch auf die
Fernhaltung von Vorurteilen aus der philosophischen Tradition und
selbst von philosophischen Interessen, die zu einer selektiven Steue-
rung der Aufmerksamkeit führen könnten. Dies heißt, das die phäno-
menologische Forschung zunächst unbekümmert um philosophische
Interessen durchzuführen ist, dass also gerade im Hinblick auf die
Grundlegung einer letztwissenschaftlichen Philosophie die Philoso-
phie einzuklammern ist.
Der Forschungscharakter der phänomenologischen Forschung be-
steht in der geduldigen, um höchste Genauigkeit bemühten, sachge-
treuen Beschreibungsarbeit der in der phänomenologischen Erfah-
rung gegebenen Phänomene, den Erlebnissen in ihren unterschied-
lichen Vollzugsweisen, Synthesen und Motivationseinheiten. Dass es
sich hierbei um eidetische Beschreibungen handeln soll, die das Ei-
genwesen des Bewusstseins im vollen Reichtum seiner konkreten Be-
stimmungen entfalten, berührt nicht den mühevollen Arbeitscharak-
ter der phänomenologischen Forschung. Wo auf den ersten Blick alles
irgendwie ineinander zu fließen scheint und sich höchstens ganz grobe
und vage Unterscheidungen treffen lassen, eröffnet sich bei tieferem
Eindringen ein ungeahnter Reichtum an Formen, Differenzierungen
und Verflechtungen. Dieser Reichtum erschließt sich nicht auf einen
Blick, sondern nur schrittweise durch eine beständige Schärfung des
analytischen Blickes, eines immer genaueren Hinsehens, und einer
entsprechenden Präzisierung der Beschreibungen. Vermeintlich ge-
sicherte Ergebnisse müssen somit immer wieder an den Phänomenen
selbst neu überprüft werden, die Beschreibungsbegriffe müssen be-
ständig neu entdeckten Unterschieden und Bestimmungen angepasst
werden.

Husserls phänomenologische Forschung entwickelte sich zuerst


im Zusammenhang mit der erkenntnistheoretischen Grundlegung
der formalen Wissenschaften, von Logik und Mathematik. Sie war
deswegen zunächst weitgehend beschränkt auf die Verstandessphäre,
die Vorstellungs- und Denkakte. In der V. und VI. Logischen Unter-
einleitung lv

suchung finden sich die für Husserls weitere Bewusstseinsforschung


grundlegenden Bestimmungen und Unterscheidungen zwischen Ma-
terie und Qualität eines intentionalen Aktes, zwischen Auffassungsin-
halt, Auffassungssinn und Auffassungsform, zwischen anschaulichen
und leeren Akten, zwischen objektivierenden und nicht-objektivie-
renden Akten, zwischen sinnlichen und kategorialen Akten. Am Leit-
faden dieser Bestimmungen und Unterscheidungen konzentriert sich
Husserls Bewusstseinsforschung nach dem Erscheinen der Logischen
Untersuchungen vor allem auf die sinnlichen Anschauungen – die
Wahrnehmung als Gegenwärtigung und die verschiedenen Weisen
der Vergegenwärtigung in Form von Erinnerung, Erwartung, Phan-
tasie und Bildbewusstsein – und die Denkakte, in erster Linie das
Urteilen, sowie das allem Bewusstsein zugrundeliegende innere Zeit-
bewusstsein. Im Zusammenhang mit Vorlesungen zur Axiologie und
Ethik in den Jahren 1902 sowie in den Jahren 1908/09 bis 1914 wendet
Husserl sich dann auch in zahlreichen Forschungsmanuskripten der
Erforschung des Gemüts- und Willensbewusstseins zu.
Der größte Teil der in der vorliegenden Edition herausgegebenen
Manuskripte stammt aus den Jahren 1909 bis 1914. Husserl hat, wie
die zahlreichen Manuskripte zeigen, in diesen Jahren offensichtlich
eine große Anstrengung unternommen, um den neuen Kontinent, den
er glaubte, entdeckt zu haben, nämlich das reine Bewusstsein, nicht
nur in seinen allgemeinsten Strukturen und Formen zu bestimmen,
sondern auch in seinen spezifischen Phänomenen in ihrer verwirren-
den Vielfalt und Verflochtenheit zu analysieren und so genau wie
möglich zu beschreiben. Neben umfangreicheren Ausführungen fin-
den sich viele nur wenige Manuskriptblätter umfassende Detailana-
lysen. Viele dieser Manuskripte wurden von Husserl zu thematischen
Konvoluten mit einer bestimmten Signatur zusammengefasst. Einem
dieser Konvolute hat Husserl den Titel „Struktur des Bewusstseins“
gegeben.1
Husserls bewusstseinsanalytische Forschung in diesen Jahren dien-
te dem Projekt einer umfassenden phänomenologischen Kritik der
theoretischen, axiologischen und praktischen Vernunft.2 Der phäno-
menologische Charakter einer solchen Vernunftkritik besteht in der

1 Siehe hierzu den Textkritischen Anhang (in Husserliana XLIII/4, S. 17 u. 365).


2 Zu diesem Projekt einer phänomenologischen Kritik der Vernunft siehe die
lvi einleitung

deskriptiven Analyse der jeweiligen intentionalen Akte und ihrer


Aktstrukturen sowie den intentionalen Gegenständen dieser Akte,
wobei vor allem die unterschiedlichen Weisen des Evidenzbewusst-
sein in den verschiedenen Aktsphären aufzuklären sind.1
Wie zahlreiche, in die vorliegende Edition aufgenommene For-
schungsmanuskripte zeigen, hat Husserl seine intentional-analytische
Forschungsarbeit auch in den zwanziger und dreißiger Jahren fortge-
setzt. Das von Landgrebe 1927 angefertigte Typoskript sollte wohl
Husserl als Vorlage für eine Publikation eines großen Teils seiner
bewusstseinsanalytischen Untersuchungen dienen.

Ludwig Landgrebe war von 1923 bis 1930 Husserls Privatassistent.2


Nachdem er in den ersten Jahren seiner Tätigkeit mit der Abschrift
von einzelnen Manuskripten beauftragt wurde, übertrug ihm Husserl
ungefähr von 1926 an die Aufgabe, um Forschungsmanuskripte zu
größeren Abhandlungen zusammen zu fügen, die Husserl nach ei-
ner Überarbeitung vermutlich im Jahrbuch für phänomenologische
Forschung zu veröffentlichten beabsichtigte. Landgrebe stellte drei
umfangreiche Typoskripte her, wovon zwei noch im Nachlass erhalten
sind: das Typoskript der „Studien zur Struktur des Bewusstseins“
sowie ein Typoskript mit dem Titel „Gegenstand und Sinn“. Nicht
mehr im Nachlass erhalten ist das dritte von Landgrebe hergestellte
Typoskript, das den Titel „Logische Studien“ trug und das nach
mehrfacher Um- und Überarbeitung durch Husserl schließlich von
Landgrebe nach Husserls Tod im Jahr 1939 unter dem Titel Erfahrung
und Urteil veröffentlicht wurde.

„Einleitung des Herausgebers“ in: Edmund Husserl, Vorlesungen über Ethik und
Wertlehre, 1908–1914, hrsg. von Ullrich Melle, Husserliana XXVIII, Kluwer, Dordrecht,
1988, S. XX–XXIII.
1 Siehe hierzu das zweite Kapitel über die „Phänomenologie der Vernunft“ im

vierten Abschnitt der Ideen zu einer reinen Phänomenologie und phänomenologischen


Philosophie. Erstes Buch: Allgemeine Einführung in die reine Phänomenologie, neu
hrsg. von Karl Schuhmann, Husserliana III/1, Martinus Nijhoff, The Hague, 1976,
S. 314–337.
2 Siehe Karl Schuhmann, Husserl-Chronik. Denk- und Lebensweg Edmund Husserls.

Husserliana Dokumente I Martinus Nijhoff, Den Haag, 1977, S. 273.


einleitung lvii

Leider lässt sich über die konkreten Anlässe für diese Arbeiten
Landgrebes, über ihre genaue Datierung und ihren Verlauf nichts
Gesichertes sagen. Das Typoskript der „Studien zur Struktur des
Bewusstseins“ dürfte größtenteils 1927 entstanden sein. Husserl ver-
fasste dazu im Sommer 1927 einen fragmentarischen Einleitungsent-
wurf.1 Angesichts des Umfangs des Textes und der Zahl der verwende-
ten Manuskripte ist es nicht unwahrscheinlich, dass Landgrebe bereits
1926 mit der vorbereitenden Arbeit der Lektüre und Anordnung der
Manuskripte begann.
Das Typoskript ist in drei „Studien“ mit den Titeln „Aktivität und
Passivität“, „Wertapperzeption, Gemüt, Wille“ und „Modalität und
Tendenz“ unterteilt. Diese Gliederung entspricht nicht der Dreiglie-
derung der Bewusstseinssphären. Die Analysen zu Gemüt und Wille
sind in der zweiten Studie zusammengefasst, wobei allerdings die Un-
tersuchung der „Tendenz“, die Husserl gewöhnlich als grundlegende
Form der Willenspassivität gilt, zusammen mit der Untersuchung der
Modalitäten die dritte Studie bildet.2 Da die sachliche Zusammen-
gehörigkeit von „Modalität und Tendenz“ in der dritten Studie im
Typoskript nicht verdeutlicht wird, weist diese Studie einen eher he-
terogenen Charakter auf. Die erste Studie beruht auf Manuskripten,
die in der vorliegenden Edition im ersten Teilband, vor allem im
ersten Teil, wiedergegeben werden.
Wieweit Landgrebe bei der Gliederung des Typoskripts und bei
der Weise, wie die Manuskripte zusammengefügt wurden, Vorgaben
Husserls folgte und wie diese Vorgaben aussahen, ist nicht bekannt.
In unmittelbarer zeitlicher Nähe, möglicherweise vor dem Typo-
skript der „Studien zur Struktur des Bewusstseins“ dürfte das Typo-
skript „Gegenstand und Sinn“ entstanden sein.3 Dieses Typoskript
kann als komplementäre Ergänzung zu den „Studien zur Struktur

1 Siehe Text Nr. 27 im vorliegenden Teilband, S. 469.


2 Der erste den Modalitäten gewidmete Abschnitt der dritten Studie besteht zum
größten Teil aus dem für die Umarbeitung der VI. Logischen Untersuchung im Som-
mer 1913 neu verfassten Kapitel über das Möglichkeitsbewusstsein, siehe Edmund
Husserl, Logische Untersuchungen. Ergänzungsband. Erster Teil. Entwürfe zur Um-
arbeitung der VI. Untersuchung und zur Vorrede für die Neuauflage der Logischen
Untersuchungen (Sommer 1913), hrsg. von Ullrich Melle, Husserliana XX/1, Kluwer,
Dordrecht/Boston/London, 2002, S. 171–230.
3 Ein Teil des Typoskripts (M III 3 IV 1–2) liegt in einem Briefumschlag, der auf den

22. April 1926 datiert ist; siehe Husserl Chronik, Husserliana Dokumente I, S. 304.
lviii einleitung

des Bewusstseins“ betrachtet werden, in größter Vereinfachung aus-


gedrückt: als die Noematik zur Noetik der „Studien“.
Das dritte, nur noch in seiner vielfach überarbeiteten Fassung von
Erfahrung und Urteil erhaltene Typoskript der „Logischen Studien“,
beruhte auf dem Manuskript der Vorlesung über „Transzendentale
Logik“ von 1920/21 und aus Manuskripten aus dem Umkreis dieser
Vorlesung. Wie die erste „Studie“ behandelte es die Verhältnisse
zwischen Passivität, Rezeptivität und Aktivität, zwischen Sinnlich-
keit und Verstand, jetzt aber auf dem methodischen Niveau der
genetischen Phänomenologie und im Hinblick auf das Projekt ei-
ner transzendentalen Logik. Dem entspricht auch die folgende Auf-
schrift von Landgrebe auf dem Titelblatt einer Dublette der ersten
„Studie“: „größtenteils veraltet, das Wesentliche verwendet in der
Ausarbeitung der Urteilstheorie“1 – „Urteilstheorie“ meint hier die
„Logischen Studien“. Eine ähnliche Aufschrift findet sich auch auf
dem Titelblatt der Dublette des Typoskripts von „Gegenstand und
Sinn“: „größtenteils verwendet in der Ausarbeitung der Urteilstheo-
rie, zum Teil erledigt durch die ‚Formale und transzendentale Lo-
gik‘.“2 Diesen Aufschriften folgend, könnte man die erste „Studie“
über Passivität und Aktivität bei den Verstandesakten und das Typo-
skript „Gegenstand und Sinn“ in ihrer Einheit auch als einen frühen
Entwurf der transzendentalen Logik auffassen. Die erste „Studie“
würde aber damit nicht mehr nur als Präsentation von Befunden
einer noch vor- und unphilosophischen, rein phänomenologischen
Bewusstseinsforschung gelten, sondern sie würde bereits eine am phi-
losophischen Interesse der Grundlegung der Logik orientierte Aus-
wertung und Systematisierung der Ergebnisse solcher Forschung dar-
stellen. Letzteres widerspricht jedoch Husserls eigenen Ausführun-
gen im fragmentarischen Entwurf einer Einleitung zu Landgrebes Ty-
poskript der „Studien“. Er will, wie es dort heißt, in den Untersuchun-
gen der „Studien“ alles Philosophische außer Spiel lassen, es soll sich
bei diesen Untersuchungen demnach um eine „sozusagen unphilo-
sophische Phänomenologie“ handeln.3 Eine solche unphilosophische
Phänomenologie ist aber nichts anderes als eine rein phänomenolo-

1 M III 3 I 1 I, 1.
2 M III 3 IV 2, 1.
3 Siehe vorliegenden Teilband, S. 469.
einleitung lix

gische, intentional-analytische Bewusstseinsforschung im Sinne einer


phänomenologischen Psychologie, von Husserl auch reine oder in-
tentionale Psychologie genannt.
Zur gleichen Zeit, in der Husserl sich mit dem Typoskript beschäf-
tigte, im Sommer und Herbst 1927, arbeitete er unter der Mitarbeit
von Martin Heidegger intensiv am Artikel für die Encyclopedia Bri-
tannica über die transzendentale Phänomenologie.1 Der erste Teil
dieses Artikels ist der Ausarbeitung der Idee einer rein phänomeno-
logischen Psychologie gewidmet. Das Problem der Konzeption und
methodischen Grundlegung einer das Eigenwesentliche des Bewusst-
seins erforschenden reinen Psychologie bzw. reinen Phänomenologie
hat Husserl in den letzten Jahren seiner Lehrtätigkeit von 1925 bis
1928 intensiv beschäftigt. Im Sommersemester 1925, im Winterse-
mester 1926/27 und im Sommersemester 1928 hat er drei Vorlesungen
über phänomenologische bzw. intentionale Psychologie gehalten, und
im April 1928 hat er in Amsterdam und Groningen auf der Grund-
lage des Artikels für die Encyclopedia Britannica viel beachtete Vor-
träge zu diesem Thema gehalten.2 Einer eidetischen Psychologie bzw.
Phänomenologie des reinen Bewusstseins kam Husserl zufolge eine
dreifache Schlüsselstellung im philosophischen Begründungszusam-
menhang der Wissenschaften zu: für die Reform der Psychologie, für
die Grundlegung der Geisteswissenschaften und für die Hinführung
zur transzendentalen Phänomenologie als absoluter philosophischer
Grundwissenschaft.
Dass die „Studien“ als eine zusammenfassende Darstellung von
Husserls eigener konkreter phänomenologischer bzw. rein psycho-
logischer Bewusstseinsforschung zu verstehen sind, kommt in einem
Brief von Heidegger an Husserl vom 22. Oktober 1927 zum Ausdruck.
Sich auf eine Bemerkung Husserls, dass es bis jetzt noch keine reine
Psychologie gäbe, beziehend, schreibt Heidegger: „Nun, die wesentli-
chen Stücke liegen in den drei Abschnitten des von Landgrebe getipp-
ten Ms. Diese Untersuchungen müssen zuerst erscheinen und zwar
aus zwei Gründen: 1. Dass man die konkreten Untersuchungen vor

1 Siehe hierzu Edmund Husserl, Phänomenologische Psychologie, hrsg. von Walter

Biemel, Husserliana IX, Martinus Nijhoff, Den Haag, 1962, S. 590.


2 Die Vorlesung von 1925, Teile der Vorlesungen von 1926/27 und 1928, die verschie-

denen Fassung des Artikels für die Encyclopedia Britannica sowie die Amsterdamer
Vorträge sind in Husserliana IX herausgegeben.
lx einleitung

Augen hat und nicht als versprochene Programme vergeblich sucht.


2. Dass Sie selbst Luft bekommen für eine grundsätzliche Exposition
der transzendentalen Problematik.“1
Wie die Bezeichnung „Studien“ im Titel jedoch angibt, wird nicht
der Anspruch erhoben, eine systematisch ausgearbeitete und voll-
ständige phänomenologische Psychologie vorzulegen, sondern Un-
tersuchungsergebnisse konkreter Bewusstseinsforschung zu bieten,
die durchaus offen sind für Weiterführungen, Präzisierungen und Kor-
rekturen. Die von Landgrebe benutzten Manuskripte haben selbst
einen ausgesprochenen Forschungscharakter, sie können als Pro-
tokolle konkret durchgeführter phänomenologischer Analysen von
bestimmten Bewusstseinsphänomenen, von Akt- und Vollzugsfor-
men, Fundierungsverhältnissen, Synthesen etc. angesehen werden.
Die Beschreibungen der Phänomene, vor allem die des fühlend-
wertenden und wollend-handelnden Bewusstseins, haben vielfach
einen explorativen und probierenden Charakter. Die Terminologie
ist nicht fixiert. Landgrebes Versuch, aus der Vielzahl von solchen
Forschungsmanuskripten einen kohärenten Text zu erstellen, konnte
deswegen auch nur bedingt gelingen. Das durch ihn angefertigte Ty-
poskript ist nicht frei von Brüchen, terminologischen Verschiebungen
und Inkonsequenzen.
Was die Beschäftigung Husserls mit dem Typoskript von Land-
grebe, betrifft, so beschränkt diese sich weitgehend auf die erste
„Studie“. Schon der Entwurf der Einleitung vom August 1927 bricht
nach Ausführungen zur ersten Studie ab. Nur Teile der ersten „Stu-
die“ hat Husserl intensiv in Form von Annotationen, stilistischen
und terminologischen Veränderungen und Streichungen überarbei-
tet. Auf einigen dem Typoskript eingelegten Manuskriptblättern fin-
den sich ergänzende Ausführungen. Im Nachlass konnten noch einige
kleinere Texte, die sich auf die erste Studie beziehen bzw. durch diese
angeregt sind, gefunden werden. Diese Texte kommen zusammen
mit dem Entwurf der Einleitung und einer von Landgrebe verfassten
„Disposition der I. Studie“ im fünften Teil des ersten Teilbandes der
vorliegenden Edition zum Abdruck.

1 Edmund Husserl, Briefwechsel. Band IV: Die Freiburger Schüler, in Verbindung


mit Elisabeth Schuhmann hrsg. von Karl Schuhmann, Husserliana Dokumente III,
Band IV, Kluwer, Dordrecht/Boston/London, 1994, S. 145.
einleitung lxi

Das Typoskript der zweiten „Studie“ weist nur noch wenige Be-
arbeitungsspuren Husserls auf, das Typoskript der dritten „Studie“
überhaupt keine mehr. Über die Gründe für die Konzentration auf
die erste „Studie“ lässt sich nur mutmaßen, da hierzu wie auch zur
Gesamtbeurteilung des Typoskripts keine Äußerungen von Husserl
vorliegen.

Da die Manuskripte, die Landgrebe seinem Typoskript zugrunde-


gelegt hat, alle im Nachlass erhalten sind und mit Hilfe der Angaben
im Typoskript rekonstruiert und datiert werden konnten, war es mög-
lich, diese Manuskripte unabhängig von der Weise, wie Landgrebe sie
in seinem Typoskript verwendet hat, zu edieren. Die mit Hilfe des Ty-
poskripts identifizierten und rekonstruierten Manuskripte werden in
der vorliegenden Edition vollständig wiedergegeben, und sie werden
durch weitere, thematisch dazugehörige intentional-analytische For-
schungsmanuskripte aus dem Nachlass ergänzt, um auf diese Weise
Husserls konkrete Forschungsarbeit auf dem durch ihn selbst ent-
deckten und methodisch gesicherten Gebiet der rein phänomeno-
logischen bzw. rein psychologischen Bewusstseinsforschung umfas-
send zu dokumentieren. Dabei werden Husserls Forschungsmanu-
skripte über die Aktstrukturen und Vollzugsformen in den nicht-
intellektiven Bewusstseinssphären, über Gefühlsempfindungen, ge-
fühlsmäßige Werterfahrungen, emotionale Reaktionen, Stim-
mungen, über das Wünschen, über die Willensformen und die passi-
ven Untergründe von Fühlen und Wollen im Begehren, in Trieb und
Tendenz nahezu vollständig wiedergegeben. Diese bisher weitgehend
unbekannten Untersuchungen Husserls zum Gemüts- und Willensbe-
wusstsein kommen im zweiten und dritten Teilband der vorliegenden
Edition zur Veröffentlichung.
Husserls Bewusstseinsforschung war ohne Zweifel vor- und über-
wiegend der Bewusstseinssphäre des Verstandes, d. h. den intellekti-
ven Bewusstseinsphänomenen, gewidmet. Die beiden wichtigsten in-
tellektiven Akte sind für Husserl die sinnliche Wahrnehmung und das
Urteilen. Durch die Analyse ihrer Aktstrukturen, ihrer intentionalen
Leistungen und ihres Fundierungsverhältnisses gewinnt Husserl die
Leitfäden für seine gesamte Bewusstseinsforschung. Die im ersten
lxii einleitung

Teilband veröffentlichten Forschungsmanuskripte enthalten ausführ-


liche Analysen allgemeiner Strukturen der Verstandesakte wie das
Meinen, die Synthesen und das Stellungnehmen mit ihren jeweiligen
Formen, Modi und Grundlagen.
Die insgesamt 277 Texte der vorliegenden Edition bilden ein weit-
verzweigtes und verschlungenes, oft schwer entwirrbares Geflecht
von phänomenologischen Analysen und Beschreibungen, von denen
die frühesten bis in die Zeit vor den Logischen Untersuchungen zu-
rückreichen, die spätesten aus der Mitte der dreißiger Jahren stam-
men. Die hauptsächliche Entstehungszeit fällt in die Jahre von 1909
bis 1914 und in geringerem Umfang in die erste Hälfte der zwanziger
Jahre. Was die Anordnung der Texte betrifft, so wurden diese zu-
nächst in drei thematische Gruppen, die den drei von Husserl unter-
schiedenen Bewusstseinssphären bzw. Aktklassen der intellektiven
Phänomene sowie der Gemüts- und Willensphänomene entsprechen,
aufgeteilt.
Verstand, Gemüt und Wille sind für Husserl keine Vermögen, son-
dern Bewusstseinssphären oder Aktklassen; es sind die Grundweisen
der intentionalen Gegenstands- und Weltbezogenheit des Bewusst-
seins: das vorstellend-denkende, fühlend-wertende und wollend-han-
delnde intentionale Bewusstsein. Diese Grundarten der Intentio-
nalität bestehen nicht getrennt von einander, sondern sind in der
konkreten Ganzheit des Bewusstseins in der Vielzahl ihrer Phä-
nomene auf vielfältige und komplexe Weise aufeinander bezogen,
miteinander verflochten und wechselseitig motiviert. Die Phänomene
der verschiedenen Sphären weisen auch zahlreiche strukturelle Ähn-
lichkeiten und Übereinstimmungen auf. Dies hat zur Folge, dass
die Analysen in vielen Texten sich nicht nur auf Phänomene einer
einzigen Bewusstseinssphäre beschränken, sondern dass die Unter-
suchung sich auch auf Phänomene einer anderen Sphäre erstreckt,
sei es vergleichend und analogisierend oder sei es kontrastierend,
oder sei es um Fundierungs- und Motivationsverhältnisse zwischen
den Phänomenen verschiedener Sphären zu bestimmen. In einigen
Fällen hätte so Manuskripte auch in einen anderen als den ihnen hier
zugewiesenen Teilband aufgenommen werden können.
In jedem der drei Teilbände wurden die Texte im Prinzip chronolo-
gisch angeordnet. In einigen Fälle wurde von dieser chronologischen
Anordnung jedoch abgewichen. Dies geschah vor allem, um die durch
einleitung lxiii

Husserls Paginierung in den von ihm zu größeren Konvoluten zusam-


mengefassten Manuskripte bezeichnete Reihenfolge der betreffen-
den Manuskripte zu beachten. Da die Datierung einer Reihe von
Manuskripten nur auf Vermutungen beruht, die sich auf mehr oder
weniger starke Indizien stützen, ist die chronologische Anordnung
auch nicht immer gesichert. Innerhalb der einzelnen Teilbände wurde
versucht, mit Hilfe der in den Husserliana üblichen Gliederungsfor-
men und unterschiedenen Textsorten eine gewisse Übersichtlichkeit
zu schaffen. Der erste Teilband mit dem Titel „Verstand und Ge-
genstand“ ist in fünf Teile mit arabisch nummerierten Texten, denen
römisch nummerierte Beilagen hinzugefügt sein können, gegliedert.
Der zweite Teilband mit dem Titel „Gefühl und Wert“ und der
dritte Teilband mit dem Titel „Wille und Handlung“ sind jeweils
in einen Teil mit einer beschränkten Anzahl von römisch numme-
rierten Haupttexten und einen Teil mit einer größeren Anzahl von
arabisch nummerierten Ergänzenden Texten gegliedert. Sowohl den
Haupttexten wie den Ergänzenden Texten können ebenfalls römisch
nummerierte Beilagen zugeordnet sein.1
Was den ersten Teilband betrifft, so sind die ersten drei Teile in
diesem Band jeweils einem wesentlichen Strukturmoment intellekti-
ver Akte gewidmet: dem intentionalen Gerichtetsein, der Synthesis
und der Stellungnahme. Der vierte, thematisch eher heterogene Teil
befasst vier umfangreichere Texte mit sechs Beilagen aus der ersten
Hälfte der zwanziger Jahre. Es handelt sich um bewusstseinsanaly-
tische Studien zu Aspekten, die in den vorangehenden Teilen an
verschiedenen Stellen behandelt wurden. Eine Ausnahme bildet al-
lerdings der Text Nr. 25, bei dem es sich um eine Untersuchung des
Sprechens und Verstehens handelt. Das Ausdrücken, Aussagen und

1 Dass den Haupttexten Beilagen zugeordnet werden, diese Beilagen aber nicht

unter den Ergänzenden Texten aufgeführt werden, sondern direkt zu den betreffenden
Haupttexten gestellt sind, während die unter den Ergänzenden Texten aufgeführten
Texte selbst wiederum Beilagen zugeordnet haben können, widerspricht allerdings der
bisherigen Praxis in den Husserliana. Die Herausgeber haben sich trotz der Merk-
würdigkeit, dass es auf diese Weise Beilagen gibt, die keine Ergänzenden Texte sind,
für die Beibehaltung der bisher üblichen Bezeichnungen „Beilagen“ und „Ergänzende
Texte“ entschieden. Dasselbe gilt für die Beibehaltung der in den Husserliana üblichen
römischen Nummerierung der Beilagen, obwohl dies bei Beilagen zu Haupttexten zu
einer doppelten römischen Nummerierung der Texte führt.
lxiv einleitung

Verstehen werden in den Texten der vorliegenden Edition ansonsten


nur am Rande behandelt.1 Der fünfte Teil des ersten Teilbandes
schließlich befasst die Manuskripte zu Landgrebes Typoskript der
„Studien zur Struktur des Bewusstseins“.
Was den zweiten und dritten Teilband betrifft, so wurden als
Haupttexte Manuskripte auf Grund ihres Umfangs und ihres sach-
lichen Gewichts ausgewählt. Bei den Ergänzenden Texten handelt
es sich um Manuskripte, die meistens nur wenige Blätter, manchmal
sogar nur ein einzelnes Blatt umfassen und die häufig in besonde-
rem Maße den Prozess lebendiger Forschung wiedergeben. Bei der
Anordnung dieser Ergänzenden Texte wurde der oben erwähnten
Zusammenlegung von Manuskripten zu größeren Konvoluten Rech-
nung getragen. Im zweiten Teilband ergeben sich so vier, im dritten
Teilband fünf Gruppen von Ergänzenden Texten, die mit Ausnahme
der letzten Textgruppe im dritten Teilband den von Husserl selbst
zusammengestellten Konvoluten entsprechen.

Abschließend sei noch kurz auf den Inhalt und die sachliche Be-
deutung der Texte der jeweiligen Teilbände und die systematischen
Zusammenhänge, in denen sie stehen, eingegangen.
Der Schwerpunkt des ersten Teilbandes mit dem Titel „Verstand
und Gegenstand“ sind die in den drei ersten Teilen wiedergegebenen
Texte, die bis auf zwei Texte mit ihren Beilagen aus den Jahren 1910
bis 1912 stammen. Alle Texte in den ersten beiden Teilen lassen
sich, mit Ausnahme des um „allgemeine Unterscheidungen“ und
„Grundarten von Akten“ bemühten ersten Textes, der phänome-
nologischen Urteilstheorie, die das wichtigste Fundament für die
phänomenologische Kritik der theoretischen Vernunft ist, zuordnen.
Im Mittelpunkt steht die Frage der Objektivation einerseits in der
Sphäre der Rezeptivität, des schlichten Erfassens, und andrerseits

1 Der Text Nr. 25 wäre sachlich den Texten zur Umarbeitung der VI. Logischen

Untersuchung aus dem Winter und Frühjahr 1914 zuzuordnen. Siehe Edmund Husserl,
Logische Untersuchungen. Ergänzungsband. Zweiter Teil. Texte für die Neufassung der
VI. Untersuchung. Zur Phänomenologie des Ausdrucks und der Erkenntnis (1893/94–
1921), hrsg. von Ullrich Melle, Husserliana XX/2, Springer, Dordrecht, 2005.
einleitung lxv

in der höheren Form der schöpferisch-spontanen Erzeugung auf der


Grundlage der „Akzeptionen“. Besondere Aufmerksamkeit gilt hier-
bei den Vollzugsweisen des Urteilens und dem Verhältnis von Rezep-
tivität und eigentlich schöpferischer Urteilsleistung in der prädikati-
ven Synthesis. Die Analysen des Meinens als des gegenständlichen
Gerichtetseins im prägnanten Sinn sowie des thematischen und un-
thematischen Bewusstseins in den Texten Nr. 4 bis Nr. 6 des ersten
Teils, die alle aus dem Frühjahr 1911 stammen, sind unter anderem
von Interesse für die Genese und die Interpretation des in den nur
ein Jahr später verfassten Ideen I eingeführten Begriffs des Noemas.
Die umfangreichen Texte des zweiten Teils untersuchen die vor-
prädikative Erfassung und Explikation von Gegenständen in ihrem
Verhältnis zu den kategorialen Denksynthesen und Denkformen. Ein
wichtiges Thema in Husserls Analysen ist der Unterschied zwischen
eigenschaftlicher Explikation und beziehender Bestimmung als Teil
eines Ganzen. Diese Analysen werden in den Texten Nr. 14 und
Nr. 15 zu einer umfassenden phänomenologischen Relationstheorie
erweitert.
Das Verhältnis von Setzung bzw. Stellungnahme – Husserl spricht
auch von „Axiose“ – und Substrat der Setzung bzw. Stellungnahme
wird in den Texten des dritten Teils, die in unmittelbarer zeitlicher
Nähe zur Niederschrift der Ideen I entstanden sind, ausführlichen
Analysen unterworfen. Der Bezugspunkt und Hintergrund dieser
Analysen ist die Unterscheidung von Materie und Qualität sowie
die kritische Auseinandersetzung mit Brentanos Satz von der Vor-
stellungsgrundlage aller Akte in der V. Logischen Untersuchung. Es
geht Husserl in diesen Analysen zum einen um die richtige Konfigu-
ration der Grundbestimmungen der Intentionalität: der Erscheinung
bzw. Vorstellung, der Zuwendung, Erfassung und Aufmerksamkeit
auf den Erscheinungsgegenstand sowie der doxischen und paralle-
len Charakterisierungen des Erscheinenden und Vorgestellten. Zum
anderen sucht er die Arten, den Aufbau, die Verflochtenheit, die
Vollzugsweisen und die Modifikationen der Stellungnahmen zu be-
schreiben. Besonderes Interesse gilt hierbei der anaxiotischen, d. h.
gedankenhaften, Modifikation, dem neutralen Bewusstsein. Es stellt
sich diesbezüglich die Frage, ob es sich bei der Anaxiose um den
bloßen Nicht-Vollzug von Stellungnahmen handelt oder um einen
eigenen Akt des Sich-Denkens bzw. Sich-Hineindenkens.
lxvi einleitung

Die Texte in den ersten drei Teilen des ersten Teilbandes sind
wichtige Ergänzungen und Fortführungen zu den in anderen Bän-
den der Husserliana bereits veröffentlichten Analysen der sinnlichen
und kategorialen Akte. In erster Linie ist hierbei zu denken an den
Band XXIII über Phantasie, Bildbewusstsein Erinnerung,1 an den
Band XXXVIII über Wahrnehmung und Aufmerksamkeit,2 an den
Band XL zur Urteilstheorie3 und die in Band V der Husserliana.
Materialien veröffentlichte Vorlesung über Urteilstheorie von 1905,4
dann aber auch an die in den Bänden XI und XXXI unter den Titeln
Analysen zur passiven Synthesis und Aktive Synthesen veröffentlichte
Vorlesung über „Transzendentale Logik“ aus dem Jahr 1920/21 bzw.
1923 und 1925/26.5 Diese Vorlesung wurde die Hauptgrundlage für die
als Erfahrung und Urteil veröffentlichten „Logischen Studien“. Die
im vierten Teil des ersten Teilbandes veröffentlichten Texte dürften
wohl aus dem Umkreis dieser Vorlesung stammen. Ganz sicher gilt
dies für Text Nr. 26. Die große sachliche Nähe vieler hier in den ersten
drei Teilen veröffentlichten Texte aus den Jahren 1910 bis 1912 zu
Husserls genetischer Begründung der Logik in Erfahrung und Urteil
ist zweifelsohne einer der auffälligsten Befunde, der einmal mehr
die Kontinuität in der Entwicklung von Husserls Denken deutlich
werden lässt.
Sowohl Husserls als Text Nr. 27 im fünften Teil wiedergegebe-
ner Entwurf einer Einleitung zu Landgrebes Typoskript als auch
die in den darauf folgenden Beilagen XLIII bis XLVIII wieder-

1 Edmund Husserl, Phantasie, Bildbewusstsein, Erinnerung. Zur Phänomenologie

der anschaulichen Vergegenwärtigungen. Texte aus dem Nachlass (1898–1925), hrsg.


von Eduard Marbach, Martinus Nijhoff, The Hague/Boston/London, 1980.
2 Edmund Husserl, Wahrnehmung und Aufmerksamkeit. Texte aus dem Nachlass

(1893–1912), hrsg. von Thomas Vongehr und Regula Giuliani, Husserliana XXXVIII,
Springer, Dordrecht, 2004.
3 Edmund Husserl, Untersuchungen zur Urteilstheorie. Texte aus dem Nachlass

(1893–1918), hrsg. von Robin D. Rollinger, Husserliana XL, Springer, Dordrecht, 2009.
4 Edmund Husserl, Urteilstheorie. Vorlesung 1905, hrsg. von Elisabeth Schuhmann,

Husserliana Materialien V, Kluwer, Dordrecht/Boston/London, 2002.


5 Edmund Husserl, Analysen zur passiven Synthesis. Aus Vorlesungs- und For-

schungsmanuskripten 1918–1926, hrsg. von Margot Fleischer, Husserliana XI, Martinus


Nijhoff, Den Haag, 1966 und Edmund Husserl, Aktive Synthesen: Aus der Vorlesung
„Transzendentale Logik“ 1920/21. Ergänzungsband zu „Analysen zur passiven Syn-
thesis“, hrsg. von Roland Breeur, Husserliana XXXI, Kluwer, Dordrecht, 2000.
einleitung lxvii

gegebenen Manuskripte, die offensichtlich Vorarbeiten zu diesem


Entwurf waren, enthalten wichtige Ausführungen zu den metho-
dischen Problemen einer reinen Psychologie und zu den Grund-
strukturen der Intentionalität. Bemerkenswert ist, dass Husserl in
dieser späten Phase seiner Philosophie nochmals die kritische Aus-
einandersetzung mit den Grundbegriffen von Brentanos deskriptiver
Psychologie als Ausgangspunkt und Leitfaden seiner Überlegungen
nimmt. Besonders hinzuweisen ist in dieser Hinsicht auf die Beila-
gen XLIV und XLV. Der Text der Beilage XLIV enthält eine Kritik
an Brentanos Klassifikation der psychischen Phänomene. Husserl
zeigt, dass es bei einer solchen Klassifikation nicht um eine empirisch-
induktive Klassifikation als Analogon der naturhistorischen Klassifi-
kationen gehen kann. Im Text der Beilage XLV macht Husserl dann
geltend, dass die Erforschung der Erlebnisse als zeitliche Realitä-
ten, d. h. die reelle Analyse der Erlebnisse, zwar möglich, aber ein
ganz untergeordneter Gesichtspunkt für die Bewusstseinsforschung
ist. Das primäre wissenschaftliche Interesse hat der Analyse der
Funktionen der intentionalen Erlebnisse im ichlichen Leben zu gel-
ten.

Die im zweiten und dritten Teilband unter den Titeln „Gefühl


und Wert“ sowie „Wille und Handlung“ veröffentlichten Texte be-
fassen in größtmöglicher Vollständigkeit Husserls Anstrengungen,
um auch die Phänomene des Gemüts- und Willensbewusstseins (der
Gefühlsempfindungen, Gefühlsakte und Gefühlsaffekte, des Wün-
schens und des Wollens in Form des Wählens und Sich-Entschließens
sowie des die Handlung initierenden und ausführenden Wollens, des
unabsichtlichen Tuns und der passiven Tendenzen und Strebungen)
in ihrer intentionalen Leistung und ihren Vollzugsweisen deskriptiv
zu erforschen. In den bisherigen Bänden der Husserliana finden sich
nur verstreut an vereinzelten Stellen Hinweise auf und kurze Aus-
führungen zur Phänomenologie des Fühlens und Wollens. Selbst die
Husserls Vorlesungen zur Axiologie und Ethik gewidmeten Bände –
Band XXVIII mit Husserls Göttinger Vorlesungen zur Axiologie
und Ethik sowie Band XXXVII mit Husserls historisch orientierter
Freiburger Vorlesung zur Ethik von 1920 bzw. 1924 – enthalten nur
lxviii einleitung

Weniges von Husserls konkreter Forschungsarbeit an den Gemüts-


und Willensphänomenen.1
Husserls gemüts- und willensanalytische Untersuchungen entste-
hen zum größten Teil im Umkreis dieser Vorlesungen zur Axiologie
und Ethik, die von Husserl in Analogie zur Logik als apriorische
Prinzipienlehren der Vernunftgeltung im Werten und Wollen auf-
gefasst werden. Als solche bedürfen sie einer Begründung in einer
Phänomenologie der fühlend-wertenden und wollend-handelnden
Vernunft. Die phänomenologische Analyse der wertgebenden Ge-
fühlsakte und der Willenssetzungen muss zeigen, dass Wahrheit und
Vernunftgeltung nicht auf die theoretische Vernunft, auf das Urteilen
und Denken, beschränkt sind, sondern dass es eine auf die theoreti-
sche Einsicht irreduzible Gefühls- und Willenswahrheit gibt.
Die Grundvoraussetzung von Husserls phänomenologischer For-
schung ist die synthetische Einheit des Bewusstseins: Das Bewusstsein
ist kein ungeordnetes Chaos, kein zusammenhangloser Haufen hete-
rogener Phänomene. Diese synthetische Einheit differenziert sich in
die zeitliche Einheit des Bewusstseins, die strukturelle und motiva-
tionale Einheit und, was in Texten des dritten Teilbandes ausführlich
behandelt wird, die tendenziöse oder Strebenseinheit. Alle Bewusst-
seinsphänomene haben Teil an und fügen sich ein in diese Einheits-
formen und sind dadurch aufs Engste miteinander verflochten. Eine
solch enge Verflochtenheit setzt ein hohes Maß an struktureller Ho-
mogenität und Affinität der Phänomene voraus. Husserls Forschungs-
strategie im Gebiet der besonders schwer fassbaren Gemüts- und
Willensphänomene wird durch diese Voraussetzung geleitet, indem
er bei den Gemüts- und Willensphänomenen die Parallelen zu den
bei den intellektiven Phänomenen bereits vielfach aufgewiesenen
und gesicherten Strukturen zu fassen sucht. Dieser Forschungsan-
satz sieht sich konfrontiert mit der in den Logischen Untersuchungen
aufgeworfenen Grundfrage nach der Unterscheidung und dem Ver-
hältnis zwischen objektivierenden und nicht-objektivierenden Akten,
d. h. nach der Intentionalität und Konstitutionsleistung der Gemüts-
und Willensphänomene, nach ihren je spezifischen Objektivitäten.

1 In den „Vorlesungen über Grundfragen zur Ethik und Wertlehre“ von 1914 findet
sich ein Abschnitt zur Phänomenologie des Willens, in dem Husserl seine willensana-
lytischen Forschungen zusammenfasst. Siehe Husserliana XXVIII, S. 102–125.
einleitung lxix

Hierbei ergibt sich nun jedoch ein grundlegender Unterschied zwi-


schen Gemüt und Willen: Bestimmte Gemütsakte erfüllen eine ko-
gnitive Funktion, sie haben den Charakter eines nicht-intellektiven
Erkennens von spezifischen Gefühlsobjekten, den Werten. Husserl
parallelisiert den Akt ursprünglicher Wertgegebenheit terminolo-
gisch öfters mit dem sinnlichen Wahrnehmen und bezeichnet ihn als
Wertnehmen oder Wertnehmung. Es handelt sich hierbei um einen
Gefühlsakt, den Husserl in der Regel als „Gefallen“ bezeichnet. Die
spezifische Willensobjektivität demgegenüber ist die Handlung, ein
durch einen einleitenden Willensimpuls, das fiat, bewirkte und durch
einen Handlungswillen inszeniertes leibliches Verhalten. Das Wollen
ist fundiert in und motiviert durch ein wertendes Gefallen, aber es ist
offensichtlich nicht selbst ein gegenstandsgebender und erfassender
Akt. Das Wollen als spontaner Akt hat in Bezug auf das gewollte Ziel
und die Wahl des dazu geeigneten Mittels und selbst in Bezug auf
den Handlungsvollzug vielmehr den Charakter einer den doxischen
Setzungen analogen Willenssetzung in Form der Entscheidung, des
fiat und des Handlungswillens
Wie schon in den Beschreibungen des Meinens und der Zuwen-
dung, des Substratbewusstseins und der Stellungnahmen in den Tex-
ten des ersten Teilbandes spielen auch in den Analysen der Gemüts-
und Willensphänomene die Vollzugsweisen und damit verbunden das
Thema des Verhältnisses von Aktivität und Passivität eine wichtige
Rolle. Als Gemütspassivität werden in erster Linie die Gefühlsemp-
findungen wie Lust und Unlust aufgefasst, während die Willenspas-
sivität unter den Titeln Neigung, Trieb, Tendenz und Streben zum
Thema wird.

Was die Gemütsanalysen im zweiten Teilband betrifft, so steht


der Gefühlscharakters des Wertens, die originale Gegebenheit von
Werten in Gefühlen, im Mittelpunkt dieser Analysen. Das Problem,
mit dem Husserl hierbei ringt, ist die Frage, wie sich der Gefühlscha-
rakter mit einer Vorstellungsleistung des Fühlens vereinbaren lässt.
Husserl versucht, das wertgebende Fühlen nach Analogie mit dem
Wahrnehmen als eine Auffassung von Gefühlsempfindungen, als eine
Wertapperzeption, zu fassen. Dies impliziert jedoch eine weitgehende
lxx einleitung

Intellektualisierung der Werterfahrung, was Husserl dazu führt, um


zwischen den Wertapperzeptionen und den Gefühlsreaktionen auf
die erfahrenen Werte zu unterscheiden. Diese Gefühlsreaktionen
sind dann die eigentlichen Gefühlsaffekte, die sich nach ihrem Ablauf
zu Stimmungen ausweiten und als solche nachwirken können. Es
stellt sich dann allerdings die Frage nach der Intentionalität dieser
Gefühlsreaktionen und Stimmungen und damit nach ihrer konstitu-
tiven Leistung. Husserl spricht davon, dass sie Gegenstände in ein
bestimmtes Gefühlslicht tauchen und ihnen eine bestimmte Gefühls-
färbung verleihen.
Eine besondere Erwähnung verdienen die im zweiten Teilband in
der Gruppe A unter dem Titel „Wert und Billigung“ zusammenge-
fassten Texte. Unter diesen befinden sich die drei frühesten, noch aus
der Zeit vor dem Erscheinen der Logischen Untersuchungen stam-
menden Texte der vorliegenden Edition, wovon allerdings nur noch
der Text Nr. 1 in der ursprünglichen Niederschrift vorliegt. Die Texte
Nr. 2 – Nr. 5 sind nach Husserls eigenen Angaben umgearbeitete
und ergänzte Abschriften aus den Jahren 1907/08 bzw. 1909/10 von
vermutlich zwei Manuskripten, die vor 1900 entstanden sind. Wann
genau und in welchem Zusammenhang diese frühesten Texte entstan-
den sind, lässt sich nicht sicher sagen. Man könnte vermuten, dass sie
aus dem Umkreis der Vorlesung über „Ethik und Rechtsphilosophie“
aus dem Jahr 1897 stammen.1
Der Begriff der „Billigung“ verweist auf Humes Moralphiloso-
phie, mit der Husserl sich in seiner Vorlesung über Ethik von 1902
intensiv auseinander gesetzt hat. Im Wintersemester 1908/09 hat Hus-
serl, parallel zu seiner Vorlesung über „Grundprobleme der Ethik“,
zudem ein Seminar zu Humes Schrift Eine Untersuchung über die

1 Von dieser Vorlesung ist nur ein wenige Seiten umfassendes Fragment erhalten,

das als Ergänzender Text Nr. 1 in Husserliana XXVIII, S. 381–384 veröffentlicht ist.
Das Fragment liegt im Konvolut F I 20, in dem sich auch die als Ergänzende Texte
Nr. 2 und Nr. 3 in Husserliana XXVIII veröffentlichten Stücke aus Husserls Vorlesung
„Grundfragen der Ethik“ von 1902 befinden. Im ersten dieser Stücke setzt Husserl
sich kritisch mit Humes Moralphilosophie auseinander (siehe Husserliana XXVIII,
S. 384–402). Den Blättern mit dieser Hume-Kritik liegt eine kurze Zusammenfassung
von Humes Argumenten für eine Gefühlsmoral voran, die wohl dem Schriftbild nach
einige Jahre früher, also vor 1900, verfasst wurde (siehe hierzu Husserliana XXVIII,
S. 514).
einleitung lxxi

Prinzipien der Moral gegeben.1 Billigung bzw. Missbilligung sind die


moralischen Gefühle, in denen die Quelle der ethischen Unterschei-
dungen liegt. Die fundamentale Frage ist nun, so Husserl, ob „die
Gründung der Moral auf das Gefühl, genauer gesprochen, auf Ge-
mütstätigkeiten überhaupt die Dahingabe der strengen Allgemein-
gültigkeit oder allgemeinen Verbindlichkeit der ethischen Normen
zur notwendigen Folge hat?“2
Es geht Husserl in den Ergänzenden Texten Nr. 1–5 und Nr. 8 um
die Bestimmung der Gemütsevidenz in der Werterfahrung in Analo-
gie mit der Bestimmung der Urteilsevidenz. Im reflektiven Akt der
Billigung eines Aktes wird sowohl dessen Richtigkeit als auch dessen
Werthaftigkeit festgestellt und anerkannt, wobei diese Anerkennung
ein positives Gefühl, ein Gefallen, ist. In diesen Texten setzt Husserl
sich offensichtlich, ohne dies jedoch explizit zu benennen, mit Bren-
tanos Bestimmung der Gemüts- und Urteilsevidenz, vor allem auch
mit dessen Auffassung, dass die Begriffe von Wert und Wahrheit ihre
Quelle in einer inneren Anschauung von als richtig charakterisierten
Gemüts- und Urteilsakten haben, auseinander. Bemerkenswert ist,
dass der Akt der Billigung in Husserls übrigen Analysen der Gemüts-
phänomene und der Werterfahrung keine nennenswerte Rolle mehr
spielt.

Was nun den dritten Teilband betrifft, so sind die ersten drei,
aus den Jahren 1910 bis 1914 stammenden Haupttexte der Analyse
der verschiedenen Willensformen und Handlungsarten gewidmet.
Husserl unterscheidet zwischen drei wesentlich verschiedenen Wil-
lensformen: dem Entschlusswillen, dem fiat als dem eine Handlung
in Gang setzenden Willen und dem die Handlung tragenden und
ausführenden Willen. Was die Handlungen betrifft, so gilt es, die
schlichte Handlung von den zusammengesetzten Handlungen zu un-
terscheiden.
In den Haupttexten IV und V aus den Jahren 1909/10 setzt Hus-
serl sich mit dem Problem der Bestimmung des Unterschiedes und

1 Siehe Husserl-Chronik, Husserliana Dokumente I, S. 121.


2 Husserliana XXVIII, S. 390.
lxxii einleitung

des Verhältnisses zwischen Willens- und Naturkausalität auseinander.


Inwieweit ist schöpferisches Wollen und Handeln verträglich mit der
universalen kausalen Gesetzmäßigkeit der Natur? Die Weise, wie die
Handlung aus dem Wollen hervorgeht, ist nicht die der Verursachung
einer Tatsache durch eine andere, davon getrennte Tatsache, auch
wenn das Wollen nicht notwendig in die gewollte Handlung übergeht;
das Wollen kann an seiner Ausführung in der Handlung gehemmt
werden.
Man kommt Husserl zufolge zu „schiefen Problemen“, wenn man
nicht sieht, dass es unterschiedliche Formen von Kausalität gibt. Nur
die naturwissenschaftlich-physikalische Kausalität hat die Form der
Exaktheit, und diese exakte Natur ist ein ideales Konstruktions-
gebilde. Die funktionalen Beziehungen zwischen Naturdingen und
psychischen Vorgängen, die unter psychophyischen Gesetzen stehen,
entbehren der Exaktheit. Der Wille als psychisches Geschehen ist
kein Naturvorgang, er ist zwar wie alles psychische Geschehen funk-
tional abhängig vom Nervensystem, aber er selbst übt keine Kau-
salität weder im naturwissenschaftlich-exakten noch im funktional-
psychophysischen Sinn. Die Weise, wie aus dem einleitenden fiat die
Handbewegung hervorgeht ist ein ganz anderes „infolge“ als das
zwischen Nervensystem und Psychischem.
Der bedeutende Haupttext VI stammt aus dem sogenannten Pfän-
der-Konvolut, dessen übrige Manuskripte in der Gruppe D der Ergän-
zenden Texte wiedergegeben sind. Es handelt sich um Manuskripte,
die durch die Lektüre von Alexander Pfänders Abhandlung „Motive
und Motivation“ von 19111 angeregt wurden. Der dem Pfänder-
Konvolut zugehörige Ergänzende Text Nr. 42 hat den Charakter eines
fragmentarischen Entwurfs einer Einleitung, was darauf schließen
lässt, dass Husserl im Sommer 1914 eine eigene Abhandlung zu den
Willensmodalitäten und ihren Abwandlungen plante. Die Untersu-
chungen sollen sich dabei „innig an eine allgemeine Untersuchung
der möglichen Strukturen des Wollens“ anschließen; sie sind „ganz

1 Vgl. Alexander Pfänder, „Motive und Motivation“, in: Münchener Philosophi-

sche Abhandlungen, Theodor Lipps zu seinem sechzigsten Geburtstag gewidmet von


früheren Schülern, hrsg. von A. Pfänder, Leipzig 1911, S. 163–195. Zum Pfänder-
Konvolut siehe auch Karl Schuhmann, Die Dialektik der Phänomenologie I: Husserl
über Pfänder, Martinus Nijhoff, Den Haag, 1973, S. 98–112.
einleitung lxxiii

unerlässlich, um die Grundbegriffe der Ethik <…> einer entschei-


denden Klärung entgegenzuführen“.1
Husserl rühmt Pfänders Abhandlung, sie lässt „durch Tiefe und
Sorgsamkeit der Analyse“ alles Bisherige auf dem Gebiet der de-
skriptiven Erforschung der Willenssphäre weit hinter sich. Vielem
kann Husserl beistimmen. Gleichwohl bildet die Abhandlung an-
gesichts der „außerordentlichen Schwierigkeiten der Materie <…>
nicht das Ende, sondern den Anfang einer Fundamentalforschung
der Willenssphäre“.2 Husserl will sich nicht im Einzelnen mit Pfänders
Analysen auseinandersetzen, sondern durch sie angeregt seine eige-
nen Forschungen durch- und fortführen. Er will dabei ausgehen von
den Strukturen in der doxischen Sphäre, um von daher zu versuchen,
die Parallelen in der Willenssphäre und dann auch „in der Sphäre
der Fühlungen und Begehrungen“ zu erfassen. Der Entwurf bricht
nach einigen Analysen der einfachsten Bewusstseinsgestaltungen in
der doxischen Sphäre ab.
Der aus dem Pfänder-Konvolut stammende Haupttext VI enthält
ebenfalls Parallelbetrachtungen zwischen den doxischen Akten und
den Willensakten; diese erfolgen jedoch vor allem im Hinblick auf
das Husserls spätere Willensanalysen beherrschende Thema des Ver-
hältnisses zwischen Passivität und Spontaneität in der Willenssphäre.
Wie verhält sich das Wollen als spontaner Akt, als Ichvollzug, zum
unwillkürlichen Tun? Was sind die Formen und Antriebe dieses un-
willkürlichen Tuns?
In den Ergänzenden Texten der Gruppe C, die einem Konvolut
entstammen, das die Signatur „Td“ für „Tendenz“ trägt, versucht
Husserl den dynamischen Spannungscharakter des Bewusstseins in
allen seinen Akten zu erfassen. Von Reizen gehen Tendenzen zur
Zuwendung aus, zum Vollzug von aufmerkenden Ichakten, in denen
dann selbst wiederum Tendenzen zum Fortgang wirksam sind. Wenn

1 Dritter Teilband, S. 391. Diese Bemerkungen können als impliziter Verweis auf

Husserls Vorlesungen über „Grundfragen zur Ethik und Wertlehre“ vom Sommer-
semester 1914, in dem er die Ergebnisse seiner Analyse der Willensformen in einer
allgemeinen Strukturbeschreibung zusammengefasst hat, verstanden werden. Die Vor-
lesung ist in Husserliana XXVIII, S. 3–153 veröffentlicht.
2 Dritter Teilband, S. 392.
lxxiv einleitung

Tendenzen als Willenspassivität gelten, muss dem Bewusstsein als


ganzem ein Willenscharakter zugesprochen werden. Husserl behan-
delt die Willenspassivität unter verschiedenen Bezeichnungen: Ten-
denz, Neigung, Drang, Streben, Trieb. In verschiedenen Manuskrip-
ten aus den zwanziger Jahren, unter anderem im Haupttext XII, hebt
Husserl den universalen Strebenscharakter des Bewusstseinslebens
hervor. Besondere Aufmerksamkeit widmet er in mehreren Texten
dem Erkenntnisstreben.
Das Willens-Ich verhält sich zu diesem vorichlich-unwillkürlichen
Streben, dem Spiel der Neigungen bzw. Tendenzen: Es erfährt Af-
fektionen, es verwandelt ein unwillkürliches Tun in ein willkürliches
oder es widersetzt sich einer Tendenz, es entscheidet einen Konflikt
zwischen verschiedenen Neigungen, es überwindet eine Hemmung
durch eine Willensanstrengung etc.

Die vorangehenden Hinweise zum Inhalt von Husserls Bewusst-


seinsdeskriptionen in den Forschungsmanuskripten, die in den drei
Teilbänden der vorliegenden Edition wiedergegeben werden, er-
schließen keineswegs den Reichtum und die Differenziertheit der
Analysen. Sie werden vor allem dem lebendigen und explorativen,
öfters mit Unterscheidungen und Benennungen experimentierenden
Charakter von Husserls Deskriptionen nicht gerecht. An vielen Stel-
len seiner Texte gibt Husserl noch bestehenden Bedenken und Zwei-
feln oder dem Bewusstsein noch bestehender Undeutlichkeit und Un-
abgeschlossenheit Ausdruck. Es wird aus diesen Texten verständlich,
warum Husserl immer wieder die Schwierigkeit des phänomenolo-
gischen Sehens und den Arbeitscharakter des phänomenologischen
Forschens betont hat und er sich selbst als Entdeckungsreisenden in
einem neu entdeckten Kontinent verstanden hat.

Die Arbeit an dieser Edition hat sich über ein viertel Jahrhundert
erstreckt. Wer in dieser langen Zeit auf welche Weise der Edition
behilflich war, entzieht sich leider vielfach der Erinnerung. Den vielen
Helfern sei deshalb hier ungenannt gedankt. Dr. Thomas Vongehr
einleitung lxxv

hat die mühsame Arbeit der Erstellung des textkritischen Apparats


einschließlich der umfangreichen Tabelle auf sich genommen. Er hat
auch maßgeblich zur Herstellung der Textgrundlage der Edition bei-
getragen. Ich danke ihm für die gute Zusammenarbeit. Die Konzep-
tion der Edition, die Auswahl und Einteilung der Texte sowie alle Titel
stammen von mir. Für hilfreiche Anmerkungen zur „Einleitung“
danke ich meinem ehemaligen Kollegen und vormaligen Direktor
des Husserl Archivs Prof. Dr. Rudolf Bernet.

Leuven, März 2018


Ullrich Melle
I. ZUR INTENTIONALITÄT DER OBJEKTIVATION
IM URTEILEN, MEINEN UND STELLUNGNEHMEN

Nr. 1

A l l g e me i n e U n te r sc he id u n g e n b e i a l le n A kt en.
5 Gru nd a rt e n v on A kte n u nd G e g ens tä nd e n 1

Inhalt: 1) Allgemeine Unterscheidungen bei allen Akten. Das In-


tentionale, Objektionale, Apparenziale. Attentionale Modifikationen.
2) Akte erster und höherer Stufe, wobei Akt = „cogito“. Gegen-
stände erster und höherer Stufe.
10 3) Primäre Gegenstände und Reflexionsgegenstände, ebenso
für Bewusstsein. Phanseologische Reflexion und semasiologische,
apperzeptive Reflexion.
Reine Reflexionsgegenstände. Gemischte Reflexionsgegenstände.
4) Immanente und transiente Gegenstände. Immanenz = reines Be-
15 wusstsein. Empirisches Bewusstsein. Natur – Geist (phanseologische
Reflexion).

§ 1. Die Unterscheidung zwischen


Intentionale, Objektionale und Apparenziale.
Der gebende Akt und sein Intentionale als
20 Erscheinung. Schlichte und höherstufige Akte2

Wir gehen aus vom Bewusstsein, und zwar setzen wir voraus den
durchgehenden Unterschied zwischen Im pre ssi on u nd Re pro -
d u kt i o n. Jedes Bewusstsein ist entweder impressionales (aktuelles
Vorstellen, Denken, Wünschen etc.) oder reproduktives (gleichsam

1Wohl aus 1910. Mit späteren Anmerkungen, möglicherweise aus 1918. – Anm. der
Hrsg.
2 Intentionale, wohl = Noema.

© Springer Nature Switzerland AG 2020 1


U. Melle, T. Vongehr (Hrsg.), Studien zur Struktur des Bewusstseins, Husserliana:
Edmund Husserl – Gesammelte Werke 43-I, https://doi.org/10.1007/978-3-030-35788-7_1
2 zur intentionalität der objektivation

Vorstellen, Denken etc.), und zu jeder Bewusstseinsartung gehören


diese zwei genau parallelen Möglichkeiten. Wir beschränken uns auf
impressionales Bewusstsein und dabei wieder auf „meinendes“ Be-
wusstsein.1 Wir schließen Hintergrundbewusstsein aus, wir beschrän-
5 ken uns auf „Ak t e“ (im spezifischen Sinn meinende), intentionale
Erlebnisse. Wir denken uns entworfen eine Klassifikation dersel-
ben. Jedes solche Erlebnis hat sein In te n t i ona le2 (seinen intentio-
nalen Inhalt) und bezieht sich dadurch auf einen in te nt iona l e n
G ege n st an d (den intendierten). Wir sagen dann: Wenn das In-
10 tentionale ein gültiges ist (Wahrheit), so entspricht der vermein-
ten Gegenständlichkeit als solcher (X) in „Wirklichkeit“ oder in
„Wahrheit“ eine „ebensolche“ Gegenständlichkeit (das wahre X).
Wir müssen hier noch einen Unterschied machen, nämlich zwi-
schen der eventuell w ah ren Gegenständlichkeit einerseits, a ls
15 genau dem Sinn, dem Intentionale entsprechende: das Gegenständ-
liche als so und so, i n d e r un d de r Be deu tun g in t en di e rte s3 –
z. B. ich nehme ein rotes Haus wahr, und es ist das Vermeinte in
Wirklichkeit, die entsprechende Wirklichkeit, das wahrhaft seiende
rote Haus, das Wahrhafte genau in der Form „rotes Haus“4 –, und an-
20 dererseits dem Ge g e n s t a n d sc hl ech t h i n: das identisch gemeinte
„dieser“ mit anderen Bedeutungsinhalten. In erster Hinsicht stel-
len wir dem Intentionale (und dann auch dem Akt) gegenüber das
O b je kt io na l e und unterscheiden es vom O b je kt. Man könnte auch
unterscheiden das Objektionale als das W a hr e, das Objekt als das
25 S e ie n de.5 Es gibt nun so viele grundverschiedene Gattungen von
Akten, als es grundverschiedene Gattungen von Intentionalien gibt,
und jeder solchen entspricht eine grundverschiedene Gattung von
Objektionalien (von entsprechenden Wahrheiten) und wieder von
Objekten selbst.
30 Noch einen Begriff wollen wir hier einführen (ohne damit zu
sagen, dass nicht noch andere analoge Unterscheidungen möglich

1
Wohl cogito im Sinn der Ideen.
2
Wohl = Noema. Das X.
3 Wohl: Das Wahre = das wahre Intentionale = das wahre Noema.
4 Das Intentionale und Objektionale, der ganze gegenständliche Sinn, und Objekt,

der Gegenstandspol selbst.


5 Objekt in unmodifizierter Rede.
text nr. 1 3

sind).1 Wenn das Intentionale gültig ist, so entspricht ihm mögli-


che Gegebenheit, „psychologisch“ gesprochen: ein möglicher „wahr-
nehmender“ Akt. Wir können a priori und allgemein sagen: Zu
jeder Grundgattung von Akten gehört die fundamentale Unterschei-
5 dung zwischen selbstgebenden und nicht-gebenden, wahrnehmen-
den und nicht-wahrnehmenden Akten. Jedem nicht-wahrnehmenden
Akt entspricht zwar nicht ein möglicher wahrnehmender, aber je-
dem möglichen wahrnehmenden ein oder viele nicht-wahrnehmende
Akte von gleichem Intentionale.
10 Der wahrnehmende Akt, der „gebende“, hat sein Intentionale, er
ist Bewusstsein von einem Inhalt, aber nicht bloß das; es „er sch ei nt“
darin auch das Objektionale, es ist bewusst eine „Erscheinung“ des-
selben. Unter E r s c he in u n g verstehen wir nicht das gebende Be-
wusstsein, sondern das in ihm bewusste Was, aber nicht verstanden als
15 bloß Vermeintes (das identisch dasselbe sein könnte in einem nicht-
gebenden Akt), sondern das Er s c he in end e a ls s ol c he s, so wie es
da erscheint. Zum Beispiel im Dingwahrnehmen erscheint das Ding,
und das Ding-Erscheinende als solches ist nicht das Ding selbst (das
vielleicht gar nicht existiert), sondern die Erscheinung, die die und die
20 erscheinenden Farben, Formen etc. impliziert, während zum Beispiel
von der „Rückseite“ und ihren Bestimmtheiten nichts eigentlich er-
scheint und doch in einer bevorzugten Weise „mitwahrgenommen“
ist. Wir nennen dieses vom bloßen Intentionale unterschiedene W a s
der gebenden Akte die A p p a r e nz i a l i e n.
25 Wir können noch hinzufügen: Jeder Akt kann gewisse attentio-
nale Modifikationen erfahren, wodurch er schließlich aufhört, ein
„meinendes“, „intendierendes“ Bewusstsein zu sein. Er geht in ein
verworrenes, meinungsloses Hintergrundbewusstsein über und von
da eventuell wieder in ein Vordergrundbewusstsein, wobei hinsicht-
30 lich der Meinung Unterschiede bestehen können zwischen bevorzu-
gend Gemeintem und in zweiter Linie Gemeintem etc. (Unterschiede
der Aufmerksamkeit und negative Aufmerksamkeit).2

1 Apparenzialien.
2 Der Unterschied zwischen Verworrenheit und Deutlichkeit und Klarheit und
Unklarheit (Evidenz) gehört zu allen Akten. Er gehört daher in die allgemeinste Be-
wusstseinslehre neben den Unterschied von Impression und Idee und den Unterschied
der Akte, in die ein Vermeinen sich hineinlebt (und so ein Objektivieren erzeugt), und
4 zur intentionalität der objektivation

§ 2. Schlichte und fundierte Akte –


Gegenstände erster und höherer Stufe

Wir nennen einen Akt (worunter wir immer ein Meinen, ein Zuge-
wendetsein verstehen, wenn auch nicht gerade eine primäre Zuwen-
5 dung) einen A kt s c h li c h t er A r t o d er u nt er st e r St uf e, wenn
er keinen „Akt“ als Unterlage voraussetzt.1 Eine Wahrnehmung im
gewöhnlichen Sinn (sinnliche Wahrnehmung) ist ein schlichter Akt;
zwar hat er notwendig einen „Hintergrund“, er ist ein meinendes
Bewusstsein, das gleichsam in einem umfassenden Bewusstsein mei-
10 nend eine Grenze setzt.2 Wir können zwar auch sagen, das Objekt sei
herausgemeint aus einem Zusammenhang, aber das Hintergrundbe-
wusstsein ist kein meinendes, und der Akt als solcher ist schlicht.
Ist aber aus dem Gesamthintergrund ein Vorzug gesetzt, etwa als
Herausgreifen einer Gruppe von Gegenständen, die als gemeinte
15 dastehen, und ist da wieder ein Gegenstand herausgemeint als Ge-
genstand aus dieser Gruppe, so ist das Bewusstsein schon fundiert.
Ebenso, wenn an einem erscheinenden Gegenstand die Farbe be-
achtet wird. Zunächst sei etwa der Gegenstand wahrgenommen (ge-
meint), und dann wende sich das Meinen dem Moment Farbe zu.
20 Ist diese Meinung eine ausschließliche (nicht ausschließend im Sinn
eines Ausschließungsbewusstseins, sondern in dem Sinn, dass aus-
schließlich auf diesen Inhalt „rot“ geachtet wird), so ist dieses Be-
wusstsein ein schlichtes, wenn nicht in eins damit das Aktbewusstsein
des konkreten Gegenstandes (meinend) erhalten bleibt, etwa in der
25 Form, die wir zirkumskriptiv andeuten mit den Worten: das Rot
am Gegenstand, das Rot dieses Dinges. Ein solches Bewusstsein
wäre nicht ein schlichtes, ein Bewusstsein unterster Stufe, sondern
schon ein als Akt fundierter Akt. Und er hätte als solcher schon
einen „G e g e n st a n d h ö h e r e r S t uf e“. Denn das Eigentümliche
30 der höherstufigen Akte ist, dass sie, auf Akte neu bauend, ein in-
tentionales Ganzes, ein Ganzes der Art Akt herstellen, in dem nicht

der Akte, die diesen Vorzug nicht haben. Wobei jeder Akt von der einen in die andere
Einstellung kommen kann, bei Erhaltung eines abstrakt gemeinsamen Wesens.
1 „Akte“ erster und höherer Stufe.
2 Akt = „Meinen“ = „cogito“ im Sinn der Ideen.
text nr. 1 5

nebeneinander und gesondert verschiedene Gegenstände gemeint


sind, sondern ein Gegenständliches, das sich gewissermaßen durch
all die Aktmomente aufbaut. Bei den im Sinn höherer Ordnung
fundierten Akten können Akte als Unterlagen fungieren, die ge-
5 geneinander selbständig sind, sofern sie auch für sich sein könnten.
Aber eine Einheit der Meinung geht durch sie hindurch, und das
tut sie vermöge eines verbindenden Aktmoments (z. B. Kollektion,
darüber Logische Untersuchungen). Dem entspricht die Einteilung
der Gegenstände in Gegenstände erster Stufe und solche höherer
10 Stufe. Die ersteren sind solche, die nur in einem schlichten Akt zur
Gegebenheit1 kommen können; die anderen, die nur in einem Akt
höherer Stufe zur Gegebenheit kommen können.

§ 3. Primäre Gegenstände und sekundäre


Reflexionsgegenstände. Verschiedene Arten der
15 Reflexion: die phanseologische Reflexion auf Akte und
die Reflexion auf Bedeutungen und Erscheinungen.
Das reine Ich als ein reines Reflexionsobjekt

Die Gegenstände können wir ferner einteilen in p ri m ä r e


Ge g e n st ä n de und R e f l e x i o ns g e g e n st än de. Ein Ding ist ein pri-
20 märer Gegenstand; der undeutliche sinnliche Inhalt im verschwom-
menen Sehen, im unfixierten Sehen ist ein primärer Gegenstand.
Ein Reflexionsgegenstand ist hingegen das wahrnehmende Meinen,
das Moment der Setzung oder Nichtsetzung (zum Beispiel, wenn
ich ein Bildobjekt betrachte). Zum Wesen des Ak t be w us s ts ei n s
25 d e r R efl e x i o n gehört es, dass es sich anschließt an ein vorgängiges
Aktbewusstsein, das ihm in gewisser wesentlicher Weise als Voraus-
setzung vorangegangen ist.2 Es bedarf einer Basis, einer Basis der
Reflexion. Andererseits konstituiert sich nicht wie in einem Bewusst-
sein höherer Stufe (das hier nicht vorliegt) ein Gegenstand höherer
30 Stufe. Selbst wenn ein Ich ein Meinen zum Objekt macht, habe ich
nicht ein fundiertes Bewusstsein; das Gemeinte ist nicht Bestandstück

1 Zur Gegebenheit oder zu einer deutlichen, expliziten Gemeintheit.


2 Akt immer = cogito.
6 zur intentionalität der objektivation

des meinenden Aktes der Reflexion. Der Akt, auf den ich hinblicke,
bzw., wie es besser heißt, auf den ich reflektiere, und der Akt der
Reflexion selbst bilden nicht zusammen einen Akt höherer Stufe.
Genauer ist aber noch zu sagen: Ein p r im är er G e ge ns t an d
5 ist ein Gegenstand, der in einem nicht-reflektierenden Bewusstsein
zur Gegebenheit kommt. Ein Reflexionsgegenstand kommt in ei-
nem reflektierenden Bewusstsein zur Gegebenheit. Natürlich gibt
es aber auch Reflexionsgegenstände höherer Stufe. Wir können von
einem primären Gegebenheitsbewusstsein sprechen. So ist z. B. das
10 Urteilsbewusstsein „Dieses Papier ist weiß“, wenn es sich um ein
sinnliches Wahrnehmungsurteil handelt, ein primäres Gegebenheits-
bewusstsein. Natürlich ist auch jede sinnliche Wahrnehmung eine
primäre Wahrnehmung. Loc kes Reflexion ist eine reflektierende
Wahrnehmung, ein reflektierendes Gegebenheitsbewusstsein. Der
15 Unterschied geht natürlich über in die Modifikationen; primäres und
reflektierendes Anschauungs- (Phantasie-)bewusstsein.
Es fragt sich dann, ob man nicht ve rs ch ie de ne Ar t en de r
R e f l e x i o n unterscheiden muss: 1) die phanseologische Reflexion,
die auf „Akte“ und Aktmomente. Aber auch: 2) die Reflexion auf
20 die Intentionalien (Bedeutungen), auf die Apparenzialien (Erschei-
nungen im ontischen Sinn) und sogar auf die Objektionalien. Auf
das Gemeinte als solches muss „reflektiert“ werden; es ist nur ein
sekundär zu Gebendes durch Änderung der ursprünglichen Blick-
richtung, die nicht zufällig vorangeht. Aber auch auf das Gegebene als
25 solches muss reflektiert werden; denn zum Gegenstand muss es erst
werden, vorher ist das Objekt der Gegenstand.1 3) Man möchte sagen,
jedes „immanente“ Objekt ist ein Reflexionsobjekt. Das sinnliche
Datum, das ich empfinde, ist ein sekundäres Objekt. Es erscheint
ein Gegenstand, ein Ding und an ihm etwa die Farbe. Aber die
30 Empfindungsfarbe wird Objekt erst durch Reflexion. 4) Wie steht es
mit der Einheit des Gegenstandes gegenüber der erfüllten Dauer und
ihren erfüllenden Momenten? Ist das Letztere auch durch Reflexion
gegeben? Da wird man nicht so einfach Ja sagen und das in eine ganz
andere Linie rechnen.

1 2a) Alle Hintergrunderlebnisse sind natürlich Reflexionsgegenstände, sind es doch

schon die Vordergrunderlebnisse als „Erlebnisse“.


text nr. 1 7

Sind alle „Reflexionen“ von einem gemeinsamen allgemeinen


Wesen? Man wird aber jedenfalls doch einen guten Grund haben,
das Primäre gegenüber dem Reflektierten zu unterscheiden und von
diesem Gesichtspunkt aus die Objekte möglicher Erkenntnis zu grup-
5 pieren.
Diese Einteilung in primäre und sekundäre Gegenstände kreuzt
sich mit der Einteilung der Gegenstände in schlichte Gegenstände
und Gegenstände höherer Stufe. Jede phanseologische Reflexion, die
z. B. auf Akte der Freude, ist ein Akt erster Stufe. Denn nicht das
10 Fundiertsein macht einen Akt zu einem Akt höherer Stufe, sondern
ein so Fundiertsein, dass der Gegenstand des Aktes höherer Ordnung
die Gegenstände der fundierenden Akte zu einer höheren Gegen-
ständlichkeit verknüpft und gewissermaßen in sich fasst. Wenn ich auf
die Freude darüber, dass warmes Wetter eingetreten ist, reflektiere, so
15 ist dieser Gegenstand „Freude über den und den Sachverhalt“ nicht
ein Gegenstand, der den seienden Sachverhalt selbst einschließt. Er
schließt das urteilende Vermeinen, dass schönes Wetter sei, ein, aber
nicht den Sachverhalt selbst.
Nun wird man fragen, ist das Sich-Freuen nicht ein Gegenstand
20 höherer Stufe, da es doch gebaut ist auf ein Meinen, es sei schönes
Wetter, und dieses nicht nur voraussetzt, sondern einschließt? Das
ist verführerisch. Es ist aber dagegen zu sagen: Die Reflexion, die als
„phänomenologische Wahrnehmung“ das konkrete Freudenerlebnis
zum Objekt macht, richtet sich auf das verwobene Ganze dieses
25 Aufeinander beider Akte. Die Gegenstände beider gehen in ihren
Gegenstand nicht ein. Aber auch davon abgesehen: Die Reflexion
ist nicht ein komplexes Gebilde, das irgendwelchen Akt zunächst
vollzieht, darauf eine höhere Aktstufe baut, die nun den Gegenstand
der unteren mit dem, was die höhere, vergegenständlichende, leistet,
30 in sich fasste. Es ist nicht so, dass etwa zuerst auf den urteilenden
Akt reflektiert werden müsste (als Unterlage) und dass nun der
Gegenstand der Gesamtreflexion stufenweise auf diesen Gegenstand
gebaut wäre, sondern in einer und derselben Aktstufe, und zwar in
schlichter, ist die Freude da, und die Freude voll genommen impliziert
35 das Vermeinen, es sei schönes Wetter. Das gilt nun von allen Akten.
Sie sind schlichte Gegenstände, als Gegenstände erster Stufe gegeben.
Zum Beispiel: Reflexion auf ein Urteil, mag das Urteil selbst noch so
kompliziert sein, ist ein einstufiges „Wahrnehmen“ usw.
8 zur intentionalität der objektivation

Man wird nicht dasselbe behaupten dürfen von der Reflexion auf
die Intentionalien und die Apparenzialien. Eine „Bedeutung“ ist
bald eine Bedeutung erster und bald eine solche höherer Stufe; eine
Erscheinung ist eine solche bald erster Stufe, bald höherer Stufe. Nun
5 kann man demgegenüber natürlich auch sagen: Ein Akt ist ein Akt
erster und bald ein Akt höherer Stufe. Und so sei alles beiderseits
gleich, z. B. ein schließender Akt ein Akt höherer Stufe.
Indessen, das ist eine schwierig zu merkende Täuschung. Der Akt
höherer Stufe, wie z. B. der schließende Akt, ist ein dahinfließendes,
10 so und so gebautes Erlebnis, das „Akt höherer Stufe“ heißt, weil
sich in ihm ein Gegenstand höherer Stufe konstituiert. Aber damit
ist nicht gesagt, dass er selbst ein Gegenstand höherer Stufe ist und
dass, um ihn selbst zur Gegebenheit zu bringen, ein Akt nötig ist,
der in der Weise eines Aktes höherer Stufe objektiviert! Hier ist die
15 Sache also klar: Di e A k t e si nd n ic h t „ G e ge ns t änd e höh e rer
Or dnu ng “.
W i e nun b e i de n B ed e ut u n gen? Sind nicht die Sätze, die
vermeinten Wahrheiten als solche, Gegenstände höherer Ordnung?
Kommen sie nicht zur Gegebenheit in Akten höherer Ordnung? Und
20 ebenso die „Begriffe“ (Vorstellungen an sich)? Zum Beispiel der Satz
„Ein Viereck ist rund“ oder der „Begriff“ „ein rundes Viereck“: Hier
muss ich einen Akt höherer Ordnung vollziehen, und die Bedeutungs-
reflexion muss durch alle seine Gliederungen hinein- und hindurch-
gehen, und ebenso bei den Erscheinungen höherer Ordnung.
25 Mit Rücksicht auf die grundverschiedene Art, wie Akte, Erleb-
nisse zu Gegenständen werden und wie Intentionalien und Apparen-
zialien es werden, derart, dass die Reflexion einmal Reflexion auf
die Akte ist und ein Analogon der schlichten Wahrnehmung bei Sin-
nendingen ist, das andere Mal eine Reflexion ist, die gewissermaßen
30 von der objektiven Einstellung, die in den Akten lebt, zu anderen
Einstellungen übergeht, die in den Akten leben, möchte man den
einheitlichen Terminus Re fl e x i o n beanstanden. Für das Erstere
könnte man sagen: phanseologische Wahrnehmung (eventuell psy-
chologische, wenn die Reflexion eine unreine ist), für das andere: ur-
35 sprünglich gebendes Bedeutungsbewusstsein, ursprünglich gebendes
Erscheinungsbewusstsein, die sich gegenüberstellen dem gebenden
Objektbewusstsein der betreffenden bedeuteten (intendierten) und
erscheinenden Objekte.
text nr. 1 9

Der natürliche Begriff von Wahrnehmung ist der eines einstufigen


Aktes. Es ist noch die Frage, ob die Bedeutungen erster Stufe Gegen-
stände erster Stufe sind. Hier möchte ich auf Folgendes aufmerksam
machen. Prä di k at i ve B ede ut un gen, Bedeutungen der Urteils-
5 sphäre, der Sphäre des begreifenden Denkens, sind, auch wenn sie
prädikative Bedeutungen erster Stufe sind, sch o n Ge g e ns tä nd e
hö her er S t uf e. Wenn ich auch nur sage „Hans“ oder „dies“, so
ist zu unterscheiden zwischen unterliegendem und daraufliegendem
Akt, und das Vorgestellte der unteren Stufe fließt ein in das der
10 höheren Stufe. Es ist das, was begriffliche Fassung erfährt und in
dieser begrifflichen Fassung in den Urteilsgegenstand eintritt. Und
das bleibt erhalten für die Bedeutungseinstellung.
Die Einteilung der Gegenstände in primäre und Reflexionsgegen-
stände zeigt ihre Wichtigkeit darin, dass nun auf Seiten der Reflexion
15 alle wissenschaftliche Untersuchung steht, welche im weitesten Sinn
das „Bewusstsein“ betrifft, d. i. alle Akte, alles Hintergrundbewusst-
sein, aber auch alles den Akten in der Weise der „repräsentierenden“
Inhalte, der Bedeutungen, der Erscheinungen etc. „Immanente“.
Aber es fragt sich, wie wir Beziehungsgegenstände, die primäre und
20 Reflexionsgegenstände miteinander verbinden, ansetzen sollen. Na-
türlich sind sie ex definitionem Reflexionsgegenstände; andererseits
können wir unterscheiden r e i n e R e f lexi on sg e gen s t änd e, die
nicht in der Weise von Synthesen, von irgendwelchen Verbindungen,
primäre Gegenstände enthalten, und g e m i s cht e R e fl ex i o nsg e-
25 g e n stän d e. Zu bemerken ist noch, dass das, was man unter dem
Titel „Immanenz“ (immanente Philosophie etc.) oder i m m a ne nt e r
In ha lt, immanenter Gegenstand zu befassen hätte und befasst hat
(ohne freilich die darin beschlossenen wesentlichen Unterschiede
überhaupt zu sehen), sich, wenn nicht decken würde mit den reinen
30 Reflexionsgegenständen, so mindestens unter diesen Titel gehören
würde. Ob das eine oder das andere, das ist erst näher zu überlegen.
I s t m e i n Ic h f ü r mi c h s e l bs t e i n Re f l e x i on s g e g e n st an d?
Ist es ein reiner oder gemischter? Mit anderen Worten also, wie
bin ich mir selbst gegeben? Ich, das Subjekt der Wahrnehmung,
35 Erinnerung, des Urteils etc., das heißt, ich, der ich jetzt das und das
wahrnehme, mich dessen erinnere, das und das meinend glaube, auf
das und das aufmerke, die und die Wünsche habe und Wollungen
bzw. Handlungen vollziehe. Das ist natürlich ein Reflexionsobjekt.
10 zur intentionalität der objektivation

Aber während das Ich hier als Einheit dieser Akte gesetzt ist, ist es
nicht immer und notwendig bezogen auf primäre Objekte. Ich nehme
Gegenstände wahr, denke an Objekte etc. Aber müssen es immer
primäre Objekte sein? Muss ich mich der Natur gegenüberstellen
5 und muss ich unter dem Titel „Ich“ auch an „meinen“ Leib denken,
der als Leib ein bevorzugtes primäres Objekt ist und ein solches, das
gegeben ist?
Andere Personen sind gegeben, mindestens als gemischte Reflexi-
onsobjekte oder in gemischten Reflexionsobjekten, da die Einfühlung
10 den Hinblick der Wahrnehmung auf den fremden Leib erfordert.
Auch beim eigenen Ich nehme ich in der Regel den Leib, an den es
„gebunden“ ist, mit. Andererseits aber kann man fragen, ob nicht
ein reines Ich (mein eigenes reines Ich) abzugrenzen ist als ein rein
immanentes, reines Reflexionsobjekt, in dem eben von der empiri-
15 schen Verflechtung desselben mit dem Leib und von der Beziehung
auf „seine“ intentionalen primären Objekte, seine Naturumgebung
abgesehen wird.
Aber die Persönlichkeit, der Charakter? Das identische Ich im
natürlichen Sinn: Der Charakter bewährt, bildet sich, entfaltet sich in
20 der Natur- und Menschenwelt. Sowie wir das Ich als den empirischen
Charakter nehmen oder das Ich, das Charakter hat, haben wir schon
ein gemischtes Reflexionsobjekt. Dieses Ich ist das der Psychologie als
Naturwissenschaft. Aber es fragt sich, ob nicht in der Beschränkung
auf den reinen Reflexionsbestand,1 auf die dahinfließenden Akte,
25 auf den Fluss des meinenden oder verborgenen Bewusstseins, eine
Einheit zu entnehmen ist (wie mir in der Tat scheinen möchte), eine
Einheit, die also ein Identisches ist, das soweit reicht, als der Fluss
des Bewusstseins zu verfolgen und in der Wiedererinnerung wieder
zu verfolgen ist. Dieses Identische wäre das r e i n e I ch als ein im
30 Reflexionsbestand vorfindliches, reines Reflexionsobjekt: E s hä t te
de n G ru n dc h a r a kt e r al l e r i mma n e n te n O bj e k te , „ a dä q ua t
ge ge be n “ zu s e i n oder gegeben sein zu können. Doch ist dieser
Grundcharakter hier noch nicht (in der Weise der cartesianischen
Betrachtung) festzustellen. Vielleicht ist es aber doch gut, schon hier
35 darauf hinzuweisen, weil sich in der Tat für alle Reflexionsobjekte

1 „Reines“ Ich?
text nr. 1 11

hier vielleicht etwas Grundwichtiges in Gemeinsamkeit herausstellt.


Nicht alle sind immanente Objekte, sofern sie auch „empirisch“ auf-
weisbar sind. Aber die empirische Auffassung ist eine solche, dass
das empirische Objekt das entsprechende immanente Objekt in sich
5 fasst. Jedes Reflexionsobjekt hat einen immanenten Kern (zu ihm
selbst gehörig), der nur auf Transzendenz bezogen wird. Aber ist das
korrekt? Gehen wir nun weiter.

§ 4. Immanente und transiente (empirische) Gegenstände.


Naturobjekte im primären und sekundären Sinn

10 Wir stellen nun eine neue Unterscheidung hin, die wir zunächst
auf die Gegenstände der ersten Stufe beziehen, von denen aus sie
sich auf die Gegenstände höherer Stufe überträgt. Ich meine die
Unterscheidung zwischen i m m a nen t en und t r an s ien t en (empiri-
schen) Gegenständen. Sie korrespondieren der Unterscheidung des
15 Bewusstseins in e mp i r i s c he s und n ic ht -e m pi r is c he s ( und i n
di e s e m Si n n re i n e s) Be w us st sei n. Es ist nicht etwa so, dass Re-
flexionsgegenstände von vornherein immanente Gegenstände sind.
Die psychologischen Gegenstände sind Reflexionsgegenstände und
doch empirische Gegenstände, nämlich die „psychischen Akte“, psy-
20 chischen Erlebnisse in dem Sinn, in dem der Psychologe von ihnen
spricht, als Akte oder Zustände von empirischen Subjekten. Auch wo
der Psychologe, was er nicht vermeiden kann, von dem Vermeinten
als solchen spricht, von dem, worauf sich ein Akt des Vorstellens z. B.
bezieht, da ist das Vermeinte (das Intentionale) empirisch aufgefasst,
25 sofern es bezogen ist auf einen Akt, der selbst als ein Empirisches
gemeint ist.
W ie es s ch e i n t , s i n d a l l e i mma ne n te n G e g e ns t ä nd e
R ef l e x io ns g e g e ns t ä nd e. Ein Zweifel könnte hier (mit Beziehung
auf psychogenetische Überlegungen) bestehen für die sinnlichen In-
30 halte, die ich in meinen früheren Schriften geradezu als primäre
Inhalte bezeichnet habe. (Reflexionsinhalte nannte ich damals nur
die Akte und ihre Modifikationen gegen den Hintergrund hin.) Ist
es nur zufällig, dass ich einen sinnlichen Inhalt nur rein immanent
erfasse durch Rückwendung von einem empirischen Objekt? Selbst
35 beim Ton, der ja im Sinn der natürlichen, d. i. empirischen Auffas-
12 zur intentionalität der objektivation

sung, derselbe ist beim nahen und ferneren Erklingen; wobei eine
eigene Einstellung dazu gehört, den jeweiligen „immanenten“ Ton-
inhalt zu fassen, der seinerseits für die reflektive Auffassung als
„Repräsentant“ dasteht, als darstellend für den objektiven Ton. Es ist
5 also eine Einstellung hier vorhanden, die reflektierte Einstellung ist,
sofern sie aus einer „natürlichen“, unreflektierten hervorgegangen
ist, und das ist ein wesentliches Verhältnis, wie sich daraus ergibt,
dass daraus ein Verhältnis von Repräsentant und Repräsentiertem
sich konstituiert und dass wir dabei die Worte nicht umgekehrt wer-
10 den gebrauchen wollen. Hat, wird ein Psychologe einwenden, das
erwachende Bewusstsein schon Dingbewusstsein, wenn es einen Ton
hört oder eine Farbe sieht? Wenn das Tönende sich entfernt, hört das
erwachende Bewusstsein schon „denselben Ton, nur entfernter“ –
nota bene: denselben unveränderten – und hört es nicht vielmehr
15 einen sich verändernden?
Ü be r ha up t bi n ic h hi n si c ht li ch d er B e gri f f e „ Re f l e-
x i o ns g e g e ns t a n d “ u n d „ R ef le xio ns be w u ss t se in “ z w e if e l-
h a f t. Beim Dingwahrnehmen, könnte man z. B. sagen, sei das iden-
tische Ding primärer Gegenstand, das Ding als Einheit der Dauer.
20 Dagegen wenn ich auf die Phasen achte, z. B. auf die Phasen der Ver-
änderung und auf ihre Verteilung in der Dauer, so sei das schon eine
Art Reflexion. So fragt es sich, ob der Gesichtspunkt der „Reflexion“
etwas Grundwesentliches ist, sowohl hinsichtlich der Einteilung des
Bewusstseins und insbesondere wesentlich für eine Einteilung der
25 Gegenstände.
G r un d we s e nt l i c h i s t da g e g e n di e S che i d u ng i n im m a-
n e n te u nd e mp i ri s c h e Ge g e n s t än de. Was charakterisiert die
einen und anderen? Wir weisen da hin auf die äußeren Wahrneh-
mungsobjekte. Dinge kommen zur Gegebenheit in jeder Dingwahr-
30 nehmung. Aber jede Dingwahrnehmung ist eine „einseitige“ Ge-
gebenheit und im Übergang von Wahrnehmung zu Wahrnehmung,
von Wahrnehmungskontinuität zu Wahrnehmungskontinuität, die zu
einem und demselben Ding gehört, kommt das Ding immer von
neuen Seiten und doch niemals (und das ist unaufhebbar) allseitig
35 zur Gegebenheit. Jedes Gegebenheitsbewusstsein ist ein Vermeinen
des Dinges, das Bewusstsein vom Selbstdasein desselben ist. Aber
in diesem „selbst da“ steckt notwendig ein „nicht selbst da“ von
verschiedenen Seiten, Komponenten des Dinges etc.
text nr. 1 13

Was ein immanentes Objekt anlangt, so ist es, wenn es gegeben ist,
absolut gegeben, nicht einseitig, nicht so, dass neue Wahrnehmungen
mit neuem Erscheinungs- und Bedeutungsgehalt dasselbe Objekt
geben und nach neuen Seiten geben könnten usw. Das immanente
5 Objekt hat keine Seiten, keine Darstellungen etc. Ein empirisches
(transientes) Objekt stellt sich durch „Erscheinungen“ dar (in jedem
ihm zugehörigen empirisch gebenden Bewusstsein). Ein immanentes
Objekt steht in der Gegebenheit einfach da ohne „Darstellung“, ohne
Erscheinung. Im Ersteren liegt: Jedes empirische Bewusstsein lässt
10 Reflexion von solcher Art zu, dass daraus ein immanentes Bewusst-
sein einer „Erscheinung“ erwächst und in weiterer Reflexion ein im-
manentes Bewusstsein von „repräsentierenden Inhalten“. Das reine
Bewusstsein lässt solche Reflexion nicht zu. Es lässt zu die Reflexion
auf den Akt. Prekär ist die Frage nach der „Bedeutung“, nach dem
15 Intentionale des immanenten Aktes, inwiefern und ob es hier ein
eigenes Intentionale gibt gegenüber dem Objekt. Soll man sagen, so
wenig als es hier ein Apparenziale gibt, so wenig ein Intentionale,
oder soll man sagen, das letztere falle hier in eins zusammen mit dem
Objekt?
20 Jedes immanente Objekt lässt sich in gewisser Weise in ein em-
pirisches verwandeln, z. B. das immanente Objekt „Wahrnehmung“,
„Urteil“ usw. in das empirische: Wahrnehmung als Zustand eines
Menschen, Urteil als Akt einer urteilenden Person, Nächstenliebe
als Ausfluss eines sittlichen Charakters usw. Ebenso ein Intentionale,
25 als intentionaler Inhalt meines Vorstellens oder Wünschens, ein in-
tuitiver Inhalt, eine Erscheinung als Erscheinung, die ich habe usw.
Die immanenten Objekte erhalten durch Beziehung auf empirische
Objekte eine Einordnung in die Natur, in die empirische Welt, und
in verschiedener Weise. Die Bedeutungen haben Beziehung zum Akt
30 des Bedeutens, zum Akt, dessen Inhalt sie sind, und dieser wieder
lässt unmittelbar die psychologische Auffassung zu, die Bedeutungen
schon mittelbar. Ob alle empirische Auffassung der Akte und damit
auch der übrigen immanenten Inhalte letztlich nicht vermittelt ist
durch die Beziehung auf das empirisch-sinnliche Objekt Leib, das
35 kann hier nicht erwogen und entschieden werden.
Alle diese empirischen Objekte haben das Charakteristische, dass
sie empirische „Wendungen“ von reinen Objekten sind, das heißt,
das reine Objekt bleibt, was es ist, und ordnet sich dem empirischen
14 zur intentionalität der objektivation

als Kernstück, als reeller Teil ein. Es erhält nur durch Beziehung
auf Empirisches selbst einen empirischen und damit transzendenten
Charakter. Oder: In sich ist es reines Objekt, und nur seine Beziehung
zum empirischen gibt ihm Stellung in der empirischen Welt. Und alle
5 diese Objekte sind Reflexionsobjekte. Können wir nicht sagen: Es
sind entweder selbst Akte bzw. psychische Objekte oder Objekte, die
an Akte gebunden sind?
Die primären Objekte, die Objekte erster Stufe, die nicht im-
manente Objekte sind, können aber auch e m pi r is c he Ob je kt e
10 s e i n , d i e n ic ht b l o ße W e ndu nge n vo n im m an ent e n si nd. Im
Gegebenheitsbewusstsein eines Dinges (in jeder äußeren Wahrneh-
mung) finden wir zwar verborgen mancherlei immanente Objekte, die
durch Reflexion herauszuholen sind, z. B. außer dem Gegebenheits-
bewusstsein selbst die Erscheinung, die Meinung, die Empfindung;
15 aber diese sind in keiner Weise dem Dingobjekt selbst angehörig.
Das Empfindungsrot ist nicht wahrgenommenes Rot, sondern stellt
es bloß dar. Die Erscheinung einer Seite des Dinges ist nicht selbst
Seite des Dinges, sondern stellt sie nur dar (jetzt in dem Sinn: ist
Erscheinung davon) usw.
20 Das sind die N a t ur o bj e k t e. Naturobjekte sind du r ch u nd
du r c h t ra n s z e n de n t und enthalten nichts, was immanent ist, was
durch Abscheidung von irgendwelchem Mitverbundenen, von Bezie-
hungen rein Immanentes werden könnte. Naturobjekte sind Objekte
des Bewusstseins erster Stufe (sie sind Gegenstände erster Stufe)
25 und näher pr i mä r e Ob j e k t e (nicht Reflexionsobjekte), oder auch
Objekte erster Stufe, und zwar r e i n t r an s i e nt e, die nichts von
Immanentem enthalten. N a t u r ob j e k t e i m s e k un dä re n S i nn
od e r e mp i r i s ch e O bj e k t e i m s e kun dä r e n S i nn sind unreine
Reflexionsobjekte, nämlich Reflexionsobjekte, die durch gewisse Ver-
30 knüpfungen mit primären Naturobjekten selbst empirisch, naturhaft
werden, aber nur mittelbar, unrein.
Danach haben wir a l s e r s t e s u n d f und a me n ta l s te s e mp i r i -
s c h es Ob j e k tg e b i et d i e N a t u r und in Bezug auf sie a ls s e ku ndä -
re s d e n G e i s t, d i e S p h ä re d e r Ps y c hol o g i e.
Nr. 2

B ew usst sei n - v on u n d d as o b je k ti vi er en de
Z u m - Geg en stan d - M a ch en im Ur t ei le n 1

§ 1. Das Erscheinende und sein Charakter. Impressionen


5 als Unterlage eines objektivierenden Begreifens und
Beurteilens. Der Unterschied der Urteilsqualitäten

Wohl zu beachten ist Folgendes: In der Anmutung „erscheint“


ein Satzinhalt in einem objektiven Charakter, der in reflektiver Prä-
dikation auf ihn bezogen werden kann: Der Inhalt „dass S p ist“
10 ist Inhalt einer Anmutlichkeit, einer Möglichkeit. Ebenso: Dass S p
ist, ist wahrscheinlich. Im Für-wahrscheinlich-Halten ist der Inhalt
charakterisiert als Wahrscheinlichkeit.
Ebenso nun „e r s ch e i n t“ in jeder Behauptung (Urteil im gewöhn-
lichen Sinn) der propositionale Inhalt in einem objektiven Charakter,
15 und das ist der Charakter der Wahrheit. Das ist der Begriff der
Wahrheit im ursprünglichsten Sinn.2 Um diesen Begriff zu gewinnen,
haben wir bloß zu urteilen und die bezeichnete Reflexion zu üben;
ebenso wie wir, um den Begriff der Wahrscheinlichkeit zu bilden,
nur vermuten müssen. Es ist keineswegs erforderlich, dass wir „die
20 Wahrheit selbst“ gegeben haben, das heißt, dass wir das Urteilen in
ein evidentes überführen müssen, in dem das Geurteilte, die Wahr-
heit, „gegeben“ ist. Das Geurteilte ist Wahrheit im Sinn von Sach-
verhalt (gerade in der und der Denkform natürlich). Das Geurteilte
als solches ist der vermeinte, urteilsmässig vermeinte Sachverhalt.
25 Das im evidenten Urteil Gegebene ist der „Sachverhalt selbst“, die
„Wahrheit selbst“.
Wir müssen nun unterscheiden: die im urteilenden Vermeinen ver-
meinte Wahrheit, das ist der vermeinte Sachverhalt, der erscheinende,
so wie er eben erscheint, wenn wir urteilen, und das Prädikat „wahr“,
30 von dem oben die Rede war. Wenn wir Reflexion üben und dem Inhalt

1 Oktober 1910.
2 Ursprung des Begriffes der Wahrheit und des Begriffes der Wahrscheinlichkeit.
16 zur intentionalität der objektivation

der Wahrheit, dem Satzinhalt, gegenüberstellen das Prädikat „wahr“,


das heißt, Inhalt einer Wahrheit zu sein (ebenso beim Vermuteten,
der Wahrscheinlichkeit, dem Inhalt gegenüberstellen das Prädikat
„wahrscheinlich“). Genauso ist im impressionalen Vorstellen, etwa
5 im Wahrnehmen, eine Objektität bewusst, es erscheint etwas, ein
Gegenstand, eine Existenz, wie wir auch sagen können, und auch hier
können wir den bloßen Inhalt möglicher Existenz für sich heraushe-
ben und auf ihn das Prädikat „existiert“ beziehen: Er ist Inhalt einer
Existenz. Wir sagen: Der Gegenstand (hier: das Ding) existiert. Aber
10 der Subjektausdruck ist hier modifiziert. Der Gegenstandsinhalt ist
ein existierender, er ist Inhalt eines Gegenstandes im existenzialen,
unmodifizierten Sinn. So wie wir oben auch sagen, der Sachverhalt be-
steht, statt zu sagen, ein Satz-Inhalt besteht, ist Inhalt eines Bestehens.
Müssen wir dann nicht konsequenterweise so weiter gehen? Jedes
15 „Bewussstsein“ ist Bewusstsein von etwas, jedes impressionale Be-
wusstsein ist „Erscheinung“ von etwas, und je nach Art des Bewusst-
seins hat das Erscheinende seinen „Charakter“ und seinen „Inhalt“
(intentionale Qualität – intentionale Materie). So wie wir hatten Vor-
stellung, Urteil als Behaupten, Für-wahrscheinlich-Halten und dem-
20 gegenüber den Seins- oder Existenzcharakter, Wahrheitscharakter,
Wahrscheinlichkeitscharakter (bzw. Existenz, Wahrheit, Möglichkeit
und Wahrscheinlichkeit), so haben wir im Gemütsakt einen Gemüts-
inhalt „erscheinend“ mit seinem jeweiligen „Charakter“: Im Werten
erscheint etwas als wertlich, als lieblich, schön, etc. Im Wünschen
25 erscheint etwas als „wünschlich“, ein Inhalt steht da im Charakter
des wünschlich (erwünscht im objektiven Sinn) oder erscheint als
seinsollend, im Bedauern etwas als bedauerlich etc., und „etwas“
ist dabei der bloße Inhalt. Der Wille allerdings steht nicht in dieser
Reihe. Wir können vielleicht das der Sprache zuschreiben und sagen,
30 im Entschließen erscheint ein Inhalt als Inhalt eines Entschlusses, als
praktisch seinsollend.
Doch nun kommen wir in eine sonderbare Schwierigkeit: Ist denn
nicht in jeder Impression irgendetwas „gesetzt“? Einmal das Sein
(der Gegenstand im engeren Sinn), das andere Mal der Sachverhalt,
35 dann Wahrscheinlichkeit, Möglichkeit, Zweifelhaftigkeit, Seinsollen
etc., jederlei Wertlichkeit. Immer können wir einen Sachverhalt und
den Charakter des Seins unterscheiden, und dieser Charakter des
Seins ist ja nichts weiter als das Korrelat der Impression als solcher.
text nr. 2 17

Einmal haben wir eine schlichte Vorstellungsimpression, das andere


Mal eine prädikative Impression (Urteil genannt), das dritte Mal eine
Gefühlsimpression, eine Wunschimpression, eine Wertungsimpres-
sion usw., und überall haben wir den ganzen Inhalt des Bewusstseins
5 im Charakter des Seins, weil nämlich doch überall gegenübergestellt
werden kann die Aktmodifikation: die Phantasie-Vorstellung, das
Quasi-Urteil, die Wunsch-Modifikation etc., und da „schwebt der-
selbe Inhalt“ vor im Charakter der „Einbildung“.
Die Schwierigkeit löst sich, wenn wir Folgendes beachten: Jedes
10 impressionale Bewusstsein kann als „Unterlage“ eines Urteilens fun-
gieren, eines Ergreifens, Begreifens und prädikativen „Beziehens“.
Und allein dieses Ergreifen und Begreifen ist im echten Sinn ob-
jektivierend, zum Mindesten das Ergreifen oder, wie es auch heißt,
„Me i ne n“, Zum-„Gegenstand-Machen“. Insoweit im Wahrnehmen
15 in der Tat schon dieses Meinen, dieses Einen-Gegenstand-Erfassen
steckt, insofern ist es wirklich ein „Vorstellen“, „Perzipieren“. Es
muss aber nicht darin sein (Hintergrundbewusstsein). Ebenso, ich
kann eine Vermutung haben, „setze“ aber nicht das Wahrscheinlich-
sein; ich kann wünschen, „lebe“ aber nicht im Wünschen und stelle
20 nicht das Seinsollen gegenständlich hin. Ich kann es jederzeit, und
dann habe ich eben einen Gegenstand, und was immer „ergriffen“,
perzipiert wird, das hat dann, wenn es ein Ergreifen auf dem Grund
einer Impression ist, den Charakter des Seins, der der eine und selbe
überall ist. Der Unterschied zwischen Dasein und sonstigem Sein
25 liegt nur darin, dass ich einmal eine empirische Impression habe, das
andere Mal eine andere. D a s ä n d e r t a be r ni c hts da r a n, da s s w i r
e b en g ru n d v e r s c h i e d e ne I m pr e s s i o ne n zu u nt er s ch ei de n
ha be n , „ W e i se n d e s B e wu s s t s e in s “, denen grundverschiedene
Regionen und Kategorien von Gegenständlichkeiten entsprechen,
30 und dass in jeder Impression eben die eigentümliche Änderung
vorgenommen werden kann, die wir Objektivieren nennen, Zum-
Gegenstand-Machen. Eben damit wird jede Impression zur mögli-
chen Unterlage eines Begreifens und Beurteilens.
Untersuchen wir nun die Impressionen, die verschiedenen Grund-
35 artungen des Bewusstseins, so finden wir als zusammengehörig das
Urteilen als Für-wahr-Halten, als Behaupten, ferner das Für-falsch-
Halten, Im-Bewusstsein-der-Nichtigkeit-Haben, und das Vermuten.
Was immer wieder täuscht und gegen die gattungsmäßige Einheit
18 zur intentionalität der objektivation

einnimmt, ist, dass scheinbar der Vermutungsakt ein fundierter ist


gegenüber dem scheinbar einfacheren Urteilsakt. Das liegt daran,
dass wir das Vermuten prädikativ zum Ausdruck bringen, indem wir
dem Vermutungsinhalt das Prädikat „wahrscheinlich“ geben oder
5 „möglich“: „Dass S p ist, ist möglich.“ Demgegenüber sprechen wir
das Urteil aus „S ist p!“ und nicht „Dass S p ist, ist wahr“, was ein
Urteil nicht über das Urteil, aber aufgrund des ursprünglichen Urteils
wäre, ein reflektives Urteil. Ebenso beim Für-nichtig-Halten. Der
Vermutungsakt selbst, und ebenso der Akt des Für-nichtig-Haltens,
10 ist aber keine Prädikation (keine Behauptung); das Wahrscheinlich-
keitsurteil ist eine auf dem Grund des Vermutungsaktes gebaute
Behauptung. Warum wir so verfahren und keinen direkten Ausdruck
haben (man wird schwerlich die Rede „S ist wohl p“, „S ist mögli-
cherweise p“ für anderes halten als für eine Behauptung aufgrund
15 der Vermutung),1 das führt auf die alten Schwierigkeiten der nicht-
prädikativen Aussagen.
Die Unterschiede zwischen Urteil, Nichtigkeitsbewusstsein und
Anmutung, so wie die entsprechenden Unterschiede der darin fun-
dierten Akte, welche Beziehungen zwischen vermeinten Wahrhei-
20 ten und vermeinten Möglichkeiten konstituieren, nennen wir Unter-
schiede der Urteilsqualität. Sie machen zum Teil in einem Sinn den
traditionellen Gehalt der Rede von modalen Unterschieden aus. (In
einem anderen Sinn ist auch das ein modaler Unterschied, aber inner-
halb der Sphäre der Behauptungen, dass ein Urteil einmal gesondert
25 und frei ist, das andere Mal eingeflochten in einen „kausalen“ Zu-
sammenhang.) Modale Unterschiede in einem anderen Sinn beziehen
sich auf die „Art und Weise der Überzeugung“ bzw. auf die Art und
Weise der Vermutung, auf die mitverflochtenen Färbungen etc. Die
letztere Rede soll bevorzugt werden.
30 Nota. Entspricht dem Unterschied zwischen Behaupten als Für-
wahr-Halten und Für-falsch-Halten (Nichtigkeitsbewusstsein) ein
Unterschied zwischen affirmativem und negativem Vermuten bzw.
Anmuten? Entspricht dem Anmuten, dass etwas nicht sei, vielleicht
ein anmutendes Nichtigkeitsbewusstsein, so dass, wie das Anmuten,

1 Oder nicht?! – Ich bin wieder zweifelhaft und habe anderweitig ja entgegen

entschieden!
text nr. 2 19

dass etwas sei oder nicht sei, ein Für-wahr-Anmuten wäre, so das nega-
tive Anmuten, dass etwas sei oder nicht sei, ein Für-falsch-Anmuten?1

§ 2. Objektivierende Setzung als Urteil im weitesten Sinn –


Apophansis als Urteil im engsten Sinn. Jedes Erlebnis
5 kann Grundlage eines apophantischen Urteilens werden2

Da fragt es sich aber, ob ich meine Urteilslehre nicht noch in


einer Richtung weiterführen muss, die im Obigen schon angedeutet
ist. Ich sprach oben von Ergreifen, Begreifen, ich sprach aber auch
von Meinen = Zum-Gegenstand-Machen. Ich sagte, jedes impres-
10 sionale Bewusstsein kann Unterlage eines objektivierenden, eines
vergegenständlichenden und urteilsmäßigen Meinens sein.3 Nun ist
jedes Urteil im gewöhnlichem Sinn ein fundierter Akt, ein fundiertes
Meinen, Objektivieren, Setzen, dem doch schlichte Setzungen zu-
grunde liegen. In den Logischen Untersuchungen habe ich anerkannt,
15 dass im Wahrnehmen ein verwandtes Setzen vorliege wie im Urteilen,
wobei ich unter Urteilen ein Prädizieren verstanden wissen wollte.
Dabei ist doch zugleich der Unterschied zwischen den ausdrücklichen
Erlebnissen, speziell den ausdrücklichen Urteilen, und den nicht-
ausdrücklichen (und den verwandten Akten) zu beachten.
20 Schon vor dem Ausdruck mit seinen verbalen Bedeutungen haben
wir doch positionale Akte (= Akte im spezifischen Sinn des ego
cogito), jene vermeinenden, aus anderen Akten herausmeinenden
Akte,4 z. B. das in ein Wahrnehmen sich einlebende Meinen, das wir in
der Regel zur Wahrnehmung selbst mitrechnen. Ebenso höhere syn-
25 thetische Meinungen: Ich erfasse einen Gegenstand in der Wahrneh-
mung, ich erfasse an ihm ein Glied, einen Teil-Gegenstand etc.; ich er-
kenne ihn als denselben, als denjenigen, den ich in einer Wiedererin-
nerung, aber in anderer Erscheinungsweise wahrgenommen hatte.

1 Darüber cf. N und darin die Blätter q, p. 2 = Husserliana XLIII/3, Text Nr. 4, S.

214,22–215,38.
2 16.X.10. – Urteil und Vermeinen (Setzen).
3 Vgl. aber Q (objektivierende Akte und wertende), p. 25 = Husserliana XLIII/2,

Haupttext I, S. 35,25–37,25. Dazu überhaupt Q, wo ich schon verwandte Stellung habe.


4 Vgl. dagegen noch die Bedenken in Q 25 = Husserliana XLIII/2, Haupttext I, S.

35,25–37,25
20 zur intentionalität der objektivation

Wir haben ja auch hier bei den vorbegrifflichen Meinungen ver-


schiedene Weisen des Urteils; nämlich der „gewissen“, sicheren Ge-
genstandserfassung, Identitätssetzung, steht gegenüber die anmu-
tende, vermutende. Auch steht gegenüber der Setzung die nega-
5 tive Setzung, dem Seinsbewusstsein ein Nichtigkeitsbewusstsein und
natürlich auch die Modifikationen subjektiver Art, von denen wir
gesprochen haben.
Also U r t e il im w e it es te n S in n umfasst alle Positionen (Nega-
tionen) mit ihren qualitativen Unterschieden der Gewissheit oder
10 Anmutlichkeit (Für-Sein-Haltungen, Für-möglich-Haltungen), mö-
gen sie nun einfache, schlicht thetische sein oder höhere, mögen sie
ferner ausdrücklich sein und damit zugleich „erkennend“, begrei-
fend oder nicht. Und dabei wieder partiell begreifend oder durchaus
begreifend.
15 U r t e i l i m e n g st en S i nn i st die Ap oph ans i s, Urteil im Sinn
der Logik ist die Gesamtsphäre der ausdrücklichen Akte, die entwe-
der apophantisch sind oder mit diesen von demselben, also apophan-
tischen Inhalt, nur qualitativ verschieden.
Ur t e i l i m w e i t e st e n S i n n is t dan n so v i el w i e o bj e kt iv i e-
20 r e n de r ( = i nt e ll e k t i v e r i m we it es te n Si nn) Ak t. Alle Ob-
jektivationen (Setzungen) weisen zurück auf nicht-objektivierende
Erlebnisse. Aber nun fragt es sich, wie der Akt be g ri f f zu fassen ist.
Sollen wir etwa so ausführen: Jedes „Erlebnis“, jedes immanente
individuelle Datum, in seiner vollen Konkretion genommen, ist Be-
25 wusstsein und ist als Bewusstsein Bewusstsein von etwas.1 Es ist ent-
weder selbst Objektivation, ein „Urteil“ im weitesten Sinn, der oben
bezeichnet war, oder wenn nicht, so kann sich in dasselbe ein „Urteil“,
ein Vermeinen hineinleben, derart, dass wir mit Evidenz aussagen
können, das Urteil expliziere nur, was in dem Erlebnis seinem Wesen
30 nach bewusst war. Es sei jedes Erlebnis eben an sich, auch wenn es
nicht vermeinendes sei, Bewusstsein „von etwas“; es habe ein jedes in
seiner Art eine immanent ihm einwohnende und herauszumeinende
Bedeutung, und wieder, es beziehe sich eben dadurch ein jedes in
seiner Weise auf Gegenständliches, oder je nach seiner Gattung auf
35 eine gattungsmässig zu charakterisierende Gegenstandsregion, auf

1 Vgl. p. 30 = S. 3,25–5,12, wo zum Begriff des Aktes im spezifischen Sinn das

„Meinen“ hinzugerechnet wird.


text nr. 2 21

die es, wenn es zum vermeinenden wird, in der Urteilsweise gerichtet


sei (oder auf die sich das darin fundierte Urteilen, Setzen dann richte:
in der Urteilsweise).
Und wir können auch so sagen: Zum Wesen des Objektivierens
5 gehört die Möglichkeit, mit anderen Objektivationen in wesensge-
setzmäßiger Weise zur Einheit („Synthese“) der Identifizierung zu
kommen und eventuell zu „evidenter“ Identifizierung. Vor allem
jede schlichte Objektivation, überhaupt jede Objektivation der un-
teren, vor allem Begreifen liegenden Schicht, lässt sich auf die Stufe
10 der spezifisch urteilsmäßigen erheben, wie wenn eine schlichte Wahr-
nehmung zur Grundlage einer Dies-Setzung und eventuell schon
attributiven, begrifflichen Fassung wird (dieses Papier) und so zum
Subjektakt eines Prädizierens.
Es ist dann mit evidentem Recht und Sinn zu sagen, die schlichte
15 Wahrnehmung sei Warnehmung eines Gegenstandes, des in ihr
schlicht erfassten, und dieser selbe Gegenstand sei in der Dies-
Setzung gesetzt und sei nun Gegenstand der Subjektsetzung des Ur-
teils, sei im Urteil Gegenstand-worüber. In dieser Weise kann eviden-
terweise jede Setzung in eine Subjektsetzung übergeführt und dann
20 prädikativer Gegenstand, Gegenstand der urteilenden apophanti-
schen Erkenntnis werden. Dies gilt auch von der synthetischen Ge-
samtsetzung, die das Urteil als Apophansis im Ganzen vollzieht, auch
sie kann in eine Subjektsetzung verwandelt werden, und wir sagen mit
Evidenz, dass der Gesamtgegenstand des Urteils, der Sachverhalt, die
25 in ihm vermeinte Wahrheit, nun zum Gegenstand-worüber in neuen
Erkenntnissen wird.
Wir finden nun n e b e n den Urteilen im engeren und weiteren Sinn
noch andere Erlebnisse und jedes, sagten wir, ist ein „Bewusstsein
von“. Jedes kann Grundlage nämlich eines urteilenden Setzens und
30 somit auch eines denkenden, apophantischen Urteilens werden, und
zwar so, dass mit jeder Grundklasse von Bewusstsein eine neue
Grundartung von Gegenständlichkeiten und somit auch von Bedeu-
tungen sich herausstellt. Sagen wir „Jedes Bewusstsein ist Bewusst-
sein von“, so liegt darin also, dass jedes in sich implizite schon auf
35 so etwas wie eine Gegenständlichkeit „gerichtet“ ist, aber dass das
Urteil es gleichsam sehend macht und diese Gegenständlichkeit ihm
entnimmt und zur Erkenntnis bringt.
22 zur intentionalität der objektivation

Beilage I
Die Urteilsbedeutung und die Bedeutung der
unterliegenden Akte. Die Urteilsgeltung übergreift alle
anderen Fälle von Geltung. Die Bestimmung des
5 Bewusstseins durch die Grundarten der Bedeutungen1

Gehen wir von den Domänen von Akten aus, so entspricht jeder eine
eigene Domäne von Bedeutungen, und diese unterstehen, so wie die Urteils-
bedeutungen, der Frage nach der Gültigkeit. Als Parallele der Logik haben
wir also andere „formale“ Disziplinen.
10 Aber wie, is t Ge lt ung n ich t sp e z ie ll S ac h e ei n es U r tei l s? Nun,
das Urteil hat seine Geltung: Das Urteil ist wahr, der Wunsch ist nicht wahr,
aber doch berechtigt, gültig; auch in der Sphäre des schlichten „Vorstellens“,
des Wahrnehmens, des Erinnerns, des vollen und leeren, gibt es eine Gel-
tung, die freilich wie jede Geltung nur prädiziert werden kann eben in der
15 Prädikation. Sind schlichte „Vorstellungen“ (Seinssetzungen) Grundlagen
für synthetische Identifizierungen, Prädizierungen, Beziehungssetzungen, so
haben diese neuen Gebilde (Urteilsbedeutungen im speziellen Sinn) eben
wieder ihre Geltungsweise: eben die der Prädikation (doch haben wir zu
unterscheiden die Synthesis vor dem Ausdruck und die ausdrückliche Syn-
20 thesis). Auch im Fragen und Vermuten „erscheint“ etwas, das ist, auch hier
haben wir Bedeutungen, die ihre Weise der Geltung haben, ebenso Wünsche
usw.
Jeder solchen „Bedeutung“ entspricht eine „Urteilsbedeutung“ (prädi-
kative Bedeutung). Zum Wesen der Vermutung des Inhalts „S ist p“ gehört
25 das mögliche Urteil: Dass S p ist, ist wahrscheinlich! Und wenn die Vermutung
Vermutungsgeltung hat, so hat das Urteil Urteilsgeltung und umgekehrt.
Und so überall. Natürlich urteilend stellen wir das alles fest. Wir urteilen
über das im schlichten Vorstellen, über das im Vermuten, im Wünschen,
Wollen Bewusste, wir sehen darauf hin, wir setzen es als Vermeintes, Be-
30 deutetes und urteilen, es sei wirklich, es „bestehe in Wahrheit“.2 Das be-
sagt: J e d es B ew u s st s ei n k a n n U n t e r lag e ein e s aff ir m a tive n o d er
n e ga ti ve n „ Ex i st en z ia l ur t e il s “ s ei n; je d es B ewu s s ts e in k an n f ü r
e i n Pr äd i zi e re n di e s elb e F u n kt io n ha b en w ie et wa d a s si n n lich e
V or s t el l un gs be w u ss t se in fü r e in D in g - Pr ä d iz ier e n.3 Auch ein Ur-
35 teilsbewusstsein selbst: Auch aufgrund dessen kann ich „existenzial“,

1 Nota bene. – Sehr wichtig. – 1910.


2 Bedeutung = Vollthema.
3 Die übergreifende Funktion des Urteils über alle Akte.
beilage i 23

„kategorial“ etc. urteilen. So kann ich überall sagen: In Wahrheit besteht


das Vorgestellte (das Ding-Bedeutete), in Wahrheit besteht das Geurteilte
(der Satz ist ein wahrer, der „Sachverhalt besteht“), in Wahrheit besteht das
Vermutete (dass S p ist, ist wahrscheinlich, das Wahrscheinlichsein besteht),
5 in Wahrheit besteht das Gewünschte, in Wahrheit möge S p sein, ebenso in
Wahrheit besteht das Gesollte, das Gesollte als solches ist, besteht.
Haben wir aber hier Urteil, Existenzialurteil, so wird man vielleicht sa-
gen: E x is t e n z i s t e in B e g ri ff , d er w e se n tlic h zu m U rt ei ls geb i et
g eh ö r t, e be n s o w ie de r B eg r iff G ege n s tan d. Natürlich ist das, recht
10 verstanden, nicht zu bezweifeln, aber es ist zu beachten, dass eben Urteile
(Prädikationen) Akte sind, welche ihrem Wesen nach fundierte Akte sind,
also Akte voraussetzen, die nicht immer selbst wieder Urteile sind und Urteile
sein können.1 Und ebenso Urteilsbedeutungen, Sätze sind fundierte Be-
deutungen, die andere „Bedeutungen“ als Unterlagen voraussetzen. J e d es
15 U rt e il se t zt „ V o rs t e llu n ge n “, s a gt m an, al s U n ter la ge vo r a u s.
Hinter diesem Wort „Vorstellung“ steht jederlei Bewusstsein: nämlich jedes,
sei es ein sinnliches Wahrnehmen, sinnliches Erinnern oder ein Vermuten,
Wünschen, Sichfreuen etc., is t e n tw e de r s c ho n s e lb s t e in „ Me in en “
o d e r e s ka n n s ich e in M ei n en d ar in ein le b en , u n d e s i s t d an n ei n
20 s ol ch es „ V o r s t ell e n “ , da s a ls U n te r la g e d e s U r te ils f u ng ie re n
k a n n.
Das Meinen selbst ist eine auszeichnende Zuwendung zu dem Bewussten;
es besagt einen eigentümlichen Modus, den jedes Bewusstsein, ohne sein
Wesen einzubüßen, erfahren kann, einen durch dasselbe hindurchgehenden
25 Blick, oder wie man es nennen möchte. Und nach diesem wahrnehmenden,
gefallenden, wünschenden etc. Meinen kann sich dann das ausdrückende
Begreifen orientieren und dasjenige Formen, das etwa eine subjektive Vor-
stellung oder eine Objektvorstellung für ein kategorisches, speziell etwa
relationelles Urteil erfordert, oder auch ein solches Fassen, das das betref-
30 fende Vorstellen in modifizierter Weise als Unterlage für ein Existenzialur-
teil ermöglicht. So ist jedes Bewusstsein und jedes Was eines Bewusstseins,
seine Bedeutung, einzubeziehen in ein Urteilsbewusstsein, ein existenziales
Urteilsbewusstsein, und ebenso korrelativ jede Bedeutung in eine Aussage-

1 Das wird man nur von eigentlich vollzogenen, erfüllten, nicht von verworren vollzo-

genen Urteilen sagen können, von „bloß intendierenden“ Urteilen, unbegründeten. –


Man müsste dann sagen: Das Urteilsmäßige ist dabei jederzeit etwas Unselbständiges,
da die Urteilsfassung, Urteilsbeseelung eben etwas voraussetzt, was seinem Wesen
nach ohne solche Beseelung sein kann und dann eben nicht Urteil ist. Aber das ist
unrichtig, da es falsches und verworrenes Urteilen gibt. Urteilen weist auf etwas hin,
was nicht Urteil ist, aber es ist nicht wirklich darin fundiert! Nicht jedes Urteil ist
begründet, aber jedes „fordert“ eine Begründung.
24 zur intentionalität der objektivation

bedeutung. Und zur Aussage kommen dabei einerseits die Geltungen jener
Bedeutungen, also Existenz, und andererseits das so und so Beschaffensein
der betreffenden Gegenstände, der betreffenden Gegenstände, der Dinge,
der Wahrscheinlichkeiten, der Wertgegenstände, auch der Sachverhalte als
5 Urteilsgegenstände (neuer Urteile).
Andererseits aber sind nicht Urteilsbedeutungen einerlei mit den
„Bedeutungen“ der unterliegenden Akte, so wenig Urteile selbst Wahrneh-
mungen, Wünsche, Vermutungen etc. sind. Sie liegen zugrunde, aber so wie
sie sind, sind sie noch keine Urteilsglieder bzw. noch keine Satzglieder:
10 Es fehlt die spezifische Gedankenformung (synthetische) und begriffliche
Formung, die zum Urteil (als Aussagen, Begreifen) gehört.1
Vor allem synthetischen Fassen, Begreifen und Aussagen liegen da Rei-
hen von Akten (Bewusstseine), und sie haben das Eigentümliche, dass ih-
nen ein Sinn, eine Bedeutung einwohnt. Natürlich, dass das der Fall ist,
15 das entnehmen wir aus ihnen im evidenten Urteilen, drücken es begrifflich
aus, machen es zu unserem Erkenntnisbesitz. Aber diese Akte sind doch
nicht die Gegenstände dieser Urteile. Ebenso ist die Eigentümlichkeit dieser
„Bedeutungen“, zu gelten oder nicht zu gelten, durch Urteile zu erkennen,
aber nicht selbst etwas zum Urteilen Gehöriges. Urteile selbst haben ihre
20 Geltung; auch das aber – diese Beschaffenheit der Urteile, „wahr“ zu sein –
entnehmen wir durch neue Urteile. Ebenso, wie es korrelativ heißt, jedes
eigenartige Bewusstsein, und zwar im Modus des Meinens, hat seine Weise,
sich zu erfüllen; auch das Urteilen hat seine Weise, die abhängig ist von
den Erfüllungen der unterliegenden Akte, aber doch wieder etwas Neues
25 ist. Und desgleichen: Im Urteilen ist uns bewusst ein „Gegenstand“, das
ist, das Urteil hat eine Bedeutung, und ist diese, der Satz gültig, so ist der
Urteilsgegenstand, der Sachverhalt. Aber genauso ist uns in jedem Bewusst-
sein ein „Gegenstand“ bewusst: Jedes ist Bewusstsein von, jedes lässt einen
„vermeinten Gegenstand als solchen“, eine Bedeutung entnehmen, und im
30 Fall der Bedeutungsgeltung sprechen wir von einem wahren Gegenstand
(oder schlechthin von einem Gegenstand). Natürlich wie vom Urteilen selbst,
so von jedem Bewusstsein sagen wir das aus, wir erkennen es durch einsich-

1 Also es muss das Verhältnis des zu Formenden und des Formenden vorliegen, das

aber ist bei einem vagen Aussagen aus Gewohnheit wie 2 × 2 = 4 nicht der Fall. Oder es
gibt zweierlei Formungen – adäquate und inadäquate –, und es gibt zweierlei Rede auch
vom Formen: einmal ein spontanes Urteilen, das sich nach anderem „Bewusstsein“
richtet, und das andere Mal ein vages Urteilen, das sich nicht tätig nach etwas richtet
und einer Unterlage etwas entnimmt, sondern in einem Schlag, „blind-assoziativ“
ist das Urteil (mit seiner Unterlage einig) da, und die Einheit ist eventuell eine
„unpassende“.
beilage i 25

tiges Urteilen. Aber darum ist doch zu scheiden das erkennende Urteilen
von dem Gegenständlichen, das erkannt ist und das ist, ob wir erkennen oder
nicht. Und somit ist auch zu scheiden das erkennende Urteilen, in dem wir
erkennen, dass jedes Bewusstsein „sich auf eine Gegenständlichkeit bezieht“,
5 von dieser Tatsache selbst und von dem Bestand solcher verschiedenartigen
Gegenständlichkeiten selbst, wenn Gültigkeit besteht.
Also Gegenstand, Gegenstandsbedeutung, Geltung von Bedeutung sind
Sachen, die erkennbar sind durch Urteile, aber nicht Urteilsfakta selbst,
mögen auch apriorische Beziehungen bestehen zwischen Urteilsgeltungen
10 und den Gegenständen, die wir setzen können, den Geltungen, die wir Wahr-
heiten nennen, und allen anderen Gegenständen, Bedeutungen, Geltungen.
Vor allem muss man sagen: De r B egr if f der G el tu n g ( Ri c ht i gk ei t
e t c. ) is t e i n a llg e m e in e r, d er de n B eg r iff d er S a tz g e lt u n g (R ic h -
t i g ke it d e s Ur t ei l en s ) a ls E in z e lfa ll e i ns c h lie ß t. Aber dieser Einzel-
15 fall übergreift in gewisser Weise alle Fälle, weil alles Erkennen von Geltung
und von Sein selbst ein Urteilen ist, das seinerseits Wahrheitsgeltung haben
muss. A ll e G e g en s t än de re ic h e n n o tw e n dig in di e U r te il ss phä re
hi ne i n: Urteile sind freilich selbst Gegenstände. Alle Gegenstände sind
mögliche Subjektgegenstände von Sachverhalten, aber Sachverhalte sind
20 selbst wieder Gegenstände. Mit dem Gesagten hängt zusammen: E s g ib t s o
v i e le G r u nda r te n v o n Ge g e ns t än d lic h k ei ten , a ls e s G r u n da r te n
d es B ew u s st s ei ns g ib t. Die Grundarten des Bewusstseins bestimmen sich
durch die Grundarten der Bedeutungen. Bedeutungen sind vermeinte Ge-
genständlichkeiten als solche: vor der Frage der Geltung. Zum Wesen jeder
25 Gegenständlichkeit gehört es, dass sie ihre ursprüngliche Bewusstseinsweise
hat, ihren sie „gebenden“ Akt, ebenso „bloß vorstellende“ Akte etc.; zu
jeder gehört ihre Art der „Ausweisung“, der Erfüllung, der Begründung.
Je nach Art des Bewusstseins, je nachdem es fundiertes ist oder nicht,
sind auch die Gegenständlichkeiten, die da „vermeinte“ sind, fundierte oder
30 nicht fundierte. Und das gibt den Ursprung für eigentümliche Prädikationen,
sofern das gegenständliche Moment, das das höhere Bewusstsein in un-
selbständiger Weise hinzutut zu dem Gegenstand des unteren Bewusstseins,
diesem als Prädikat zugemessen wird. Es sind grundverschiedene Arten von
Prädikaten, je nachdem es heißt, der Gegenstand, das Ding da ist rot, und
35 wieder, es ist schön, wahrscheinlich, gut etc. Kann man diese Prädikate mit
dem Prädikat Wahrheit, Gültigkeit auf gleich behandeln? In gewisser Weise
sicherlich. Nämlich: Auch das Bewusstsein, in dem ein Urteil als gegebene
Wahrheit dasteht, nämlich vor der Prädikation der Wahrheit, ist ein fundiertes
Bewusstsein, ein „Evidenz“bewusstsein, und wenn ich von dem Urteil dann
40 aussage, es sei wahr, es „stimme“, so gebe ich ihm mit Beziehung auf das,
was das fundierte Bewusstsein neu hergibt, ein Prädikat.
26 zur intentionalität der objektivation

Andererseits aber ist der Unterschied offenkundig. Es liegt hier nicht


so etwas vor, was analog ist mit einem Werten, in dem ein Wertprädikat
am Gegenstand oder Sachverhalt erscheint, wie ja dann auch jedes Werten
selbst sich ausweisen kann und dann nicht in einem analogen Sinn wieder
5 einen Wert erhält.
Mit all dem sind die Fundamente für eine Kategorienlehre gelegt, deren
volle Ausführung aber hier nicht am Platz ist.

Beilage II
Das Urteil als ein Gebilde von eigenen
10 Intentionen. Das Urteilen ist ein erfülltes, wenn
es sich nach einem gebenden Akt richtet1

Was da2 ausgeführt ist, ist sehr schön. Aber es bedarf nun neuer Unter-
suchungen. Das Urteil ist hier hingestellt als eine formende Spontaneität,
durch deren Formung Urteile in concreto erwachsen. Es ist da in erster
15 Linie gedacht an die Fälle, wo ein Bewusstsein, das im Allgemeinen noch
kein Urteilsbewusstsein ist, allenfalls partiell ein solches enthält, als Substrat
fungiert, es wird daraufhin ein Urteil gebildet, das auf dieser Grundlage etwa
über den wahrgenommenen Gegenstand und seine Existenz urteilt oder über
die Schönheit, Güte eines Menschen, über die Erfreulichkeit einer Tatsache
20 etc.
In anderen Fällen ist es aber anders. Während hier ein bloßes A u s ein an -
d er le g e n d e s a n de r we it i g Be wu sst en s tat th at t, ein U r t eilen , d as
s ic h n ac h a n d e r e m B e wu s st se i n u n d s ein e m G eh a lt „ r i c ht e t “ un d
ih m „ a n ge m e s se n “ i st (wobei wir von einer Evidenz der Angemessenheit
25 sprechen können), kann ein Urteilen einfach da sein oder kann gefällt wer-
den ohne ein solches Auseinanderlegen, so z. B. wenn ich gewohnheitsmäßig
urteilend einen mathematischen Satz ausspreche, wobei mir eventuell eine
Verwechslung passieren kann, die einen Widersinn mit sich bringt, den ich
aber nicht merke. Diese schwierige Sachlage muss nun erforscht werden.
30 Es liegt nicht, wird man sagen, ein „eigentliches“ Vorstellen, Wünschen,
Sichfreuen etc. zugrunde, und es gründet sich darauf nicht ein eigentliches
Explizieren, Objektivieren, Beziehend-Fassen etc. Ich sehe etwa ein Haus, ich
habe also eine Wahrnehmung, aber ich sage hier, was ich davon aufgrund frü-
herer Einzelbetrachtung, Explikation etc. „weiß“; ich vollziehe nicht Urteile,

1 Wohl Ende 1911. – Anm. der Hrsg.


2 Gemeint ist die vorangehende Beilage I. – Anm. der Hrsg.
beilage ii 27

die sich nach dem Wahrgenommenen hier und jetzt „richten“. Oder ich sage
„Möge S p sein, das ist erwünscht“. Aber ich urteile „mechanisch“, ich fühle
jetzt keinen eigentlichen lebendigen Wunsch, vielleicht eine Wunscherinne-
rung, aber eine ganz unklare, matte, in nicht „vollziehender“ Weise usw.
5 Was für Modifikationen liegen da dem Urteil zugrunde? Eventuell ist das
„eigentliche“ Substrat gar nicht herstellbar, eben wenn das Urteilen wider-
sinnig ist.
Wir haben also gegenüberzustellen: das uneigentliche Urteilen und das
eigentliche. Aber das in verschiedenem Sinn! Auf Seite der Uneigentlichkeit:
10 einmal das unartikulierte, verworrene, nicht wirklich Setzung auf Setzung
gründende Urteilen und andererseits das eventuell artikulierte, aber seiner
Unterlage nach „uneigentliche“. Ich urteile wirklich und artikuliert, aber
was das Urteil voraussetzt für die Realisierung seiner Termini bzw. was es
voraussetzt, wenn es soll „richtig“ sein können, das fehlt.
15 Soll man sagen: Das Urteilen ist im Fall, dass es aus einem vorgegebe-
nen Substrat durch Explikation und prädikative Formung einen Sachverhalt
konstituiert, nicht etwa eine bloß unselbständige Formung der unterliegen-
den Wahrnehmung, Erinnerung, des unterliegenden Wunsches etc., sondern
ein Gebilde von eigenen „Intentionen“, die sich nach dem Vorgegebenen
20 richten, indem sie die Bestimmheit der Richtung danach orientieren, aber
doch ihm gegenüber ein Neues sind, derart, dass dieselben Intentionen,
in derselben Form nachher ohne diese Unterlage auftreten können? Als
unerfüllte Intentionen. Und nun können sich diese Intentionen auch anders
formieren und auftreten, ohne Bestimmtheit der Richtung der erfüllenden
25 „Anschauung“ zu verdanken, ohne aus der Fülle zu erwachsen, in der sie
sich erfüllen, eventuell ohne erfüllbar zu sein? Wir hätten dann also den
Gegensatz von e ig e nt l ic he n U r t e il si nt e nt io n en (artikulierten, wirk-
liche Setzung) und u n er f ü ll t en; alle Urteile wären entweder unerfüllte
Intentionen oder erfüllte. Aber in jeder spontanen Sphäre hätten wir den
30 Unterschied unerfüllter und erfüllter Intentionen, und damit hängen die
Unterschiede der Begründung zusammen.
Also muss ich den in den Logischen Untersuchungen so stark hervortre-
tenden Unterschied zwischen Intention und Erfüllung hier in den Mittel-
punkt stellen, und zwar fällt er durchaus in den Rahmen der Aktualität. Das
35 Urteilen kann volles (erfülltes) sein, wenn es sich aktuell „richtet“, seine
Richtigkeit sich ausweist, wenn es sich nach einem gebenden Akt orientiert.
Andernfalls ist es leeres Urteil, leere Urteilsintention. Es weist dann auf
eine zu leistende Begründung hin: Es steht eben unter Normen. Auch eine
Wunschintention kann bloße, leere Wunschintention sein. Darum ist der
40 Wunsch wirklicher Wunsch, aber er ist anders charakterisiert, wenn seine
„Voraussetzung“ realisiert ist, als wenn das nicht der Fall ist.
28 zur intentionalität der objektivation

Wie weit reicht dieser Gegensatz? Gehört er spezifisch zu den spontanen


Intentionen? Gehört er nicht schon zu den Hintergrundakten? So besteht ja
die Perzeption (die Wahrnehmungserscheinung), ob Zuwendung da ist oder
nicht, aus einem Komplex von Intentionen, von denen die einen volle, die
5 anderen leere sind. Ist das nicht im Wesen derselbe Unterschied?

Beilage III
Das Verhältnis des vorprädikativen
Vorstellens zum Denken. Identifikation im
eigentlichen Sinn findet nur im Denken statt1

10 Wie verhält sich das vorprädikative (nicht-konzeptive) V o r s tel le n


(schlichte Perzeption) zum D en k e n (Konzeption), wie dieses zum Sich-
meinenden-Zuwenden? Ist I d e nt if iz ie r un g nicht eine Sache des De n -
k e n s? Kann man z. B. sagen: In der „Erfüllung“ trete ein Akt des Vorstellens
und ein Akt des Denkens in die Einheit einer Identifizierung? Doch sicher
15 nicht. D ie „ D e ck u ng “ i st n ic ht s el b st I de nt if iz ier u n g, die Deckung
zweier Akte.
Zunächst a) Vorstellung in dem vorstellenden Einheitsbewusstsein (d. i.
dem zu Vorstellungen gehörigen) – z. B. das Einheitsbewusstsein in der Kon-
tinuität von Wahrnehmungen, die denselben Gegenstand immer wieder von
20 neuen Seiten zeigen – ist kein Identitätsbewusstsein als Denken von Identität,
Erfassen von Identität, aber ein Denken kann etabliert werden.2 Das sagt,
derselbe Gegenstand, der eine ist es, der sich in dieser und jener Wahrneh-
mung oder Wahrnehmungskontinuität darstellt, da nach diesen Seiten, dort
nach jenen Seiten.
25 b) Ferner, das Denken, das sich auf dem Vorstellen aufbaut, in dem es
sich nach ihm „richtet“ bzw. nach dem richtet, was ich sehe, was ich vorstelle,
geht damit mit dem Vorstellen eine eigentümliche Einheit ein, und diese Ein-
heit ist wieder eine andere als die vorhin besprochene der kontinuierlichen
Wahrnehmungseinheit. Aber wieder ist es eine Einheit, die es gestattet, in
30 einem neuen Denken zu sagen: Das in der bloßen Vorstellung (schlichten
Perzeption) Vorgestellte und das im darauf gegründeten Denken Gedachte
ist dasselbe. Das Denken ist es, das im Hinblick auf eine Vorstellung sagt
„diese Vorstellung“ (das heißt, das auf dem Grund einer Wahrnehmung

1 Aus Dezember 1909.


2 Kontinuierlich sich deckendes Bewusstsein, einstimmiges Vorstellen, ist nicht Er-
fassen von Identität.
beilage iii 29

oder Vorstellung dieser Vorstellung so sagt), und das Denken ist es, das
zugleich nach dieser Vorstellung sich richtend sagt „dieser Gegenstand“ und
die Beziehung herstellt „dieser Gegenstand dieser Vorstellung“. Und wieder
auf Grund der Vorstellung vom Denken (im Hinblick darauf) sagt „dieses
5 Denken“ und es denkt „diesen Gegenstand“ etc. Und es ist dabei das so
sich richtende Denken evident; alle diese Urteile sind evidente (eines jeden
Aktes überhaupt!). Zum Wesen jeder Vorstellung und zum Wesen jeden
Denkens gehört die Möglichkeit, ein so sich nach ihnen richtendes Denken
zu begründen, das in Evidenz der Vorstellung ihren Gegenstand entnimmt,
10 nämlich ihn für das Denken zu einem Dies macht, von dem sich Prädikationen
vollziehen lassen.
Ei ne I de n t i fiz ie r un g f in d et i m ei gen tl ic h en S in n n ur s ta tt
zwis ch e n z w e i De n ka k t e n , u n d d i es e h a ben i h re rse it s z we i V o r -
s t e l lun g e n zu r G r un d la ge. Vorstellungen als Grundlage! Habe ich da
15 früher nicht einen wesentlichen Sinn der Vorstellungsunterlage der rechten
Abhebung entbehren lassen, aus dem Grund, weil ich nicht scharf unterschied
in den Logischen Untersuchungen zwischen dem leeren Vorstellen (vor allem
Denken) und dem leeren Denken, z. B. im leeren Gebrauch eines Eigen-
namens. Muss man nicht sagen, je d e r D en k a k t s e tz t e in V o r s tel len ,
20 e in v o ll e s o d er le e r es, voraus und baut sich darüber? Ich merkte richtig,
dass in den Terminis ein Vorstellen stecke; das Denken bringt aber seine
Denkform herein, und diese durchdringt alles, auch die Termini.
Setzt aber jedes Denken Vorstellen im unteren Sinn, ein schlichtes Perzi-
pieren, derart voraus, dass es Nicht-Konzeptives denkmäßig formt und setzt?
25 Das Denken objektiviert auch; in ihm steht der Sachverhalt (urteilsmäßig)
da, und ein neues Denken bezieht sich eventuell auf ihn und sagt „dies“,
„dieser Sachverhalt“. Das ist dann ein Denken zweiter Stufe, dem direkt ein
Denken und mittelbar ein schlichtes Vorstellen zugrunde liegt.
Nun scheint es sich aber weiter bei allen impressionalen (positionalen)
30 Akten ebenso zu verhalten. Wieder entnimmt ihnen das Denken einen Ge-
genstand, indem es an die Frage, den Wunsch etc. anknüpfend sagt „dies!“
und über das darin Gegebene prädiziert. I st al s o n i ch t ü b er a ll da s
D e nk e n das i m e ig e nt li c he n Si n n O bj e kti vier e n de? D a s D en k en
ist es, das der sinnlich schlichten Vorstellung und allen anderen Akten, auch
35 den Denkakten, den Gegenstand entnimmt, das heißt, dass es sagt und
aufgrund aller Akte sagen kann „dies da!“ und dass es das Dies dann
prädikativ weiter bestimmen kann, und zwar nicht so, dass etwa die Akte
zu Gegenständen werden – dazu müsste vielmehr ein Wahrnehmen dieser
Akte zu Grunde liegen, womit wir nur Denken auf Grund von Wahrneh-
40 mungen hätten –, sondern so, dass das Denken allen Akten ein Intentionales
entnimmt, genauso wie der Wahrnehmung, der schlichten Vorstellung. Das
30 zur intentionalität der objektivation

Intentionale „liegt“ also in jedem Akt, jeder ist Intention-auf, jeder hat
Richtung auf ein Gegenständliches, Richtung auf eine Einheit, die im Denken
zu einem Dies und einem so und so bestimmbaren und bestimmten wird.
Aber so einfach liegen die Sachen nicht, dass wir nun schon fertig wären
5 und alles klar hätten. Vor allem das ist zu überlegen, wie d as in te nd ie -
r e n de M e i ne n un d da s D e nk e n zu e in an d e r s te h en. Wie grenzen sie
sich gegeneinander ab?
Nr. 3

E i ge nt li c he s u nd u n eige nt l ic he s Ur tei l e n 1

§ 1. Das theoretische Meinen und sein Substrat. Leeres


Denken. Das Herausmeinen aus einem leeren
5 Akt ist Meinen und keine Vergegenwärtigung

Bisher hatten wir das theoretische Meinen immer betrachtet als ein
solches, das sich in einem zugrunde liegenden „Erscheinen“ etabliert,
das aus einem Substrat herausmeint, das auch in Ungemeintheit für
sich leben kann. Kann nun nicht ein theoretisches Meinen ohne ein
10 derartiges Substrat bestehen? Ist das nicht beim „leeren“ theoreti-
schen Meinen, beim „bloß symbolischen“ der Fall? Wie verhält sich
also das „volle“ und das „leere“ theoretische Meinen (oder Denken
im prägnanten Sinn)?
Auch das „leere“ Meinen (das leere Denken) hat sein „Substrat“
15 im ersten Sinn, nämlich so verstanden, dass das leere Denken wie
jedes Denken etwas denkt, darin etwas bedeutet. Das „volle“ meint
aus einer Erscheinung etwas heraus, setzt, fasst es als Subjekt etc., und
die „Erscheinung“ kann auch Erlebnis sein, ohne als Denkfundament
zu fungieren.
20 Wie ist es aber beim leeren Denken, ist es auch ein Herausmeinen,
überhaupt ein Meinen auf einem „Grund“, nur dass dieser Grund,
das fundierende „Erscheinen“, ein leeres ist? Da ist zunächst zu
fragen: a) Gibt es zunächst zu jeder Sorte von intentionalen Er-
lebnissen einen Gegensatz von „vollen“ und leeren? b) Gibt es so
25 etwas wie Herausmeinen aus leeren Nicht-Meinungen, kommt es vor
als Möglichkeit, dass aus einem leeren, nicht-theoretischen Akt eine
Gegenständlichkeit herausgemeint wird?
Was nun das Erste anlangt, so ist zunächst vor Verwechslung zu
warnen. Wir nennen ein Denken ein leeres, weil es sich auf dem Grund
30 einer Leervorstellung, eines Leeraktes aufbaut. So wenigstens, wenn

1 Wohl 1910/11. – Anm. der Hrsg.


32 zur intentionalität der objektivation

die aus b) zu erwägende Möglichkeit besteht. Es ist aber die Frage, ob


das Denken selbst darum in demselben Sinn „leer“ ist, wie das, was
es fundiert. Es fragt sich also zunächst, was wir als Leermodifikation
definieren und welche Beispiele wir zugrunde legen.
5 Wenn nun das Meinen aus einem leeren Akt herausmeint, wenn
ein objektivierendes Setzen sich dem verborgenen Gegenstand eines
Aktes zuwendet und ihn dem „Auge des Geistes“ offenbart, den
verborgenen zum offenbaren Gegenstand macht,1 so ist natürlich
das Meinen unter allen Umständen eben ein Meinen und nicht eine
10 Vergegenwärtigung. Wenn das Meinen sein Substrat in einem leeren
(dunklen) V e rgegenwärtigen hat, so ist es nicht selbst ein Vergegen-
wärtigen und gar ein leeres.
Wir haben also eine fundamentale Unterscheidung zu machen und
terminologisch zu fixieren:
15 1) die dunkle Vergegenwärtigung;
2) die Apprehension (im Gegensatz zur Prehension) in den appa-
renzialen Akten. Der Gegensatz, der hier besteht zwischen „Fülle“
und „Leere“ (das Leerstück der Apprehension, wenn wir das ganze
Phänomen selbst Apprehension nennen);
20 3) das „Denken“, das setzende und synthetische Meinen, das
theoretische Bewusstsein, das sich auf dem Grund einer dunklen
Vergegenwärtigung etabliert und eventuell auf einem apprehensiven
Grund. Im letzteren Fall geht „innerhalb der Apprehension“ ein
Spiel von dunklen Vergegenwärtigungen vor. Das ist ein eigenes
25 Phänomen. Wenn wir uns der Rückseite dieses Tintenfasses zuwen-
den, treten Vergegenwärtigungen auf, lebendige oder unlebendige,
dunkle. Aber es ist die Apprehension festgehalten, und es deckt sich
in der „Erfüllung“ die Tintenfasswahrnehmung hinsichtlich ihrer Ap-
prehension mit der Rückseitenvergegenwärtigung, einer bevorzugten
30 aus der Mannigfaltigkeit. Bezeichne ich dies da als Tintenfass, so mag
ich sogar sagen „quadratisch“ etc., ohne dass Vergegenwärtigungen
eintreten. Die Setzung richtet sich auf das ganze Objekt und darin
liegt, sie lebt sich in den Akt ein, entnimmt ihm das Objekt, wo-
bei die Apprehension natürlich mit ihre Rolle spielt, nur nicht eine
35 abgesonderte.

1 Verborgener – offenbarer intentionaler Gegenstand.


text nr. 3 33

Das denkende (objektivierende) Meinen ist in je de m Fall keine


Vergegenwärtigung, weder eine klare noch eine dunkle, und nennen
wir es ein unklares Denken, so heißt das: ein Denken, das sich auf
einem unklaren Grund etabliert.
5 Andererseits, w i e jed er A k t A ha t au ch da s D en ken se ine
ver geg enw är t i gen d e Mo d if i ka t i o n R(A), und wie jede andere
R kann diese auf t au c h e n und im inneren Bewusstsein bewusst
sein, ohne dass sie oder ihr Objekt oder das Objekt ihres Objekts
(die Rede vom Objekt ist freilich impliziert zu nehmen) g e m ei nt
10 ist. In der Reproduktion einer meinenden Wahrnehmung ist das
Meinen eines Dinges reproduziert. Das sagt aber nicht, dass ein
wirkliches, impressionales Meinen sich dem vergegenwärtigten Ge-
genstand zuwendet. Und geschieht das, so ist dieses impressionale
Meinen und das demselben Gegenstand zugerichtete vergegenwär-
15 tigte Meinen (Quasi-Meinen) zu unterscheiden. So kann ich mich
auch erinnern, ohne dem Erinnerten zugewendet zu sein (die Erin-
nerung regt sich, lebt auf, aber im Hintergrund des Blickfeldes des
„Meinens“).
Die frühere Zuwendung kann ich mir in den meinenden Blick
20 bringen, aber die jetzige Meinung, das Hinblicken, Betrachten des in
der Wiedererinnerung vor mir ablaufenden Vorgangs ist nicht bloß
Reproduktion der früheren Wahrnehmung. Es deckt sich damit, aber
ein Strahl von Aktualität geht da durch (bzw. ein wirklicher Aktstrahl
und nicht ein bloßes Aktphantasma etc.).
25 Wie ist es nun, wenn sich ein „Gedanke regt“, während ich anderen
Dingen zugewendet bin? Und zwar wenn sich eine Überzeugung
regt?1 Das kann besagen: Ich habe schon die aktuelle Überzeugung
und die ist Meinung, ein objektivierender Akt. Aber es bestehen
noch Unterscheide zwischen thematischer Überzeugung und nicht-

1 Das, was hier ausgeführt ist, kann leicht missverstanden werden. Ich hatte immer

gesagt: „aktuelles“ Meinen. Was ich sagen wollte, war: ein Akt des Meinens (= Im-
pression), ein jetziger, wirklicher Akt, im Gegensatz zu der eventuellen reproduktiven
Vergegenwärtigung eines Meinens, das in der Erinnerung und dgl. liegt. Der Akt des
Meinens, der zum Feld des inneren Bewusstseins und nicht zum Feld der Reproduktion
gehört, kann aber den Modus des Glaubens haben (einen Modus der „Aktualität“
unter anderen) oder den des „bloßen Sich-Denkens“ (Inaktualität), so wie ich das
Urteil als „bloßes Phantasie-Urteil“ haben würde.
34 zur intentionalität der objektivation

thematischer. Sie liegt noch nicht in der Linie meiner thematischen


und mich jetzt beherrschenden Interessen und des Hauptzugs thema-
tischer Tendenzen.

§ 2. Das Urteil und seine retentionale Modifikation.


5 Festhaltung und Nachdauer der Meinung
gegenüber Nachklang ohne Festhaltung. Die
wiedervergegenwärtigende Rückkehr zum Festgehaltenen

Es ist auch Folgendes zu beachten: Wenn ich jetzt urteile und dann
mit Urteilen fortgehe, s o e r f ähr t d as Ur t eil , da s ic h v or hi n
10 f ä l l t e , s e i ne re t e nt io na l e M od i f ika t i on, un d e s si nk t a uc h
i ns Du nk e l h e ra b. W as b e sag t d ies es D un kel ? Ve r w and el t
e s s i c h i n e i n e V e rg egen w ä rt ig un g? -- Ne in. Solange es noch
„da“ ist, noch bewusst, noch festgehalten sogar, solange ist es keine
Vergegenwärtigung, sondern eine Ret en ti o n, aber eine leere. Im
15 „Herabsinken“ des gefällten Urteils nimmt seine Lebendigkeit ab,
und es wird schließlich zu einem leeren. Also Retention (auch leere)
gehört in die impressionale und nicht in die reproduktive Sphäre.1
Nun haben wir zwei Fälle: 1) Ich objektiviere, ich meine und
gehe Schritt für Schritt im Meinen weiter.2 Indem ich das tue und
20 „Synthesis“ vollziehe, übe ich in gewissem Sinn Retention, nämlich
andauerndes Festhalten, Durchhalten der Meinung. Von Retention
der Meinung wollen wir besser nicht sprechen, sondern von Fest-
haltung, Nachdauer der Meinung als solcher. In diesem Sinn haben
wir zwischen a) dem Vollzug eines meinenden Schrittes im Ein-
25 schnappen der Spontaneität, dem Neuvollzug einer Objektivierung,
dem Einsetzen einer solchen und jedes neuen Gliedes einer sol-
chen, und b) andererseits dem Fe s t h a l t en d e r M e i nu ng, No c h-
Me i n e n, Im-Rahmen-der-sich-durchführenden-Meinung-Halten zu
unterscheiden.

1Doppelsinn von Retention siehe unten, leere Retention bzw. leeres Abklingen des
Urteils.
2 Erster Sinn von Retention: Festhalten der Meinung.
text nr. 3 35

2) Ich gehe zu einem neuen Denken über, mein Interesse wendet


sich anderem zu.1 Mein Thema ändert sich; dabei aber habe ich noch
N ac hk lang der soeben vollzogenen Objektivationen (Retention im
gewöhnlichen und echten Sinn, sagen wir N a ch ge ge nw är t ig ung,
5 Nachleben). Aber ich halte sie nicht fest, beziehe sie nicht ein in meine
Meinung. Ich meine nun also nicht mehr, was ich vorhin gemeint hatte.
Das Meinen lebt noch nach, aber es ist kein „Vollzug des Meinens“
mehr (kein Akt im allerengsten Sinn). Aktvollzug ist Andauer des
Aktes, der als spontane Setzung anfängt, aber als „Festhalten“ im-
10 mer noch ist und dauert, ungleich der „Retention“ des Nachlebens,
die nur Bewusstsein des eben gewesenen Aktes ist, aber nicht mehr
gegenwärtiger, fortdauernder Akt.
Es fällt das nicht ohne weiteres mit der Änderung des Themas
zusammen. Es kann sein, vielleicht, dass ich noch daran hängen bleibe,
15 während schon ein Interesse sich Neuem zuwendet. Doch wird man
dann sagen, dass ich solange noch das alte Thema habe, während das
neue sich schon auftut.
Es ist ferner zu sagen, dass ein Festhalten bestehen kann (innerhalb
eines thematischen Zuges), ohne dass das Festgehaltene als synthe-
20 tisches Glied sich in den Zug des neuen Urteils schon einordnet. Ich
vollziehe einen synthetischen Zug und komme zu einem Resultat. Ich
beginne einen neuen, halte aber noch fest: Das Resultat dürfte sich
noch als wertvoll erweisen für das Spätere, dürfte in einem künfti-
gen synthetischen Zusammenhang noch eine Rolle als synthetisches
25 Glied spielen.
Dabei aber ist zu bemerken: Das Zurückkehren zu dem dunkel
Festgehaltenen ist natürlich ein Wiedervergegenwärtigen, falls ich
es lebendig wieder erneuere. Wie ist es, wenn ich den meinenden
Blick zurückwende? Es ist doch zunächst ein Unterschied: ein Mei-
30 nen, das im Neuvollzug objektivierend fungiert, und das „Noch-
Festhalten“ am Meinen, wenn ich abgewendet war, den primären
Blick auf anderes inzwischen gerichtet hatte. Rückkehr ist Neuzuwen-
dung, ist Objektivieren in dem ausgezeichneten Sinn des Neusetzens
auf dem Grund der Noch-Meinung, mit der sich eventuell in identifi-
35 zierender Deckung ein Reproduzieren verbindet. Das Die-Meinung-

1 Nachklang, Nachgegenwärtigung.
36 zur intentionalität der objektivation

Festhalten, etwa eines soeben gefällten Urteils, kann in doppelter


Form statthaben: Entweder ich gehe weiter, um etwas anzuknüpfen,
oder ich halte, etwa bevor ich weitergehe, den Blick des Meinens fest
auf das Geurteilte gerichtet. Im letzteren Fall habe ich fortdauernd
5 primäre Zuwendung. Im anderen Fall zwar Festhaltung, aber zugleich
Abwendung des Blickes.

§ 3. Die Regung eines Gedankens. Das nachlebende,


abklingende Urteil als Urteilsmodifikation
gegenüber dem aktuell sich vollziehenden
10 Urteil. Das Entnehmen des Intentionalen aus
einem unlebendigen Phänomen in einem Zug

Wenn sich nun ein Gedanke regt, wenn ich einen Einfall habe,
ehe ich aber ihn mir „zu eigen“ gemacht habe, so haben wir in
ähnlicher Weise einen Modus von Objektivation, der doch noch nicht
15 Objektivation in ganz besonderem Sinn ist. Ich folge etwa der Erörte-
rung des Buches, vollziehe die Urteile, oder folge den Argumenten
des Vortragenden, und es regt sich ein Gedanke (etwa ein Einwand
oder eine Bekräftigung), und nun erst wende ich mich ihm zu und
„vollziehe“ den Gedanken, der nun erst rechtes Leben gewinnt. Soll
20 man sagen, das sei, dieses Sich-Regen, eine Art von Vergegenwärti-
gung? Es kann ja allerdings Wiederaufleben einer früheren, früher
von mir vollzogenen Einsicht sein.
Allgemein zu reden ist die Vergegenwärtigung, deutlicher, di e
R epr o du k ti o n e i n e r f r ü h e r en W ah r ne h mu ng , ü be rh au pt
25 e i ner fr ü h e re n S e t z u ng , Gr u n d fü r e i ne E r ne ue r un g d e r
S e tzu n g se l b st. Ich erinnere mich, das meint in der Regel bei
solchen Objektitäten, ich reproduziere nicht nur, ich werde im All-
gemeinen nun auch glauben, nämlich an das früher Gesetzte, an das
„Gewesene“. Ebenso Reproduktion eines Urteil führt in der meinen-
30 den Zuwendung zum früher Geurteilten zu einer neuen Setzung, ich
urteile wieder. (Gehört da ein Wesensgesetz dazu, dass mindestens
eine Motivation hier vorgezeichnet ist? Das früher Geurteilt-Haben,
phansisch gesprochen die Vergegenwärtigung, notwendig ein Motiv
für die neue Setzung?) Also wenn ein Gedanke, eine Meinung auf-
35 taucht, so wird es vielfach eine frühere meiner Meinungen sein. Das
text nr. 3 37

Auftauchen kann aber auch eine Vergegenwärtigung im weiteren


Sinn sein, ohne Erinnerung zu sein, also keine Reproduktion im Sinn
einer Erinnerung.1 So kann aber doch das Phänomen ähnlich sein, es
kann das Vergegenwärtigte Seinscharakter haben.
5 Das ist aber jetzt eine schwierige Situation. Vollzieht nicht das Ur-
teil erst die Seinssetzung? Ist aber eine solche „Vergegenwärtigung“,
mag es auch Vergegenwärtigung einer „Aussage“ sein, wenn ich nicht
vollziehend mich betätige, also meinend der Sache zugewendet bin,
ein Urteilen?2 Im Festhalten nach dem Urvollzug des Urteils haben
10 wir eine Modifikation des Urteils, die noch Urteil ist. Warum ist
nicht ebenso eine Antizipation, ein modifiziertes Urteilen vor dem
Urteilsvollzug, eine eigene phänomenologische Art?
Es scheint, dass wir etwa so auszuführen hätten. Das nachlebende,
abklingende Urteil ist ein eigentümlich modifiziertes Phänomen ge-
15 genüber dem aktuell sich vollziehenden Urteil. Es ist kein Urteil
mehr, kein Urteilsmeinen. Aber das gehört zum Wesen jeder solchen
sich an das Urteilen anschließenden Modifikation, dass da das Sein
des Sachverhalts zu entnehmen ist.3 Ich kann ein neues Urteil, eine
neue Setzung etablieren, die jetzt eine entnehmende ist aus diesem
20 einheitlichen Phänomen und die im „Wesen“ sich deckt mit dem
ursprünglichen und etwa in voller Gleichheit wieder zu vollziehen-
den Urteil. Ich führe den Beweis und habe nun einsichtig den An-
schlusssatz geurteilt, in einem bestimmten Vollzug. Nachher tritt die
Modifikation ein, ich blicke darauf zurück, während ich es noch fest-
25 halte und sage e n t n eh m e n d: Weil das nun so ist usw. Das wirkliche
Urteilen knüpft zusammen, das verknüpfte „Ganze“ ist nun eines, das
zurücksinkt und immer verworrener wird. Was im wirklichen Vollzug
gebildet war, eines auf das andere in lebensvoller Aktion (Setzung)
sich bauend, das ist nun ein unlebendiges Phänomen, aus dem sich
30 einheitlich ein „Dies“ entnehmen lässt, ein Entnehmen in einem Zug.
So können wir überhaupt Phänomene haben, die den Charakter
von Urteilsmodifikationen besitzen, in denen ein Meinen zwar nicht

1 Freilich ob es wirklich mit in den Rahmen des allgemeinen Begriffs der Vergegen-

wärtigung gehört? – Nein.


2 Warum denn Vergegenwärtigung?! Das Bewusstsein hat dabei doch nicht den

Charakter eines Vergegenwärtigens eines Nicht-Gegenwärtigen!


3 Nein. Nachleben ist nicht Festhalten. Das Gesagte gilt nur vom Festhalten.
38 zur intentionalität der objektivation

aktuell, „lebendig“ aktiv vorliegt, die aber Modifikationen desselben


enthalten. Und nun kann sich ein Meinen dem darin „verborgenen“
Intentionalen zuwenden; es kann, ohne dass die Meinung, die da in
Modifikation bewusst ist, wirklich neu, in neuer expliziter Aktivi-
5 tät vollzogen und eigentlich aktualisiert wird, ein Meinen vollzogen
werden, das i n ein em Üb e rsc hl a g, in einem Zug das Intentionale
meint, und diese Meinung ist dann gleichwertig dem Urteil und kann
in das Urteil (in den expliziten Vollzug) eventuell auch übergeführt
werden.
10 Wir können sagen, es sei zu unterscheiden zwischen expliziten und
eigentlichen Urteilen (lebendigen, aktiven), spontanen Urteilsvollzü-
gen und modifizierenden Gebilden, uneigentlichen, nicht-expliziten.
Genauer: Objektivierende Meinungen sind es. Es ist etwas gemeint.
Aber während das explizite Urteil als Urteilssynthesis sich in be-
15 stimmter Weise durch objektivierende aktive, lebendige Schritte auf-
baut und in jedem Schritt Phänomene voraussetzt, Akte als Ob-
jektivationssubstrate, dient dem inexpliziten Urteil eine verworrene
Reproduktion1 überhaupt, eine verworrene Urteilsmodifikation als
Objektivationsfundament. Ich höre z. B. einen Satz, vollziehe die
20 Verständniseinheit in verworrener Weise2 und das Ganze hat Ak-
tualitätscharakter; ich vollziehe daraufhin setzende Meinung. Das
ganze Phänomen könnte in demselben Charakter „genauso“ ohne
Meinung bewusst sein, wie eine Wahrnehmungserscheinung es sein
kann ohne wahrnehmendes Meinen oder eine Erinnerung. Überall
25 kann ich das Meinen nach dem Substrat orientieren und komme zu
einer objektivierenden Setzung.

§ 4. Unlebendiges, passives Urteilen als eine


Modifikation des lebendigen, aktiven Urteilens. Der
Vollzug der Urteilssynthesis und ihr Ergebnis

30 Es ist allerdings mehr als fraglich, ob das hier Dargestellte genug


präzise und ausreichend ist. Aber Gutes ist wohl darin, wenn ich

1 Es ist fraglich, ob immer eine Reproduktion.


2 Aber doch nicht als Reproduktion.
text nr. 3 39

nur wieder herausstreiche, was ich vorhin versuchte, als ob es sich um


Vergegenwärtigungsmodifikationen und Analoga derselben Urteile
handeln müsste. Es gibt sozusagen un lebe n di ge s , pas s iv es , re -
z ep t i ves , n i c h t w i rk li c h spo n tan e s U r te i l e n al s e in e Mo d i-
5 f ik at io n d es l e ben d ig en , a kt i ven , wi rkl i ch s et ze n de n, d ar-
a uf hi n - se tz en d en , bez i eh e nd en , b eg re i fe nd en un d zu s am -
m e nb e gre if en den u sw . U r t ei le n s. Das bloß passive Lesen, das
bloß passive Aufnehmen, das Urteilen in Form der Verworrenheit,
diese verworrenen Urteilsphänomene, „die verstandenen und gläu-
10 big aufgenommene Sätze“: Das deutet eine Weise des Bewusstseins
der Sätze an, die einige Analogie hat mit einem verworrenen Phä-
nomen einheitlicher sinnlicher Erscheinung. Dazwischen kann sich
ein lebendig-explizites Denken anspinnen. Ich vollziehe, wenn auch
in einem verworrenen Medium, in „Hinblick“ auf das einheitlich
15 verworrene Verständnis des gehörten Satzes, eine einheitliche Set-
zung und urteile etwa wirklich: „Daraus folgt das und das“. Oder ich
verstehe in einem Verworrenen eins und stimme zu: Ja! Es ist dabei
noch der Unterschied, ob ich passiv hinnehmend höre oder lese, wobei
ich „a u f me rk s a m bin“, oder ob ich eine Gedankenrichtung habe,
20 die mir als verworrene Einheit durch den Kopf geht, während ich
no c h ni ch t a u f m e rk s a m b i n. Zu beachten ist hier immer dabei,
dass es sich um eigentümliche Modi des theoretischen Meinens, des
Urteilens handelt.
Man wird da Mehreres auseinanderhalten müssen.
25 1) Die aktuelle Setzung und Darauf-Setzung, der Vol l z ug der
Urteilssynthesis Schritt für Schritt, in lebensvoller Aktivität, Sponta-
neität.1
2) Nach Abschluss des letzten Schritts die Summe, das Er ge bni s,
das als Einheit dasteht, das ist, ein mit dem Abschlussschritt lebendi-
30 ges und seinem Wesen nach diesen Prozess voraussetzendes Meinen
wird „fe st g e h a lt e n“, und während das Phänomen abklingt, kann
darauf weiter gebaut werden.2 Es kann auch, wenn es sich um das
Schlussglied eines Beweises handelt, ein Rü ckb l i c k auf den Be-
weis in seiner, im nachlebenden Bewusstsein gegebenen, aber nicht

1 Urteil als spontaner Akt.


2 Das Urteil als Ergebnis.
40 zur intentionalität der objektivation

mehr Aktives enthaltenden Einheit (die Schritte sind jetzt nicht mehr
wirkliche Schritte, sondern Modifikationen von ihnen gehören einer
passiven Einheit an) vollzogen werden. Ein m ei ne n de r, s e tze n de r
Blick setzt jetzt das Ganze, „entnimmt“ aus dem Phänomen des
5 Nachbewusstseins den Gegenstand. Dabei ist im Allgemeinen v on
V erw o r ren h ei t k ei n e Red e oder braucht nicht die Rede zu sein.
Ich urteile „S ist p!“ und knüpfe daran „Diese Tatsache!“ Ich blicke
also auf das „Ergebnis“ hin oder zurück und mache die Tatsache zum
Subjekt-worüber neuer Urteile.
10 Aber das bleibt bestehen, dass zwischen dem lebendigen Aufein-
andersetzen und dem Resultat (das im letzten Setzungsschritt ein
Bewusstsein nicht sosehr vollendet, als aufgrund der nachlebenden
Schritte erst gewinnt – das Bild mit dem Bau ist eigentlich schlecht)
zu unterscheiden ist und dass dieses Endbewusstsein immer mehr an
15 Leben und Deutlichkeit verliert. So wie der Schlussschritt vollzogen
ist, beginnt schon das Verschwimmen und Verworrenwerden, ein
stetiger Prozess. Aber es ist ein Bewusstsein, aus dem durch neue
meinende Blicke Verschiedenes entnommen werden kann. Vor al-
lem das gegenständliche Korrelat des Ganzen kann nun Gegenstand,
20 „Vorgestelltes“, „Erfasstes“ werden.
3) Etwas anderes ist das v er wo rre n e B ew u ss t se i n, das nicht
bloß nachlebendes Bewusstsein eines ursprünglichen Lebens, eines
„wirklichen Vollzugs“ ist. Ich meine da s B e w us st s e in ei n es
Sa t ze s , d a s V e r st e he n i m Le s e n un d v e r w or r en e „ U r tei -
25 l e n “ i m L e s e n. Hier baut sich ja auch wie aus Worten der Satz,
so aus Gedanken das Verständnis auf, und fü r j e d e s Ver m e i nen ,
f ü r j e d e n A kt , d e r s i c h z e i t l i c h a u f b au t, g i l t d a ss e lb e w i e
da s , wa s w ir z um Ur t e i l e n g es a g t h a be n, e r h a b e e i ne n
Ab sc hl u ss , e i n Er g e bn i s e t c.
30 4) Und wieder etwas anderes sind sich „regende Gedanken“. Und
dabei ist 5) zu fragen, wie es sich mit Vergegenwärtigungen von
Meinungen verhält, die offenbar notwendig explizite Vergegenwär-
tigungen im „Wiedervollzug in der Erinnerung“ sind oder explizite
Phantasierungen als „Vollzug in der Phantasie“ oder andererseits
35 einheitlich vage Vergegenwärtigungen ohne expliziten Vollzug „in“
der Vergegenwärtigung.
Frage: Wie stehen diese, insbesondere die letzteren zu den Be-
deutungsintentionen der Ausdrücke? Und wie ist, was sub 3) aufge-
text nr. 3 41

führt ist, das Sich-Aufbauen der Bedeutungsintentionen komplexer


Ausdrücke, prädikativer Aussagen und Aussagezusammenhänge zu
verstehen?
Nr. 4

The mat i s ch es u nd un t h em a ti sc he s Be wu ss t se in .
D er U n t ers c h ied un d das V e rh äl t n i s zw isc he n
R ez ep t iv it ät u n d s ch öp fe ri sc he r Sp o nt an ei tä t 1

5 § 1. Intentionale Erlebnisse im weiteren und engeren


Sinn. Akte im prägnanten Sinn als Erlebnisse, in denen
ein einheitliches Sich-Richten-auf-Gegenständliches
statthat. Meinende Zuwendung und ihre Modi

Jeder Akt bezieht sich auf eine Gegenständlichkeit. Jedes Be-


10 wusstsein ist Bewusstsein von etwas.
1) Dieser Satz wurde, indem ich von B ren t an os Darstellung
zunächst ausgegangen bin, von mir so verstanden: Eine und dieselbe
Gegenständlichkeit kann eventuell intentionale sein für verschiedene
„Weisen des Bewusstseins“, für verschiedene Akte.
15 Dass S p ist, das denke ich mir; ein andermal urteile ich, dass S
p ist (ich urteile „S ist p!“). Wieder einmal wünsche ich: „S möge
p sein“. Wieder einmal frage ich: „Ist S p?“ usw. In allen diesen
Fällen bezieht sich ein Bewusstsein in verschiedener Weise, aber
auf eine und dieselbe Gegenständlichkeit „S ist p“, bloß denkend,
20 wünschend, urteilend, sich freuend etc. Von da ausgehend kam ich
auf die Ausbildung der Begriffe Materie und Qualität. Indem ich
diese „Gegenständlichkeit“, auf die sich der Akt bezieht, festhielt
und die Bewusstseinsweisen sich differenzieren ließ, sagte ich mir,
in den Erlebnissen selbst muss ein Gemeinsames sein, und dieses
25 Gemeinsame nannte ich die phänomenologische Materie.
2) B r e nt a n o ging wohl aus von der subjektiv psychologischen Be-
trachtung, indem er sich sagte: Im Bewusstsein, in Form verschiedener
Akte kann eine Gegenständlichkeit „intentionale“ („immanente“)
sein, und ist sie es dank eines Vorstellens, das sie zur Vorstellung
30 bringt, dann kann sich das Bewusstsein noch in verschiedenen weite-

1 März 1911.
text nr. 4 43

ren Weisen zu demselben immanenten Gegenstand verhalten. Er kam


so zur Lehre, dass jedes Bewusstsein entweder Vorstellung ist oder
eine Vorstellung zur Grundlage hat. Die phänomenologische Mate-
rie reduzierte sich für ihn auf einen konkreten phänomenologischen
5 Bestand: einen Vorstellungsakt. Das führt aber auf Schwierigkeiten.
Aber eins ist sicher, es gibt den Unterschied schlichten und fundier-
ten Bewusstseins, und dabei kann das fundierende und fundierte
Bewusstsein in der Tat von derselben „Materie“ sein. Nur meinte
ich, dass zwei Bewusstseinsakte, die dieselbe Materie in diesem Sinn
10 haben, keineswegs in diesem Verhältnis stehen und auch keineswegs
einen konkreten Akt, genannt Vorstellen, gemeinsam haben müssen,
der die identische Materie ausmache.1 Alle einfältigen – ich könnte
sagen: qualitativ einschichtigen – Akte derselben Materie rechnete
ich zu einer „Grundklasse“: Vorstellungen.
15 3) Die qualitativ einschichtigen Akte sind insofern objektivierend,
als alle anderen Akte ihnen die phänomenologische Materie und
damit die Beziehung auf die Gegenständlichkeit in gewissem Sinn
verdanken. Zunächst muss eine Gegenständlichkeit überhaupt vor-
stellig sein, dann kann sie für das Bewusstsein noch anderes sein.
20 Aber leider ist damit nicht gesagt, dass alle qualitativ einschichti-
gen Bewusstseinsarten von einer wesentlich einheitlichen Gattung
sind.
Es kann hier aber noch ein anderer Unterschied in Betracht kom-
men und so überhaupt, wenn von objektivierenden Akten die Rede
25 ist. Es kann dann angeknüpft werden an einen engeren Begriff von
Akt. In einem weiteren Sinn kann Bewusstsein von einem Gegen-
stand statthaben, ohne dass dieses Bewusstsein sich i m p rä g nan t e n
Si n n a u f e i n e Ge g e n s t ä n d li c hk e it „ r i cht e t “.
Ich unterscheide unter dem Titel objektivierende Akte im weite-
30 ren Kreis der intentionalen Erlebnisse eine engere Gruppe. 1) Im wei-
teren Kreis d i e s e r in t e n t i on a l e n E r l e bn i ss e üb er h a up t (Akte
im Sinn der Logischen Untersuchungen, im allerweitesten Kreis
also) scheiden sich: 2) A k t e i n e i n e m pr ä g na n t e n und e ng e r e n
S in n, Erlebnisse, in denen ein e i g e n tl i c he s Si c h- Ri c ht en -a uf -

1 Qualitativ einschichtige Akte, deren Gesamtmaterie nicht mehrere Qualitäts-

schichten hat.
44 zur intentionalität der objektivation

G egenst änd li c h es statthat.1 Jedes intentionale Erlebnis ist Be-


wusstsein von etwas, mag es sich auch z. B. um eine Hintergrundwahr-
nehmung handeln. Es „bezieht“ sich auf das, wovon es Bewusstsein
ist, und so heißt es „intentionales“, gleichsam sich-darauf-richtendes.
5 Aber eigentlich gerichtet sind wir nur in solchen intentionalen Er-
lebnissen auf dieses Was, in denen wir diesem Was zugewendet sind.
So z. B. sind wir einem Gegenstand, den wir betrachten, zugewendet.
Die umgebenden Gegenstände sehen wir auch, sie sind für uns be-
wusstseinsmäßig da, wir sind ihnen aber nicht zugewendet, wir sind
10 nicht auf sie in einem spezifischen Sinn gerichtet.
Also hier ist zunächst an jeden Fall schlichter Aufmerksamkeit
(in der Sphäre schlichter Perzeptionen) zu denken. Es sind hier
mehrere Unterschiede zu beschreiben: Dasjenige, dem wir nicht
im eigentlichen Sinn zugewendet sind, kann dem völlig vagen Hin-
15 tergrund angehören, es kann aber auch schon me r kl i ch sein, in
gewisser Weise abgehoben sein gegenüber dem letzten Bewusst-
seinshintergrund. Und es kann sich stufenweise vom Hintergrund
etwas abheben, merklich werden, und dann der Strahl der Zuwen-
dung hineinleuchten. Hierbei haben wir gewisse zu beschreibende
20 phänomenologische Abwandlungen.
Diese Zuwendung kann man auch bezeichnen als Z um - Th e m a-
M a c he n (im ersten Sinn: der bloßen Aufmerksamkeit); das thema-
tische Objekt ist aufgemerktes und nicht bloß bemerktes, so in der
Sphäre der schlichten Perzeptionen; und Ähnliches, wird man sagen,
25 gilt in der Stufe der höheren, der spontanen Akte, der Synthese etc. Es
ist aber der Begriff der Zuwendung noch durch Hinzunahme einiger
ihr zugehöriger Unterschiede zu bestimmen.
Es ist ein Unterschied zwischen der Sph ä re de s Me r kl ic he n,
des Abgehobenen, durch das kein Strahl der Zuwendung hindurch-
30 geht und eventuell soeben hindurchgegangen ist, und der Sphäre
des N oc h -F e s t ge h a l t en e n, dem soeben eine Zuwendung Gunst
erteilte. Oder, wie wir ebenso sagen können: Wir müssen unter dem
Titel „thematischer Akt“ unterscheiden das primäre Sich-Zuwenden
bzw. Zugewendetsein (vom Übergangsphänomen des Sich-Zuwen-
35 dens sehen wir ab) und das nach Übergang zu einem neuen primären

1 Akt im prägnanten Sinn = cogito.


text nr. 4 45

Zugewendetsein zu anderem Noch-Festhalten, das sekundär thema-


tische. Das also nehmen wir zusammen, wenn wir von m ei n en d e r
Z u w en du ng und Sich-Richten-auf sprechen. Es hat, sagen wir hier,
Zuwendungsmodi, Modi des Meinens. Alles Objektivieren in dem
5 doppelten Sinn des Zum-spezifischen-Objekt-Machens und Zum-
Objekt-Habens gehört hierher. Ob das eine Beschränkung ist, da
wir von „hierher gehören“ sprechen, das werden wir ausführlich
zu erwägen haben; ob also Verschiedenheit der Akte jeder Klasse
Verschiedenheiten betrifft zwischen sich zuwendendem Denken, sich
10 zuwendendem Wünschen etc. und solchem, das es nicht ist, und
ebenso, ob der Begriff der Merklichkeit entsprechend zu erweitern
ist.
Wir betrachten eine Landschaft. Sie ist unser „Thema“; wir be-
trachten innerhalb ihrer Einheit nach und nach einzelne Baumgrup-
15 pen, Berge, Täler etc.1 Sie sind unsere Sonderthemen, ebenso die be-
sonders erfassten Beschaffenheiten, Momente derselben. Innerhalb
dieser thematischen Intentionalität treten hier dann Vorkommnisse
auf: Im fortschreitenden Einzelbetrachten wird das Gesamtobjekt,
aus dem wir Einzelnes herausnehmen und betrachten, nicht bloß
20 festgehalten (das Phänomen der Objektwahrnehmung bleibt nicht
ungeändert und steht nicht einfach neben den Phänomenen der Ein-
zelbetrachtung). Ohne dass der primäre Strahl der Zuwendung ande-
rem gilt als dem Einzelnen, erfährt das Objekt „Näherbestimmung“,
es „bereichert sich seine Intentionalität“ usw. (Diese zum Wesen
25 des thematischen Objektivierens gehörigen thematischen Funktionen
und Leistungen sind zu studieren.)
Die Rede von Zuwendung, von einem Strahl des Gerichtetseins-
auf usw. ist eine formale Rede. Sie hebt in der Tat gewisse allgemeine
Formen hervor, auf die wir aufmerksam sein können; aber mit ih-
30 nen gehen Hand in Hand funktionelle Wesensvorkommnisse in den
Akten, die vom Licht der Zuwendung durchleuchtet oder vielmehr
durch diesen Modus ein eigentümliches Leben und ein Spiel eigen-
tümlicher Leistungen empfangen oder, wenn man will, eine eigene
Leistungsfähigkeit.

1 Also nicht thematisch im Sinn anderer Manuskripte, also nicht im Sinn des theo-

retischen Interesses.
46 zur intentionalität der objektivation

Indem hier nun ein neues Leben lebt, organisiert sich in diesem
Leben Neues und Neues. Es konstituieren sich neue Objekte, was
eben sagt, dass die Akte sich nach ihrem Gehalt ändern und zu neuen
Aktgebilden organisieren; es bilden sich Synthesen und konstituieren
5 sich synthetische Objekte etc. In jeder Stufe, scheint es, haben wir
U nt er sc hi ede z w i sc hen Pri mär em und Se ku ndä r e m. Und
ferner, jedes solche Gebilde kann in den Hintergrund der bloßen
Merklichkeit oder in den letzten vagen Hintergrund rücken. Um-
gekehrt können Gebilde dieser Art schon im Hintergrund sein und
10 auftauchen, Zuwendung sich mit ihnen verbinden etc. Zuwendung
ist dabei zunächst etwas Einfaches, wie in der Stufe des schlichten
Aufmerkens; aber mehrfache Zuwendungen, das heißt, mehrere spe-
zifische Akte, die dieses Leben haben, in denen das Ich sich richtet
etc., können sich verbinden, so dass das Ganze wieder den Charak-
15 ter einer Zuwendung höherer Stufe hat (ein Akt höherer Stufe mit
fundierter Zuwendung) etc. Das ist das Feld der Studien.
H i ns i c h t l i ch d e r G em üt sak t e wäre von vornherein auf Fol-
gendes hinzuweisen. Betrachte ich eine Landschaft mit Wohlgefallen,
so wird es, wenn es „lebhaft“ ist, merklich sein, aber darum nicht
20 notwendig selbst Zielpunkt einer Richtung-auf. Andererseits wird
man zu sagen versuchen, d a s W oh l g e f a ll en s el b s t hat R i ch tun g
a u f di e La n d s c ha f t und nicht nur das Betrachten. Ebenso im
ästhetischen Wohlgefallen an einem Bildobjekt. Wieder, e i n Wi l le
r ic h t e t si c h , ei n Wu ns c h r i c h t e t s i c h. Damit hängen freilich
25 schwierige Problem zusammen. Wir lassen jetzt offen, wie weit diese
Analogie trägt.1 Wir sprechen nun speziell vom „thematischen“ nur
beim theoretischen doxischen Sich-Richten-auf, nur bei der theoreti-
schen Zuwendung und den theoretischen doxischen Akten sagen wir
vorläufig, dass in denen solch thematische Richtung waltet.2
30 3) W oh l u n t er s c h i e d e n halten muss man die thematischen (ob-
jektivierenden) Akte im bisherigen Sinn von den Akten des „Interes-
ses“, die spezifischen Objekte des Vorstellens und Denkens von
O bj e kte n d e s t h eo r e t is c he n I nt e r e ss e s (interessanten Objek-
ten). Einheit des „Themas“ im engeren Sinn, z. B. in meiner theore-

1 Ausschluss der Gemütsakte, also Beschränkung auf doxische Akte.


2 Engster Begriff von Thema (Sphäre des theoretischen Interesses).
text nr. 4 47

tisch-mathematischen Beschäftigung. Was ich als hierein gehörig und


nicht hierein gehörig charakterisiert habe etc. Bleibe beim Thema!
Aber auch: Sei aufmerksam! (Enger Begriff von Aufmerksamkeit.)
Das bleibe ausgeschieden.

5 § 2. Das thematische Meinen. Thema und


Gegenstand. Thematischer Inhalt und Charakter.
Thematisch schlichte Objektivation und sich
darauf bauende synthetische Objektivationen

Das thematische Meinen, eventuell mit seiner Grundlage, würde


10 dann einen p rä gn a nt en B e gri f f vo n obj e kt iv i er en d em Akt
definieren. Auf dieses baut sich in höherer Stufe als Gefallen, Wün-
schen ein „Akt“, in dem, was er Neues bietet, n oc h k ei n the m a ti-
s c h e s Me i n e n l e b t, er gehört noch zum Unbewusstsein und ist
doch ausgezeichnet durch sein besonderes Gerichtetsein. Aber je-
15 des Bewusstsein kann Unterlage für ein thematisches sein, und so
erwächst hier aus dem nicht-objektivierenden Akt des Wohlgefallens
ein objektivierender, in dem das thematische Objekt als wohlgefällig
thematisch da steht.1
Sehen wir genauer zu, s o s c he i d e t sic h d ie F unk ti on, d i e
20 zu m Th e ma m a c ht , v o n de m Be w u ss t s ei n, d a s d as The ma
h er g ib t, und zwar in dieser besonderen Weise, nach welcher nicht
das Erlebnis als phänomenologisches Datum zum Objekt wird (in
dem ein thematisch beseeltes, reflektives Anschauen sich darauf rich-
tet), sondern das Erlebnis durch ein thematisches Meinen Beseelung
25 erfährt und hierdurch ein Intentionales zum Objekt wird.
Nun ist auch diese Rede ungenau. Denn wir finden nicht identisch
dasselbe Erlebnis (von demselben phänomenologischen Gehalt), das
einmal eine beseelende Beigabe erfährt und das andere Mal nicht.
Vielmehr tritt eine gewisse Modifikation ein; es handelt sich um ge-
30 wisse Wesensveränderungen, die zur Einheit gebracht werden unter
dem Titel „Ein nicht von Aufmerksamkeit und thematischem Meinen

1 Also doxisch objektivierender Akt (sowohl aktuelles wie inaktuelles objektivieren-

des Bewusstsein) = thematisches Meinen (auch = theoretisches, doxisches Meinen).


48 zur intentionalität der objektivation

beseeltes Wahrnehmen etc. verwandelt sich in ein Wahrnehmen etc.,


das Träger eines thematischen Meinens ist“.
Man wird wohl sagen dürfen: J ed es Er le b ni s i s t B e w u ss ts e in
u n d l äs st d i e U mw an dl un g in ei n th em at i s ch me in end es zu,
5 und jedes ist wahrnehmbar und kann so selbst zum thematischen Ob-
jekt werden. Ein Phantasma kann im Hintergrund bleiben: Es kann
aber auch ein thematisches Betrachten des Phantasieinhalts stattha-
ben und wieder ein thematisches Betrachten des Phantasierens, wobei
ein Wahrnehmen sich auf das Phantasieren richtet. D i e Sph är e
10 d e r A uf m er ks am k eit u nd d es th e ma ti sc he n M e in e ns g i bt
e i ne n b e son d er en B eg r i ff vo n B ew u ss ts e in1 v or. Nennt man
dieses Meinen selbst Bewusstsein, dann ist es eine Funktion, die
bewusst im spezifischen Sinn macht, aber es ist kein konkretes Er-
lebnis. Es setzt immer einen Erlebnisgehalt voraus, eben das, was ein
15 Meinen von etwas, ein Konstituieren gemeinter Gegenständlichkeit
voraussetzt.
Man kann aber auch jedes konkrete Erlebnis, in dem die thema-
tische Funktion waltet, in dem also etwas thematisch bewusst ist, ein
meinendes, sich-richtendes, ein intendierendes Bewusstsein (einen
20 Akt) nennen und dann in der doppelten Weise, dass das meinende
Bewusstsein (das Meinen mit seiner Grundlage) objektivierendes
Bewusstsein heißt und ein fundiertes „Bewusstsein“, das sich auf
das Gemeinte richtet, intendierendes Bewusstsein im weiteren Sinn.
Das heißt, dass man 1) das thematische Meinen „Bewussthaben
25 von etwas“ im besonderen Sinn nennt, und das ist verwandt mit
dem Bewusstseinsbegriff aus der inneren Wahrnehmung, die nur
ein sehr besonderer Fall davon ist;2 2) dass man jedes Bewusstsein,
das solches zur Grundlage hat, Bewusstsein von etwas, genauer,
in te nd i e ren d e s E r le b n i s nennt.
30 Unter einem Be w u s s t se i n i m w ei t e r e n Si n n wäre dann zu
verstehen jedes Erlebnis, das entweder ein Meinen von etwas ist oder
das durch ein Meinen zu beseelen ist (wirklich patent intendierend –

1 „Bewusstsein“ als thematisches Meinen = objektivierendes Bewusstsein. Aktuelles

und inaktuelles, und dazu jeder Akt, der ein solches Meinen zur Grundlage hat.
2 Bewusstsein in diesem engeren Sinn = patentes Bewusstsein; im engsten Sinn

patente Objektivation.
text nr. 4 49

latente Intentionalität).1 Und zum Letzteren gehört auch der ausge-


zeichnete Fall, wo auf ein Meinen sich ein neues Erlebnis baut, darin
fundiert ist, das selbst wieder durch ein Meinen zu beseelen ist und
durch die Art, wie es als ein fundiertes Moment Erlebnis ist, ein
5 mit dem Fundierenden einiges Gegenständliches konstituiert. Das ist
freilich nicht gut genug gesagt. Ein „B ew us s ts ei ns c ha ra k ter“, ein
„Aktcharakter“ tritt zum thematischen Bewusstsein hinzu, „gerich-
tet“ auf Gegenständlichkeit, und wo immer das der Fall ist, da kann
eine neue thematische Gegenständlichkeit konstituiert werden, die
10 ein neues thematisches Moment der bisherigen hinzufügt, das das
gegenständliche Korrelat dieses Charakters ist. (Wir können den
Bewusstseinscharakter auch i nt en t ion ale n C ha ra kt e r nennen,
er „gewinnt“ ja Intentionalität. Besser „Bewusstseinscharakter“ als
intentionaler Charakter.)
15 Im Übrigen muss bemerkt werden, dass Aktcharakter (= Be-
wusstseinscharakter im weiteren Sinn) hier nicht gegenübergestellt
werden soll irgendeinem phänomenologischen Inhalt des konkreten
Aktes, der nicht Aktcharakter ist. (So wie ich das früher hinsichtlich
der Empfindung getan habe.) Vielmehr lassen wir es offen, ob
20 nicht notwendig jedes Bestandstück von Bewusstsein selbst wieder
„Bewusstsein von“ ist2 und ob nicht alles, was wir unter dem Titel
Empfindungsinhalt als adäquat gegebenes Nichtbewusstsein bezeich-
nen, nicht hier wie überall bloß adäquat Herausgemeintes aus einem
Bewusstsein ist. Was sagt aber dieses „bloß“? Das würde sagen, dass
25 z. B. das, was wir Bewusstsein nennen, nicht seinerseits wieder be-
wusst ist (wahrgenommen, empfunden etc. ist), dass dagegen, was wir
Empfindungsinhalt nennen, nicht Bewusstsein, aber aus Bewusstsein
zu entnehmen ist und nur in diesem Sein besteht. Es ist darum doch
Seiendes, aber dieses Sein liegt in einer anderen Linie. (Es ist, was
30 es ist, nur als intentionales Sein.) Bewusstsein selbst aber ist nicht
intentionales Sein, sofern wir sagen können, es ist zwar zum intentio-
nalen Objekt zu machen, aber es ist nicht bloß intentionales Korrelat.

1 Endlich: Bewusstsein im weiteren Sinn = teils nicht wirklich intentionales und

teils wirklich intentionales oder latent intentional und wirklich intentional. Oder auch
„Bewusstsein“ ist latentes und patentes.
2 Intentionaler Charakter ist dagegen nicht „Intention“, könnte man sagen.
50 zur intentionalität der objektivation

Empfindungsinhalt ist kein reelles Bestandstück von Bewusstsein,


sondern aus Bewusstsein adäquat als Gegebenheit zu entnehmen.
Ein thematisches (objektivierendes) Bewusstsein ist au f et w as
al s „ The m a “ ger ic h t et,1 z. B. ein thematisches Wahrnehmen auf
5 das Wahrgenommene, ein Urteil „Dieses Papier ist weiß!“ auf: Dieses
Papier ist weiß. D a s T h em a u n ters c he i de n w ir v om G e ge n-
st an d. Im Urteilen steht das „Urteil“ im logischen Sinn da (die
„vermeinte Wahrheit“) als das, worauf das Urteilsbewusstsein „th e -
m at i sc h ger ic h t et“ ist, während wir vom „Sachverhalt selbst“
10 sagen, dass auf ihn das Bewusstsein o b j ek tiv g er ic ht e t, dass dieses
in ihm intendiert ist.2
Das Thema lässt eine Unterscheidung zu in t he m a t is ch en
I n ha l t (thematische Materie) und „Ch ara kt er“, m oda l e Qu al i-
f i z i e r u n g d e s Th em a s. Und diese Q u al if i zi er ung ka nn en t-
15 w e de r a k tu e l l e o d er ged a nk enh af t mod i fi zi e r te se in. Und
all dem entsprechen parallele phänomenologische Unterschiede.
Mehrere „intentionale Erlebnisse“ können phänomenologisch
sehr verschieden sein (z. B. Unterschiede der Lebendigkeit und An-
schaulichkeit), aber vom identisch selben Thema sein, und sie kön-
20 nen zwar verschiedene Themen haben, aber Themen von demselben
thematischen Inhalt, so dass sie sich thematisch nur durch die mo-
dale Qualität unterscheiden. So zunächst für bloß objektivierende
Erlebnisse. Ferner können mehrere intentionale Erlebnisse, die nicht
bloß objektivierend sind (aber als intentionale solche zur Grund-
25 lage haben), sich ebenso verhalten, wie wir in den vorstehenden
Unterschieden angegeben haben. Sofern wir die Möglichkeit finden
werden, den Begriff des Themas zu erweitern, können wir auch von
theoretischem (objektivierendem) Thema sprechen, und somit sind
diese Vergleichungen und Unterscheidungen, von denen soeben ge-
30 sprochen war, nur auf ihren doxisch-theoretischen Gehalt bezogen.

1 Als „Thema gerichtet“ besagt „zugewendet“, im eigentlichen Sinn „gerichtet“.

Ein jedes intentionale Erlebnis „bezieht“ sich auf Gegenstände, und schon da könnte
man von „gerichtet“ sprechen; aber erst in der „Zuwendung-zu“ haben wir Richtung
im ausgezeichneten Sinn. „Thematisch gerichtet“ darf also nur jenes im eigentlichen
Sinn Gerichtetsein besagen und dabei nicht etwa das „mit Interesse gerichtet“. Diese
Einschränkung ist hier nicht in Frage.
2 Der Gegenstand selbst, wenn wir voraussetzen, dass er existiert.
text nr. 4 51

Es gehört eben zum Wesen der intentionalen Erlebnisse, dass sie


gegenständliche Beziehung in dem Sinn haben, dass sie sich vermöge
einer Richtung auf ein objektivierendes Thema auf Gegenständliches
beziehen, und das nicht nur insofern, als die objektivierenden Akte
5 ihrer Unterlage es tun, sondern es hat einen phänomenologisch guten
Sinn von der Richtung auch der fundierten Bewusstseinscharaktere
auf das theoretische Thema bzw. auf die Gegenständlichkeit zu spre-
chen.
Jedes fundierte intentionale Erlebnis hat „substruierte“ theoreti-
10 sche Themata. Objektivierendes Thema = objektivierende, doxische
(theoretische) Gemeintheit.
Weiter ist in Betreff der objektivierenden Akte zu sagen: Alle Ob-
jektivation führt zurück auf Objektivationen unterster Stufe; das sind
die v o r s t e l l e n d en A kt e i m e ngs te n S inn. Auf diese bauen sich
15 die synthetischen Objektivationen in apriorischen Formen, welche
die reine Grammatik als Formenlehre der objektivierenden Themata
(= der objektivierenden Bedeutungen im „ontischen Sinn“, wie ich
immer sagte, und jetzt sage ich besser: der Bedeutungen im thema-
tischen Sinn oder thematische Bedeutungen) behandelt. Denken
20 wir uns irgendwelche Objektivationen, so können wir logisch daraus
immer neue bilden. Gehen wir von thematischen schlichten Objek-
tivationen aus, so kommen wir immer wieder zu Objektivationen.
Andererseits können sich aber neue intentionale Erlebnisse durch
neue, nicht-objektivierende Aktcharaktere bilden.
25 Es ist hier aber wichtig, Folgendes herauszustellen. Die Objek-
tivationen unterster Stufe haben ihre Parallele in sozusagen unbe-
wussten latenten Objektivationen, und es hat einen guten Sinn zu
sagen, sie erwachsen aus latenten Objektivationen dadurch, dass sich
in ihnen ein entnehmendes Meinen etabliert, das aus ihnen, sie zu-
30 gleich in objektivierende Meinungen verwandelnd, eine Objektität
herausmeint. So z. B. vollziehen wir ein Hintergrundwahrnehmen
(und überhaupt ein Hintergrundanschauen) und dann wendet sich
der bemerkende und thematisch meinende Blick dem wahrgenom-
menen Gegenstand zu, das ist, das Hintergrundwahrnehmen verwan-
35 delt sich in ein thematisches Wahrnehmen (überhaupt thematisches
Anschauen). Auch beim Leervorstellen (dem dunklen Vorstellen –
wohl zu unterscheiden von einem Hintergrundvorstellen) ist das aus-
zuführen.
52 zur intentionalität der objektivation

Nun gehört es zum Wesen von thematisch meinenden Erlebnissen,


dass sie in Synthese treten können; es gehört zu ihnen, dass sie in
bestimmten Formen zu immer neuen synthetischen Komplikationen
und Modifikationen Gründe abgeben können. Es erwachsen so aus
5 den ursprünglich schlichten Vorstellungen synthetische Akte höherer
Stufe (synthetisches Bewusstsein, sage ich lieber), fundiert in den
schlichten, und dabei immerfort objektivierend, durch und durch
nicht nur nach den fundierenden Teilen, sondern als Ganze thema-
tisch meinend. Diese synthetischen Akte sind, wird man einwenden,
10 nicht genau in dem Sinn objektivierende als die unterliegenden.1
Es bedürfte freilich genauerer Beschreibungen. Ein Gegenstand
lenkt das Interesse auf sich, der schon vorstellig ist und nun zum
besonderen Bemerken kommt, an ihm wird ein Glanzlicht besonderes
Merkmal, während der ganze noch im Bemerken festgehalten ist und
15 das Moment eben als an ihm dasteht. Dabei tritt aber noch eine noch
nicht erwähnte Schicht auf: Der Gegenstand ist zugleich als Uhr, das
aufgesetzte Licht als Spiegeln erkannt usw., und die Uhr liegt auf den
Papierblättern usw.
Dabei unterscheiden sich innerhalb der Synthesen die G e ge n-
20 s t ä n d e - wo r ü b e r und die Sy nt h es en , d ie s el bs t ni ch t G eg e n-
st ä nd e - w o r üb e r sind, und die als so und so bestimmt aufgefassten
und erkannten Gegenstände von denselben ein zweites Mal in der
synthetischen Einheit anders aufgefassten und anders bestimmten
Gegenständen. In den höheren Akten konstituieren sich neuartige
25 Gegenständlichkeiten, die logisch-kategorialen, und sie konstituie-
ren sich, das ist, sie sind in den betreffenden Akten nicht selbst
Gegenstände-worüber, sondern werden es erst in neuen Akten, die
sie „nominal modifizieren“.
Nun hätte ich wohl, wie schon in den Logischen Untersuchungen,
30 von vornherein auch bei der Wahrnehmung scheiden müssen: das
Aufmerken auf den Gegenstand und das Worüber, das Funktional-
Form in einer synthetischen Meinung ist, die nominale und subjek-
tivische Form. Ich denke, wir müssen das „thematische Meinen“
vom „Aufmerken“ sondern und unter diesem Titel thematisches

1 Die synthetischen Akte sind meinend, das Worüber meinend und in Betreff dessen

meinend, aber nicht meinend den Sachverhalt als Gegenstand-worüber.


text nr. 4 53

Meinen das ganze Spiel der synthetischen Akte verstehen, mit dem
ihm einwohnenden Aufmerken; alles darin ist Gemeintes, was eben
nicht besagt, Gemeintes als Subjekt oder Objekt einer Synthese, einer
synthetischen Gemeintheit.

5 § 3. Das passiv aufnehmende und entnehmende


Betrachten und Explizieren gegenüber dem schöpferischen
Konstituieren. Sinnliche gegenüber kategorialen
Gegenständen. Zweierlei gebendes Bewusstsein:
sinnlich gebende und synthetisch gebende Akte

10 Auf dieser Seite1 kommt eine Unstimmigkeit hinein. Die themati-


schen Akte, die objektivierenden, waren eingeführt als das schlichte
Erfassen und als die daraufgebauten Denksynthesen (prädikativen
Synthesen). Allerdings von vornherein war eine Unklarheit in Betreff
des Sinnes von „t h e ma t i s ch“.2
15 1) Thema als Feld des Interesses: Ein herrschendes Interesse zeich-
net ein thematisches Feld aus. So sagt der Lehrer: „Sei aufmerksam!“,
„Bleibe bei der Stange!“, oder man spricht vom Abschweifen der
Aufmerksamkeit etc. Nun, bei diesem Abschweifen wird allerlei vom
Schüler wahrnehmend erfasst. Das Wahrgenommene wird durch-
20 laufen, prädikative Synthesen werden vollzogen und ausdrückliche
Urteile. Aber all das bildet eine Sphäre, die außerhalb des von der
Schule und dem Lehrer geforderten Interesses liegt. Nun ist das
natürlich auch ein Feld des Interesses. Und bei dem Schüler ist das
das herrschende. Wenn wir nachdenken und momentan durchbricht
25 ein Stimmengeräusch von der Straße her die Sphäre unseres theore-
tischen Interesses, so empfinden wir die auf diese Sphäre hingerichte-
ten Ten d e n ze n; andererseits sind wir wahrnehmend und eventuell
auch urteilend zugewendet anderen Sachen, die momentan „unser
Interesse in Anspruch nehmen“, jenen herrschenden Tendenzen zum

1 Husserl bezieht sich hier und an anderen Stellen auf den Text eines nicht mehr

im Nachlass vorhandenen Blattes. Die folgenden Ausführungen (bis zum Ende von
§ 4) sollten diesen Text wohl ersetzen (vgl. dazu die Textbeschreibung in Husserliana
XLIII/4, S. 56). – Anm. der Hrsg.
2 Das war aber oben ausdrücklich ausgeschaltet, also nicht übersehen.
54 zur intentionalität der objektivation

Trotz. Da steht also Interesse gegen Interesse, ein „momentanes“


Interesse gegen ein herrschendes, ein Sich-Durcheinanderschieben
von Interessen und eventuell von relativ herrschenden und sich be-
kämpfenden Interessen. Das müsste näher beschrieben werden.
5 2) Aber so viel ist klar, dass diese Unterschiede nichts mit der
„O b j ek t i vi eru ng“ zu tun haben, und nichts mit dem, was das
Wesen der Betrachtung, Explikation, prädikativen Synthese, begrei-
fenden Prädikation selbst ausmacht.
Eine andere Frage ist es allerdings, ob der Versuch einer wesent-
10 lichen Trennung zwischen den schlicht betrachtenden bzw. explizie-
renden Akten (das wahrnehmende Durchlaufen und dgl.) und den
denksynthetischen und prädikativen Akten nicht aus guten Gründen
durchführbar ist. Jedenfalls liegt er in einer neuen Linie, und zunächst
habe ich diese alle als wesentlich eins genommen, und so durften
15 sie nicht unvermittelt und ohne zwingenden Grund hier gegenüber-
gestellt werden. Das Aufmerken war eingeführt als der thematische
Akt, und zwar als derjenige Akt dieser Sorte, der schlicht zuwendend,
schlicht herausmeinend oder erfassend eine schon voraus konstitu-
ierte Gegenständlichkeit erfasst. Er weist also eventuell in niederster
20 Stufe zurück auf das Hintergrundwahrnehmen und dgl. als vorthema-
tischer Akt (der also kein aufmerkender ist). In höherer Stufe handelt
es sich um das Hinblicken auf Sachverhalte, die originär anderweitig
konstituiert waren und dgl. Es müsste hier der Schritt zu schlicht ex-
plizierenden Akten und anderen Akten also ausdrücklich eingeführt
25 werden durch den Unterschied von Rezeptivität und schöpferischer
Spontaneität. „Logischer Akt“, das passt natürlich nur auf die denk-
synthetischen Akte, in denen sich Subjekt, Merkmal (Bestimmung)
etc. konstituiert. Es muss daher passend modifiziert werden. Es muss
auch nicht heißen, alle thematischen Akte, sondern alle logischen
30 Akte (Akte der spontanen theoretischen Synthesis) „weisen zurück
auf schlichte Akte der Rezeptivität“ (die allerdings in gewissem wei-
teren Sinn auch Spontaneität enthält: das Erfassen selbst).
Überhaupt wechselt jetzt das Wort „thematisch“ seinen Sinn. Es
besagt plötzlich soviel wie „logisch“, wie synthetisch in der Stufe
35 der schöpferischen Spontaneität. Und weiter verengt wohl auch der
allgemeine Begriff des „intentionalen Erlebnisses“, des Aktes, seinen
Sinn: Akte sind schöpferische Spontaneitäten, in denen sich schöpfe-
risch Gegenständlichkeiten konstituieren.
text nr. 4 55

Im Bisherigen war das bloße Aufmerken, oder sagen wir lieber das
schlichte Zuwenden, Erfassen eines Gegenstandes und das schlichte
ihn Betrachten, ihn wahrnehmend oder erinnernd „Durchlaufen“
und dgl. unter den Titel des thematischen Meinens befasst, ebenso
5 wie die höheren „thematischen“ Akte, die logischen Akte, Subjekt-
setzung, daraufhin Prädikatsetzung etc.
Hier versuche ich aber eine Trennung, die sicher berechtigt ist,
obschon das Problem im Auge behalten werden muss, ein Haupt-
problem für das Verständnis der Konstitution des Bewusstseins über-
10 haupt: das Problem, zu entscheiden, ob das schlichte Erfassen, Auf-
etwas-bevorzugend-Merken, Es-„aufmerksam-Betrachten“ (Expli-
zieren) und andererseits das Vollziehen prädikativer Synthesen nicht
sich zueinander verhalten wie niedere und höhere Stufe, und zwar
innerhalb einer gattungsmäßigen Einheit.1
15 Jedenfalls berechtigt ist aber die Sonderung und Gegenüberstel-
lung, die wir jetzt vollziehen, nämlich zwischen einerseits dem p as -
s i v e n, a uf n e h m e nde n , en tn ehm en d en B e tr a ch te n – wir sind
rezeptiv, Vorgegebenes nehmen wir nur hin, wir setzen nichts, wir
betätigen uns nicht in schöpferischer Weise etc.2 – und andererseits,
20 wir vollziehen schöpferisches Tun, wir nehmen nicht hin, was uns
auffällt, sondern wir setzen in Beziehung, wir beziehen auf Subjekte
Prädikate, wir vergleichen und unterscheiden etc. Im einen Fall ha-
ben wir ein Feld der Rezeptivität in dem Explikationssubstrat; aber
eigentlich haben wir kein Thema, weil wir keine These vollziehen. Die
25 eigentliche Thesis liegt erst im Gebiet der schöpferischen Akte vor, als
Subjektsetzung (Untersetzung), als Daraufhinsetzung, als Vorausset-
zung und Folgesetzung usw. Insofern können wir hier von eigentlich
thematischen Akten (oder thetischen Akten) sprechen,3 natürlich
auch von syn-thetischen, und es ist klar, dass das ko nt i nu i e r l ic he
30 E i nh e its b e wu s s ts e i n, das vorliegt, wenn wir explizierend in purer
passiver Betrachtung einen Gegenstand durchlaufend einen Teil auf

1 Aber cf., gerade was unten als „rezeptiv“ charakterisiert ist, das ist doch das bloße

Aufmerken.
2 Ist das ganz korrekt? Ist das Erfassen, Betrachten nicht eine andere Stufe der

Aktivität gegenüber dem „synthetischen“ Meinen?


3 Aber was wären einfache thetische Akte anderes als schlichte Zufassungen und

Festhaltungen?
56 zur intentionalität der objektivation

dem Grund des Ganzen, das sich just aufgedrängt hat, aufnehmen,
keine Syn-thesis ist, kein Setzen und kein das Gesetzte Zusam-
menfassen und zu einer höheren Einheit eines Synthemas Bringen.
Also sprechen wir besser in der explikativen Sphäre nicht von Syn-
5 these.
Also b ess er al s „ t hem at i sc h e “ sagen wir the t i sch e un d
sy n t het i sc he Ak t e. Die synthetischen Akte setzen thetische vor-
aus. Die prädikativen Akte setzen nominale, adjektivische Setzung
voraus, und bei „eigentlichem“ Vollzug dieser Akte (was das ist, ist
10 hier noch nicht untersucht) setzen diese Thesen „Entnehmungen“
voraus. Die logischen (theoretisch-synthetischen) Akte bauen sich
dann auf auf Akten einer „Schicht der Sinnlichkeit“, auf schlicht
erfassenden, explizierenden (entnehmenden); oder sollen wir sagen
auf „bloß aufmerkenden“ Akten? Gehört ein prägnanter Sinn
15 von „Aufmerksamkeit“ zu dieser Schicht? Doch wohl nicht. Denn:
Die logischen Akte, die beziehenden Synthesen konstituieren n e ue
G e g e ns t ä nd li c hke i t e n , a uf w el ch e sic h, na ch de m s i e ko n -
s t i t ui e rt s i nd , wi e de r e i n auf m erk en d er , sc hl i ch t er fa s s en -
d e r , b e t r a c h t e nd e r Bl ic k l en ke n l äss t. Und nun sind neue the-
20 tische und synthetische Akte möglich; die Synthemen, die sich in ers-
ter Stufe schöpferisch konstituiert haben, werden zu Gegenständen-
worüber in neuen Synthesen usw.
Man kann sehr wohl die l og i s c h e n A kt e, die s ynt h et is c he n,
a l s d i e i m e i g e nt l i c he n S i n n o bj e k t i v i er e nd en bezeichnen,
25 sofern erst in ihnen Gegenstände-worüber als Subjekte von Bestim-
mungen bewusst werden. Aber was heißt denn im „eigentlichen
Sinn“? Doch nichts anderes als „theoretisch“, logisch objektivierend,
gegenüber bloß doxischen Akten der unteren Stufe, bloßer Erfah-
rung, bloßer Sinnlichkeit. In gewissem Sinn wird es auch sicher gesagt
30 werden müssen, wie ich es ursprünglich sagte, dass alle thematischen
Akte der schöpferischen Stufe, alle „produktiven“, „synthetischen“,
zu r ü ck w e i s e n a uf A k t e , de n e n d i e „ Ge g e n s t ä nde “ e nt -
n o m me n , i n d e ne n d i e Ge g e ns t ä nd e „ ur s pr ü ng l i c h g e g e-
ben “, v o r ge g e be n, passiv gegeben sind, während die thematischen
35 Akte durch ihre synthetischen Funktionen Gegenstände schöpferisch
„erzeugen“ (produktive Gegebenheit). Oder auch so: Die eigentlich
theoretischen Akte (die produktiven, die Verstandesakte) mögen zu-
nächst zurückweisen auf v or g e g e be n e Ge g e ns t ä nd e, die selbst
text nr. 4 57

wieder Verstandesgegenstände, produzierte sind. Aber schließlich


kommen wir zu n ich t p ro du z i ert en G ege n stä nde n.
Es ist das der Unterscheid zwischen s i nnl ich e n und ka teg o ri -
alen  G e gen s t än de n (in der logischen Sphäre). Die sinnlichen
5 Gegenstände sind durch keine Synthese ge g eb e n ( urs pr ün g li c h
g ege ben ); sie sind gegeben in reiner Rezeptivität, der keine Pro-
duktivität vorausgeht. Die sie gebenden, rein rezeptiven Akte, die
rezipierend sind aufgrund einer ursprünglich gebenden Materie, sind
die sinnlichen Wahrnehmungen (die sinnliche Erfahrung, aber origi-
10 näre).
Doch noch besser sagen wir: J ed em m ög li ch en G eg en st and
e n t s p r i c h t ei n m ögl i c h e r, s ch l i ch t i hn e rf a ss en de r, sich ihm
schlicht zuwendender (ihm, dem gegebenen) und eventuell ihn in der
Gegebenheit explizierender Akt. Dabei müssen wir unterscheiden:
15 den Blick der Zuwendung oder des Zugewendetseins (die Erfas-
sungsform, den Charakter der Anschauung als erfassendes Darauf-
Gerichtetsein) und das, was der Zuwendung die Materie, den phäno-
menologischen Gehalt1 gibt, nämlich das, was phänomenologisch das
nehmende Erfassen gerade dieses Gegenstandes und dieses in der
20 bestimmten Erscheinungsweise und dgl. ausmacht.2
In dieser Materie liegen nun gerade die wesentlichen Unter-
schiede. Dem nehmenden Erfassen entspricht sozusagen ein Geben,
und wenn man die A n s c ha u u n g en „ geb en de Ak te “ nennt, so
liegt das Geben in diesem phänomenologischen Gehalt. Auch ni c ht -
25 a n scha uen d e Akte können von der Art schlichter Zuwendungen
und Erfassungen sein, wie wenn sich ein Gedanke vage regt und ich
mich ihm zuwende und dgl.3
Es gibt nun z w e i e r l e i g e be n d es Be w u ss ts e i n oder zwei-
erlei Gehalt gebende Akte. Einmal liegt i m G e be n e i ne r ei ne
30 Pas s ivi t ä t. Die Rezeptivität des Nehmens, des Erfassens ist bloße
Rezeptivität, weil bloße Aufnahme von etwas erfolgt, das nicht selbst
wieder aus Spontaneität entsprossen ist. Also der Gegensatz macht es

1 Das heißt nachher Substrat.


2 Erfassen im prägnanten Sinn = nehmendes Erfassen eines Gegebenen.
3 Geben und Erfassen ist im prägnanten Sinn zu nehmen. Dieses Geben ist An-

schauen im erweiterten Sinn. Schlicht gegeben ist schlicht angeschaut.


58 zur intentionalität der objektivation

klar: Es wird etwas erfasst, und zwar im prägnanten Sinn, derart, dass
erst ein spontaner Akt vorausgegangen sein muss, der die Materie
des Erfassens vorbereitet und herstellt. Erst muss die Urteilssynthese
hergestellt sein, damit ein erfassender Blick sich dem Sachverhalt zu-
5 wenden und ihn zum eigentlich erfassten Gegenstand machen kann.1
Für jedes (natürlich eigentliche) Erfassen gilt, dass ein Bewusstsein
möglich ist, dass die volle Materie in gewisser Weise schon enthält,
derart, dass wir sagen müssen, der Gegenstand sei schon bewusst,
aber er sei noch nicht Gegenstand der Erfassung, der Zuwendung.
10 Dazu bedarf es eben erst des Rezipierens, des Erfassens, Aufneh-
mens, was eine gewisse Modifikation jenes Bewusstseins – das im
eigentlichen Sinn nicht bewusst macht, erfasst macht – mit sich führt.
Dieses Bewusstsein ist einmal ein spontanes, in gewissem Sinn von
Licht durchleuchtet (Spontaneität ist immer hell), und das andere Mal
15 nicht spontan. Oder das originäre Konstituieren vor der Zuwendung,
das e i g e nt l i c h g e b e nde, zeigt diesen kardinalen Unterschied der
ursprünglich passiven Vorgegebenheit und der spontanen Erzeugung
und Erzeugtheit.
Dieser Wesensunterschied in der Art der Gegebenheit der s i nn -
20 l i c h g e b e n d e n und s y nt h e t i s c h ge ben de n Akt e setzt sich dann
fort, hat dann seine Abwandlungen und führt zur allgemeineren
Unterscheidung zwischen s i n n l i ch e n A kt e n und sy n th e ti sc hen
( s pe z if isc h l o g i s c he n ) A k t e n. Es gibt gewisse Abwandlungen,
Modifikationen, die zu allen Akten unter Erhaltung ihres gattungs-
25 mäßigen Wesens gehören: so die Unterschiede der Klarheit und
Verworrenheit und dgl., und die finden wir also in gleicher Weise
bei den sinnlichen Konstitutionen und sinnlich erfassenden Akten
und bei den synthetischen Konstitutionen (den Urteilsakten etc.)
und den synthetisch fundierten, erfassenden Akten. Der Unterschied
30 liegt dabei originär durchaus in dem Zuwendungsgehalt, also in der
„Gegenstandskonstitution“.
Man kann also, wenn man von der Erfassung, Zuwendung ab-
sieht, gegenüberstellen: sozusagen u r s pr üng l i ch to te s , b l i n de s
Be w uss t s e in , s i nn l i ch e s (vor der Zuwendung), und s y nt he ti -

1 Die aktuelle Synthese ist notwendig, damit der Sachverhalt gegeben sein kann bzw.

genommen, erfasst sein kann.


text nr. 4 59

sc h es B ew u sst s ein , ak t u ell e s Leb en. Man kann allgemein auch


so sagen: Es gibt 1) das ursprünglich Stoffliche, da s u rs pr üng li ch
S t o f f l ic he d er Rez ept ivit ät;1 2) S p on ta ne i t ät, und zwar die
schlichteste Aktivität. Die unterste Stufe oder uneigentliche ist das
5 bloße Zuwenden, Erfassen des im bloßen Stoff blind, untätig Kon-
stituierten. Dann kommt aber die schöpferische Spontaneität, die
lebensvoll Stoffe, d. i. gegenständliche Beziehungen, neu erzeugt, und
zwar so, dass ein derart Erzeugtes niemals ursprünglich anders gege-
ben sein kann als durch diese Spontaneität; dass es nur schlicht erfasst
10 werden kann als Gegebenes, gegebenes Objekt der Zuwendung, des
Hinsehens und Fassens nur sein kann, nachdem es tätig erzeugt
war. Ein Begriff der synthetisch erzeugten Gegenstände (Verstandes-
objekte) gegenüber den bloß sinnlich empfangenen Gegenständen
reicht aber über die „theoretische Sphäre“ hinaus.

15 § 4. Die Schichtung in der Sphäre der Sinnlichkeit:


physische Sinnlichkeit und Gemütssinnlichkeit

Wir müssen sagen: Nicht alle sc hö pf er i sc h er z e uge nde n


A k t e sind l og i s ch e Akte. Korrelativ: Nicht alle thematischen, und
zwar aus Thesis und Synthesis hervorgehenden, schöpferisch erzeug-
20 ten Gegenstände sind logische Gegenstände, Sachverhalte, Inbegriffe
etc. Ebenso haben wir auch in der Sphäre der Sinnlichkeit kardinale
Unterschiede; es gibt nicht nur eine ä s t he t i s ch e S i nn li ch kei t,
sondern auch eine (sagen wir vorläufig) Ge mü t s s i nnl i ch ke it, und
zum Wesen der letzteren gehört es, dass sie die erstere voraussetzt, in
25 ihr fundiert ist. Wir lassen es dahingestellt, ob jeder originär gebende,
sinnliche Akt von vornherein geschichtet ist, ob er von vornherein ne-
ben ästhetisch-sinnlichem Material auch Gemütssinnlichkeit enthält.2
Jedenfalls, wenn er geschichtet ist, dann kann das „zum Gegenstand
machende“ Erfassen und Betrachten sich entweder in der Unter-
30 schicht bewegen oder in die Oberschicht eintreten und sich ganz

1 Was besagt aber das „ursprünglich“? Ist das anderes, als was auf voriger Seite =

S. 57,21 ff. das „geben“ heißt?


2 In weiterem Sinn gebend ist jeder sinnliche Akt, sofern er einer möglichen Erfas-

sung darbietet ein Was der Erfassung. – Aber das darf nicht „gebend“ heißen!
60 zur intentionalität der objektivation

in ihr bewegen, wobei von der Unterschicht nur das Momente der
Oberschicht in „dienender“ Weise speziell Fundierende in Betracht
kommt; endlich kann auch die Betrachtung in der Einheit einer unge-
schiedenen Erfassung des ästhetisch-axiologisch einheitlich erfassten
5 Objekts vom einen in das andere wahllos übergehen.
Ich betrachte zum Beispiel eine Blume. Ich kann einmal erfassend
das Naturobjekt erfassen und mich in der Einheit dieses natürlichen
Seins bewegen, oder ich kann das „schöne“ Objekt, die schöne Blume
(in ihrer Schönheit) betrachten und erfassend und betrachtend in
10 die Einheit eintreten, die das „wertende Bewusstsein“ herstellt und
die in dem bloßen ästhetischen Objekt (der Natur) und gewissen
Seiten desselben gegründet ist. Ich betrachte das schöne Objekt in
seiner Schönheit: Ich erfasse und betrachte seine „Schönheiten“,
seine Gefälligkeiten: die schöne Form, die schöne Farbe, den schönen
15 Duft usw. Ich bewege mich „rein in der Oberschicht“; die Formbe-
trachtung etc. ist hier dienend für die Erfassung des Schönen und
erfolgt nur soweit, als sie „dazu nötig“ ist. Es kann die „Einstellung“
von vornherein die Unterschicht herausnehmen und sie allein bevor-
zugen; so wenn der Naturforscher das Ding betrachtet, er „sieht“
20 nur das Naturobjekt. Es kann die Einstellung von vornherein auf
das axiologische Objekt gehen, so wenn der ästhetische Betrachter
(im gewöhnlichen Wortsinn: der schönheitsfreudige Betrachter, der
Blumenfreund) die Blume betrachtet. Es kann aber sein, dass keine
solche Bevorzugung statthat; das Objekt schlechthin lenkt den Blick
25 auf sich und im Lauf der einheitlichen Betrachtung kommt bald
Naturhaftes, bald Axiologisches zur Geltung.
De r N a t u r g e ge n s t an d u nd de r a x i ol og i s c he d ur chdr i n-
g en s ich. Beide sind selbständig und durchdringen sich eigentümlich.
Der Naturgegenstand ist völlig selbständig. Was das axiologische Be-
30 wusstsein heranbringt zum Naturgegenstand, der mindestens nach
gewissen seiner Seiten (die aber doch das Ganze fordern) die axio-
logischen Momente fundiert, das ist eine unselbständige Schicht (on-
tisch wie phansisch). Charakteristisch ist die wesentlich verschiedene
Art, wie die ästhetisch-natürlichen Merkmale im oder am Objekt
35 sind und wie die axiologischen; die einen gehören zum Wesen des
Naturgegenstandes, die anderen zu dem des axiologischen Gegen-
standes. Also die axiologischen Merkmale sind dem Naturgegen-
stand „außerwesentlich“, sie kommen ihm zu, aber nicht als sein
text nr. 4 61

Wesen ausmachend, es innerlich bestimmend, verdeutlichend, näher


bestimmend etc. Andererseits kommen sie ihm nicht zu wie relative
Merkmale.
In der „schlichten Betrachtung“ ist noch von keinen „Merkma-
5 len“, „Bestimmungen“ die Rede. Aber in ihr schon unterscheiden
sich die verschiedenen Weisen der schlichten Gegebenheit, die ver-
schiedenen Einstellungen, die verschiedenen Explikationen, die
„ästhetischen“ und axiologischen, während doch bloße Explikation
statthat und in dieser Hinsicht keine Unterschiede bestehen.
10 Es fehlt an einem richtigen Namen für das, was ich jetzt immer
„ästhetische“ Sinnlichkeit nannte. Aber gerade das Wort hat ja einen
axiologischen Sinn bekommen. Auch „physische Sinnlichkeit“ passt
nicht, da es ja auch eine „innere“ Sinnlichkeit geben soll, mit ihr
gleichartig. Eigentlich würde das Wort „physisch“, wenn wir nicht
15 gewohnt wären, es so eng zu fassen, ganz gut dienen können. Natur
im weitesten Sinn steht ja in Bezug zu dieser Sinnlichkeit.1 Sagen
wir vorläufig: p hy s i s c h e Si n nl i ch keit, und verwundern wir uns,
dass wir nicht theoretische Sinnlichkeit sagen dürfen als Parallele zu
Gemütssinnlichkeit.
20 In der Sphäre der Sinnlichkeit finden wir eine Schichtung; der in
sich geschlossene konstituierte physische Gegenstand hat eine axio-
logische Schicht. Korrelativ: Das Natur konstituierende Bewusstsein
trägt eine unselbständige Schicht axiologischen Bewusstseins, aber
eines Bewusstseins, das nichts von Spontaneität enthält. Es kann nun
25 aber auch ein auf physischer Sinnlichkeit gegründetes synthetisch-
logisches Bewusstsein eine axiologische Bewusstseinsschicht tragen
und das ganze fundierte Bewusstsein wieder konstitutiv sein für eine
neue Gegenständlichkeit.

1 Man könnte sagen, das geht doch nicht, da ja die innere Sinnlichkeit mit hierher

gehört. – Überlegen.
62 zur intentionalität der objektivation

§ 5. Funktionell verflochtene Grundarten des


Bewusstseins. Vordergrund- und Hintergrundbewusstsein.
Jeder Akt, dem sich ein Gegenstand entnehmen
lässt, bezieht sich auf diesen Gegenstand. Die
5 zu allen Akten gehörigen modalen Unterschiede

Betrachten wir die Gegenstände ausschließlich hinsichtlich der


thematischen (logisch- oder doxisch-synthetischen) Formen, der ka-
tegorialen Formen, in denen sie sich im thematischen Denken kon-
stituieren, so kommt es auf den besonderen „Ursprung“ der Gegen-
10 stände-worüber, der Besonderheit ihres Inhalts nicht an. Wir bewe-
gen uns dann in der Sphäre der Formen des kategorialen Meinens
(statt logisch-thematisches Meinen könnte ich auch sagen kategoria-
les Meinen) und korrelativ der kategorialen Formen der Gemeinthei-
ten.1 Diese Gemeintheiten sind die V er st a nde so bj e kt e, es sind die
15 doxischen Bedeutungen im ontischen Sinn, wenn wir von Wahrheit
und Falschheit zunächst absehen. Gehen wir aber auf den „Ursprung“
der Gegenstände-worüber zurück, so bestimmen sich die kategorialen
Gegenständlichkeiten je nach den „Regionen“ (Grundklassen von
Akten); vor allem je nach Art der „Sinnlichkeit“, auf die sie zuletzt
20 zurückführen.
Soweit wir bisher überlegt haben, könnten wir sagen: Es gibt
folgende Grundarten des Bewusstseins, die miteinander funktionell
verflochten sind: 1) das latent intentionale Bewusstsein, vorthemati-
sche Bewusstsein, und das thematische. Dann das nicht logisch Ver-
25 ständige, das vor dem logischen Verstandesfunktionieren Liegende.
Zu jeder Grundart solchen Bewusstseins gehört die Doppelheit: Es
kann Hintergrundbewusstsein sein und erfassendes, betrachtendes;
und jedes bemerkende ist überzuführen in logisch-thematisches (Sub-
jekt, Beschaffenheit etc.). Im Übrigen ist das latente Bewusstsein

1 Dabei ist zu bemerken, dass es sich teils um Formen handelt, die unabhängig sind

von den modalen Unterschieden des thematischen Denkens, teils um die modalen Un-
terschiede selbst, entsprechend der Unterscheidung im Thema zwischen thematischem
Inhalt und thematischer Qualität. Dies entspricht aber einigermaßen dem Unterschied
der Urteilsformen (Gewissheit) und dem der durch die übrigen modalen Unterschiede
hereinkommenden Formen; was sich erklären würde, wenn Gewissheit die einzige
aktuelle theoretische Qualität wäre, die nicht fundiert ist.
text nr. 4 63

Bewusstsein unterster Stufe (ästhetisches Bewusstsein) und höherer


Stufe (axiologisches Bewusstsein, darauf weiter gebaut praktisches).
2) Das thematische Bewusstsein ist fundiert und zuletzt in dem sinn-
lichen Bewusstsein.
5 Im Gemütsbewusstsein, das einem sinnlichen oder thematischen
Gegenstand zugewendet ist (einem in logische Fassung gebrachten),
ist die Gemütsobjektität latent, sie ist noch nicht in die Verstandes-
sphäre, in die thematische, objektivierende getreten; sie muss erst
zum objektiven Thema werden. Erst dadurch verwandelt sich der
10 Gemütsakt in einen objektivierenden.
Auch das logische, schöpferisch spontane, thematische Bewusst-
sein kann Vordergrundbewusstsein und Hintergrundbewusstsein
sein; der Ausdruck „latent“ für „vorthematisch“ ist wohl nicht pas-
send, es würde ja besser auf das Hintergrundbewusstsein passen.
15 Aber hier ist eine Schwierigkeit: Sollen wir ein Urteilsbewusstsein,
in dem wir nicht leben, auf den Sachverhalt nicht achtend, noch
Verstandesbewusstsein nennen?1 Wir müssen jedenfalls sagen: Ein
richtiges thematisches Bewusstsein, ein richtiges Verstandesbewusst-
sein ist ein solches, in dem wir leben, dessen Thema eben Thema
20 für uns ist. Ein solches Bewusstsein kann nun in ein Hintergrund-
bewusstsein übergehen, das ist sicher.2 Ich habe soeben geurteilt,
und wenn ich mich einem Neuen zuwende, sinkt das Bewusstsein
in das Dunkle des Hintergrundes zurück; aber ich kann mich wie-
der darauf zurückwenden und dabei konstatieren, dass es „noch
25 lebendig war“. Also es wird sich vielleicht besser machen, wenn
ich die s en U n t er s c hi ed v o n V or d e r g run d u nd H i nt er g ru nd
a l s e in e n b e s o nd e r e n P u nk t e i n f ü r a l l e M a l h e ra us st e ll e
un d in n e rh a l b de r V or de r gr u n ds p hä r e - d i e Sp hä r e von
E rl e bni sse n , i n de n e n w i r v o r zu g sw ei s e l e be n - di e and e-
30 re n U n t ers ch i e d e m a c h e.

1 Es ist eben unpassend, das logische Bewusstsein ohne weiteres thematisch zu

nennen.
2 Es gibt aber noch verschiedene Bedeutungen von Vordergrund: 1) Vordergrund

kann dasjenige heißen, worauf wir achten. 2) Vordergrund kann in einem anderen
Sinn verstanden werden, in dem wir komplexe Phänomene haben und nun auf einen
komplexen Gehalt derselben hinsehen, ihn im Vordergrund haben im vorigen Sinn.
Aber die aus ihnen zu entnehmenden Gegenständlichkeiten sind uns in besonderer
Weise zur Hand.
64 zur intentionalität der objektivation

Dann wird man sagen: Was im Vordergrund ist, das ist „m e r k-


lic h“. Auch wenn ich in einem Wunsch lebe, ist das Wunschmo-
ment, das im Gegenstand „erwünscht“ heißt, nicht bemerkt zwar,
aber merklich. Im Gefallen lebend ist das Gefallende von rosigem
5 Schimmer übergossen etc.; das ist nicht unmerklich, aber thematisch
bin ich damit nicht beschäftigt, ich bin ihm nicht primär zugewendet
und objektiviere es nicht.1
Noch ein Wichtiges: Lebe ich im Gefallensakt, Wunschakt und
reflektiere ich dann auf das Moment des Gefallens, Wünschens, so
10 erscheint dieses auf das Objekt bezogen,2 und ich sage dann: Zum
Wesen solcher auf thematische Objekte bezogenen neuen Akte ge-
hört eine S ubj ek t - O b j e k t- B ez ie hu n g, w e lch e w i r b ei d en
s c h l i c h t e n o b jek t i vi ere nd en A k t en ni c ht fi nd en. Die haben
noch nicht ein konstituiertes Objekt und dazu einen Aktcharakter,
15 der sich auf dasselbe richtet.3 Man darf das nicht hineintragen, wie
man es tut, wenn man das einfache Urteilen „S ist p!“ als Zustimmung
zu einem bloßen Vorstellen fasst, als Ja-Sagen zu einem Vorgestellten
und Fraglichen. Natürlich können wir auch beim einfachen Urteil
eine Beziehung zwischen Akt und Sachverhalt herausstellen: In ei-
20 nem neuen Meinen machen wir den Sachverhalt zum Gegenstand-
worüber (nominal) und bringen nun den ursprünglichen Akt und den
so modifizierten zur Synthese. So sagen wir von jedem Akt, dem sich
ein Gegenstand entnehmen lässt, dass sich der Akt auf ihn beziehe.
Sagen wir von einem Erlebnis, es sei ein Bewusstsein, ein „Akt“
25 im weiteren Sinn, so sagt das dasselbe wie: Zum Wesen dieses Er-
lebnisses gehört die Möglichkeit, aus ihm einen Gegenstand zu ent-
nehmen4 durch ein Hinblicken und thematisches Meinen (wodurch

1 Dann müsste ich aber auch sagen: In der äußeren Wahrnehmung sind die Empfin-

dungsinhalte nicht bemerkt, aber merklich. Und es ist das Fiktum des Bildes merklich
nur, aber nicht thematisches Objekt?
2 Und ebenso auf die dem thematischen Meinen entsprechende Sachverhaltsgegen-

ständlichkeit. Thematisches Objekt ist zweideutig: Es kann den Gegenstand-worüber


des Sachverhalts und den Sachverhalt selbst bezeichnen.
3 Das ist wohl eine bedenkliche Ausführung: Von allen fundierten, auch den the-

matischen Akten kann allenfalls dergleichen gesagt werden. Es steht schon ein Ob-
jekt da und darauf bezieht sich eine Prädikatsetzung und wieder eine Setzung von
Erwünschtsein.
4 Oder das Erlebnis ist selbst ein Entnehmen oder ein Einen-Gegenstand-Setzen.
text nr. 4 65

wir den Gegenstand als Gegenstand im eigentlichen Sinn bewusst


haben). Und jedes unselbständige Erlebnismoment, dem in seinem
Zusammenhang der Fundierung wesensmäßig ein Gegenstandsmo-
ment als Gemeintheit zu entnehmen ist, heißt ein Aktmoment, ein
5 Aktcharakter, Bewusstseinscharakter. Dasselbe sagt, jeder Akt, jedes
Bewusstsein hat einen „Sinn“.
Den „Sinn“ eines „Bewusstseinsaktes“ auseinanderlegen, das be-
sagt zunächst, die in ihm – wenn er nicht schon thematisch ist – sozusa-
gen lat en t e ge gen st än d li c he B e zi eh u ng ans Tageslicht zu zie-
10 hen dadurch, dass der Akt in einem Einheitsbewusstsein übergeführt
wird in einen thematischen Akt, der ihm die Gegenständlichkeit
entnimmt. Ist der Akt ein thematischer, so machen wir – wenn er ein
synthetischer ist – den ganzen Sachverhalt zum Gegenstand-worüber
und beziehen ihn auf den Akt selbst als das in ihm „Gemeinte“.
15 Die logische, doxische Funktion ist überall die eigentlich objekti-
vierende, und eigentlichere, nämlich entfaltete Intentionalität haben
wir nur in den Fällen, wo eine gemeinte Gegenständlichkeit schon
konstituiert, eben thematischer Gegenstand-worüber ist, und wieder
in der Weise der auf intendierte Gegenstände bezogenen Akte höhe-
20 rer Stufe. Zu den logischen Akten gehören die logischen Formen, die
Formen der Bildung von logischen Akten zu logischen Akten. Und
korrelativ die Bildung von kategorialen Gegenständlichkeiten, aber
dabei ist von den modalen Unterschieden abstrahiert. Was besagt das
also?
25 In ganz anderer Richtung, als in der die Formen gefunden werden,
liegen die m od a l e n Un t e r s c h i e de. Ein Gegenstand oder Sachver-
halt (besser doch ein thematischer Gegenstand als solcher) steht da in
der Weise der Gewissheit (Wahrhaftigsein, Wahrheit), in der Weise
der Möglichkeit, in der Weise der Wahrscheinlichkeit, auch in der
30 Weise der Nichtigkeit, der Fraglichkeit, Zweifelhaftigkeit. Soll man
sagen, dass diese Unterschiede wesentlich zu den thematischen Akten
gehören, also nur zu den „Gegenständen“ im eigentlichen Sinn? Und
was sind diese „Gegenstände“ ohne diese modalen Charaktere? Das
sind offenbar auch keine Charaktere der Gegenstände im eigentli-
35 chen Sinn, keine Merkmale derselben. Man wird auch sagen: Wenn
ich im Stereoskop eine weit verbreitete Landschaft sehe und dabei
ausschließlich einen Gegenstand betrachte und thematisch als Objekt
behandle, so gehört der Charakter der Fiktion doch auch zum Hinter-
66 zur intentionalität der objektivation

grundwahrnehmen bzw. zu dem nebenbei Bemerkten und jedenfalls


nicht thematisch Behandelten. Und ebenso bei Zweifel, Vermutung.
Ferner, auch bei den fundierten axiologischen Akten treten diese
Charaktere auf, und sie treten auf, auch wenn ich nicht objektiviere.
5 Ich empfinde Gefallensneigung oder einen Wunschzweifel usw. Frei-
lich, ob sich die Charaktere nicht im Licht des Verstandes reicher
ausgestalten, das ist eine andere Frage.
Wir haben hier also eine Reihe von Modi, die zu allen Akten gehö-
ren, und in gewisser Weise alle „Gegenständlichkeit“ betreffen: Ge-
10 wisssein – oft Urteilen schlechthin (im engeren Sinn) genannt – oder
Für-wahr-Halten, Für-möglich-Halten, Für-wahrscheinlich-Halten,
Für-fraglich-Halten, Für-falsch-Halten und endlich auch das Sich-
bloß-Denken, eventuell die Entscheidung ausschalten, einklammern,
was mit gehört zu dem „dahingestellt sein lassen“. Und bei all dem
15 kann es „derselbe Sachverhalt“ sein, der einmal für wahr oder für
falsch, das andere Mal für vermutlich und wahrscheinlich gehalten ist
etc.

Beilage IV
Psychische Akte gegenüber psychischen
20 Zuständen. Meinen und Objektivieren. Der Satz
von der Vorstellungsgrundlage und die Frage
nach einem einheitlichen Vorstellungsbegriff1

Man pflegt zu unterscheiden zwischen psychischen Z us tä nd e n und psy-


chischen A kt e n. Das kann vortrefflich so interpretiert werden: Psychische
25 Akte sind die im s pe z if is ch e n Sinn „intentionalen“ (intendierenden) Er-
lebnisse, es sind entweder objektivierende Akte (objektivierende „M ei-
n un ge n“) oder andere Akte, denen objektivierende zugrunde liegen. Diese
müssen aber selbst „meinend“ sein, und das können sie nur sein, wenn
ihnen Meinungen zugrunde liegen. Was sagt das? Es sagt, dass sich etwa
30 ein Vermuten regen kann, ohne dass ich im Vermuten lebe, das Vermutete
meine. Oder noch besser: Ich kann eine Tatsache „konstatieren“, und das
ist ein meinendes Erlebnis, ein intentionales (intendierendes), ein Akt. Es
regt sich etwa die Freude darüber, aber ich lebe nicht in der Freude; die

1 Wohl Frühjahr 1911. – Anm. d. Hrsg.


beilage iv 67

Tatsache in ihrer Erfreulichkeit fällt nicht in den Rahmen des meinenden


Bewusstseins. Es mag sich auch ein Wille regen, aber es fällt nicht der
Entschluss, das Gewollte als solches, in den Rahmen des Meinens; ich habe
keine Willensmeinung. Nun kann aber ein fundierter Akt meinend nur sein,
5 wenn seine Unterlagen es sind.
B lo ße Z u s tä n de w ä r e n B e wus st s e in s erl eb n i ss e , d ie ni c h t m e i-
n e nd s in d . J ed e s m e in en d e E rl eb n i s k an n s ic h z u ein em blo ß en
Z us t a n d m o d if izi e r e n, je d e r Be w us st s eins zu s ta n d k a n n A k t w e r-
d e n.
10 Meinen ist hierbei nicht Objektivieren. – Warum denn nicht? Zwar kann
man sagen: Wenn ich diesen Zug der Wolken im Sturm beleuchtet von der
untergehenden Sonne sehe und die Pracht des Schauspiels fühle, so bin ich
mir der Prächtigkeit bewusst. In gewisser Weise ist wie der Wolkenzug so
die Pracht „wahrgenommen“. Und doch nicht „objektiviert“? Ich müsste
15 dann auch hinsichtlich der Wahrnehmung sagen, das „bloße“ Wahrneh-
men, das Einheitsbewusstsein, in dem der Wolkenzug im Wechsel konti-
nuierlicher Erscheinungen bewusst ist, ist noch kein Objektivieren, vielmehr
erst das Verstandesbewusstsein, das „Als-dieses-Ding-, als-Wolkenzug-etc.-
Setzen“. Und so objektiviere ich das Gefühlsbewusste auch erst, wenn ich
20 „urteilsmäßig“ setze: „Dieser Wolkenzug ist prächtig“ oder „dieser präch-
tige Wolkenzug“ etc.
Dann ist aber zu sagen, der Satz „Jedes intentionale Erlebnis ist entweder
Vorstellung oder hat Vorstellung zur Grundlage“ meint unter Vorstellung
nicht eine begrifflich-nominale Vorstellung oder ein Urteil. Ich kann ja rein
25 wahrnehmend und im Wahrnehmen Wohlgefallen fühlend einen einheitli-
chen Akt vollziehen (setzen). Überhaupt, kann der Satz einen ganz ein-
heitlichen Sinn gewinnen, wenn wir jederlei Bewusstsein und auch jeder-
lei intentionales Bewusstsein zusammennehmen? Genauer, kann man da
einen einheitlichen Vorstellungsbegriff als Begriff einer zusammengehörigen
30 Klasse von Bewusstseinsarten gewinnen? Wie es scheint, nicht. Einmal haben
wir eine schlichte Anschauung als Grundlage, das andere Mal (wenn wir die
Gesamtmaterie, den gesamten thematischen Inhalt festlegen) ein Urteil. Und
wenn wir von der Unterscheidung zwischen fundierenden und fundierten
Akten ausgehen und die Identität der Materie nicht festhalten, so gewinnen
35 wir bei den letztfundierenden auch keine Einheit. Wir kommen dann einmal
auf anschauliche, schlichte sinnliche Akte (Wahrnehmungen und dgl.), das
andere Mal auf schlichte leere Akte, ein drittes Mal auf nominale unsinnliche
Vorstellungen wie „4“ usw.
Erst wenn wir auf die „Ursprünge“ zurückgehen, auf die g eb e n d en oder
40 q ua s i - g eb e n de n Ak t e, auf die „eigentlichen“ explizierten Akte oder auf
die Akte, welche in expliziter Weise eben dasselbe vorstellen, urteilen etc.,
68 zur intentionalität der objektivation

was die anderen in bloß impliziter und verworrener Weise tun, kommen
wir auf letzte anschauende Akte, und das sind die sinnlichen Akte, und
zwar die empirisch-sinnlichen (physisch-sinnlichen). Versteht man aber unter
objektivierenden Akten die wirklich objektivierenden, die Verstandesakte
5 (die synthetisch erkennenden und begreifenden), so ist natürlich keine Rede
davon, dass jeder meinende Akt (jedes intentionale Erlebnis) notwendig
einen objektivierenden Akt zur Grundlage haben muss.

Beilage V
Lebendigkeit und ihre Grade beim Wünschen
10 und beim Urteilen. Lebendigkeit besagt
nicht Evidenz und setzt sie nicht voraus1

L e be n di gk e it (wohl nicht dasselbe wie Eigentlichkeit) und ihre Grade.


Beim Urteil die lebendige Überzeugung und ihre Grade.
Ich hege einen Wunsch: Möge Gott mir beistehen. Möge der Himmel
15 mir den Abschluss der großen Unternehmung gestatten. Diesen „selben“
Wunsch kann ich lebendiger und weniger lebendig hegen. Im lebendigen He-
gen des Wunsches, in dem Mehr-oder-minder-vom-Wunsch-Erfülltsein-und-
darin-Leben ist der Sachverhalt Thema des Wunsches, das Sp ist „lebendig
charakterisiert“ als wünschlich. Es kann aber die Lebendigkeit eine sehr
20 geringe sein. Und man kann auch geradezu von einem Gegenpol der „Unle-
bendigkeit“ sprechen. Ich sage vielleicht noch den Wunschsatz aus „S möge
p sein“, aber bei dem „möge“ „fühle ich nichts“. Es ist leer. Jemand spricht
diesen Satz aus, ich stimme ihm bei, aber ich bin momentan von ganz an-
deren Sachen im Gemüt erfüllt. Trotzdem spreche ich nicht unwahrhaftig,
25 wenn ich zustimme.2 Wenn ich mich in die Sachlage wieder vertiefe, würde
sich der aktuelle Wunsch wieder einstellen und meine leere Wunschsetzung
„erfüllen“.
Es ist aber zu bemerken, dass ich nicht etwa die Sachlage mir ganz klar ma-
chen muss, um lebendig zu wünschen; es handelt sich also nicht um diejenige
30 phänomenologische Sachlage, die gegeben sein muss, damit eine Evidenz
des Erwünschtseins der betreffenden Sachen statthätte. Ich kann lebendig
wünschen, dass die tyrannische Verfassung wiederhergestellt würde, ohne
dass diese Sachlichkeit im Geringsten klar wäre.

1Osterferien, März 1911.


2Und ich wünsche – ich spreche nicht bloß ein leeres Wissen davon aus, dass ich das
wünsche.
beilage v 69

Wie ist es beim Prädizieren? Ich kann einen Satz aussagen und dabei
wirklich urteilen; aber doch ist das Urteil in gewisser Weise unwirklich,
nämlich u n leb e n di g. I ch ha b e k e i n e „ l e be n d ige “ Ü b er z eu gu n g.
D a s U r te il k an n m i t grö ß er e r o d er ge r ing ere r L eb en d i gk eit d er
5 Ü b er z eu g un g v o llz og e n sei n.1 Diese Lebendigkeit besagt nicht Evidenz,
und Grade der Lebendigkeit besagt hier nicht und noch weniger Grade der
Wahrscheinlichkeit. Ein reproduzierter Satz, der im Denken benutzt wird,
drückt ein „Urteil“ aus, aber im Allgemeinen ein „unlebendiges“. (Man
würde es passend auch uneigentliches nennen.) Machen wir uns den Sinn
10 des Satzes deutlich, aber darum noch nicht klar und gar evident, so wird
nun vielleicht das Urteil lebendig werden, und die Lebendigkeit nimmt wohl
insbesonders zu, wenn die oder jene Urteilsmotive ins Bewusstsein treten,
ohne darum in ihrer Klarheit und Beweiskraft gegenwärtig zu sein. Aber
mehr kommt es wohl an auf die deutliche Explikation des Sinnes und die
15 Eigentlichkeit, mit der die Urteilsmeinung den Gliederungen des Sinnes
gemäß vollzogen ist, gegenüber dem vagen, verflossenen Urteilen, wo die
Einheit des Sinnes eine vage Art der Bewusstheit hat und damit auch das
Urteil keine wahre Gliederung, eben keine Deutlichkeit, und dies gibt auch
dem allgemeinen belief-Charakter einen anderen Habitus. Natürlich handelt
20 es sich also auch nicht um begleitende Gefühlscharaktere, nicht darum, ob
für mich dieser Glaube Herzenssache ist oder nicht und dgl.
Soll man nicht sagen, es handle sich um den Unterschied der Deutlichkeit
und Verworrenheit? Es wäre aber dabei zu sagen, dass nicht etwa dasselbe
Urteil (phänomenologisch identisch genommen) im Übergang zur Deutlich-
25 keit sich nur entfalte, seine immanenten Teile zeige, so wie wir, wenn wir
einem von fern undeutlich gesehenen Gegenstand näher treten, bei Identität
des Gegenstandes der Teile besser sichtlich werden.
Dasselbe Urteil ist dasselbe, sofern in der Einheit der Identifizierung eine
Deckung nach dem Gemeinten eintritt (und sofern gemeinsames „intentio-
30 nales Wesen“ besteht), aber die Phänomene sind verschieden. Hier könnte
man sagen: Korrelativ, was das Geurteilte, den Seinsverhalt anbelangt, tritt
uns derselbe Seinsverhalt oder Sachverhalt gewissermaßen näher, er wird
deutlicher und andererseits verworrener. Also n ich t d as U r te i le n s e lbs t,
sondern d as G e u rt ei lt e hat die Unterschiede der Deutlichkeit und Un-
35 deutlichkeit, mit der es zum Urteilsbewusstsein kommt.

1 Etwas anderes ist die Lebhaftigkeit, die Intensität der „Überzeugung“ als mehr

oder minder hitzige Gefühlsparteinahme, das Sich-dafür-Einsetzen, Entschieden-


dafür-Stellungnehmen, eventuell Sich-dafür-Ereifern etc., wobei eventuell Folgeer-
scheinungen mitgenommen sein mögen.
70 zur intentionalität der objektivation

Hängt nicht die „Lebendigkeit“ auch an der Wahl gewisser Ausdrucks-


formen? So bei Wünschen in den spezifischen Wunschsätzen: „Möge S p
sein“, ebenso bei Vermutungen und Fragen: „Ist S p?“, „S dürfte wohl P
sein“. Wählen wir die prädikativen Formen, so ist das nicht mehr der Fall:
5 „Dass S p ist, ist erwünscht, ist fraglich, ist zweifelhaft, ist wahrscheinlich“.
Doch macht das nicht allein den Unterschied zwischen prädikativer Form
und nicht-prädikativer aus.

Beilage VI
Notiz über Stellungnahme und ihr Moment der
10 Aktivität einerseits und über Momente der Passivität
und Aktivität in der Wahrnehmung andererseits1

Wenn wir den Ausdruck „Stellungnahme“ verwenden, so drückt sich da-


mit ein phänomenologisches Moment der A kt i v itä t aus. Dies liegt nicht aus-
gedrückt oder nicht in prägnantem Maß ausgedrückt in dem Wort „W ah r -
15 n e hm u n g“.
Im letzteren Fall, möchte man sagen, liegt zweierlei vor (als angedeutet
durch den Ausdruck): eine Passivität und eine Aktivität. Es wird uns durch
„die Sinnlichkeit“ etwas als gegeben entgegengebracht, es ist nun für das
Bewusstsein da, wir mögen dazu Stellung nehmen oder nicht. Andererseits
20 liegt in dem Nehmen dieses Gegebenen schon eine niederste Stufe der Ak-
tivität. Wir sprechen ja auch vom B e t r a c h t e n, dann vom aufmerksamen
Betrachten, von dem Betrachten mit Interesse. Da sind Aktivitäten.

1 Wohl 1911. – Anm. der Hrsg.


Nr. 5

D er t hem ati sch e I n ha lt u nd s ei ne C h ar ak t er e1

§ 1. Das thematische Bewusstsein mit seinen


verschiedenen Qualitäten. Der thematische Blick
5 als Bewusstsein vom Thema und als Bezogensein
auf den Gegenstand. Die Objektivierung des
Charakters als Prädikat eines thematischen Inhalts

Gehen wir nun zu den „modalen“ Unterschieden (oder besser den


qualitativen des thematischen Meinens) über und zu dem Verhältnis
10 der modalen Unterschiede zur Materie dieser Akte.
I. Wir urteilen (und sagen aus), wir sind dessen gewiss, dass S p ist.
Wir vermuten, halten es für möglich, dass S p ist. Wir fragen, zweifeln,
ob S p ist (wir „schweben“ in Ungewissheit). Wir lehnen es ab, wir
sind dessen bewusst in einem Nichtigkeitsbewusstsein.
15 II. Endlich: Wir können es uns bloß denken, dass S p ist, ohne dass
irgendwelche Anmutung, Vermutung etc. im Spiel wäre. Wir können
aber auch Gewissheit, Zweifel etc. „ausschalten“; wir können – selbst
wo wir gewiss sind, dass S p ist – es dahingestellt sein lassen.
Wir setzen nun gegenüber: All die genannten Akte bis auf das
20 bloße Denken (bzw. Dahingestelltseinlassen, in welchem auch ein
bloßes „Sich-Denken“ mitvorliegt) und andererseits eben das letz-
tere. Wir nennen die ersteren Akte im weitesten Sinn s te l lu n gne h-
me n d e A k te t h e ma t i s c h e r Ga t tu n g oder t he m a t is ch e St el -
l un g n ahm e n und die letzteren Akte stellungsfreie Akte (stellungs-
25 freies Bewusstsein). Der Unterschied reicht über die Sphäre der the-
matischen Akte hinaus, und nun können wir sagen: Beschränken wir
uns zunächst auf die stellungnehmenden Akte, und zwar auf synthe-
tische, so kann es sein, dass wir zunächst diese Akte, im thematischen
Meinen lebend, vollziehen, wobei der t h e ma t i s c he B l i c k a u f da s
30 „ T he m a “ g er i ch t e t is t. Wir leben im Gewisssein, und unser Blick

1 Osterferien 1911 (ausgebessert mit Bleistift Anfang Oktober mit Anmerkungen

aus der Zeit nach 1913).


72 zur intentionalität der objektivation

ruht auf „S ist p“, schrittweise, wie es sich dabei aufbaut, oder auf
„S ist p und dasselbe ist auch q“, oder „S, welches p ist, ist auch
q und dasselbe S p, welches q ist, ist einerlei mit M, welches n ist“
usw.
5 Was heißt das: Der „thematische Blick ist gerichtet“ auf diesen
„Inhalt“? Der Blick ist der Blick, der eben zum Wesen des thema-
tischen Meinens gehört, und ist der Blick des „Aufmerkens-auf“ (in
dem einen Sinn). Wohl gemerkt, es ist d iese s G er ic ht e ts e in d es
t he m at i sc h en Bl i ck s n ic ht ei n Wah rn eh m e n i m ge w öh nl i-
10 c he n S in n, das ist ein Zum-Gegenstand-worüber-Machen, zu einem
identisch Einheitlichen, das Subjekt thematischer Meinung ist.1 Z u m
t h e ma t i s c hen G emei nt e n g eh ö rt e s, da ss es i m m e r ei n
S ubj ek t wo rü ber „ hat “, und eventuell wie in den Beispielen geht
das thematische Meinen (der Blick) darauf, dass ein so und so Ge-
15 meintes dasselbe ist wie ein anderes Gemeintes, aber der thematische
Blick, das thematische Gerichtetsein geht eben auf das so Gemeinte
und auf „dasselbe“, kurzum darauf, dass dieses S p dasselbe ist wie
das M n und dgl. Und dieser thematische Inhalt ist in der Weise
der Gewissheit thematisch bewusst. In der Vermutung kann genau
20 derselbe „thematische Inhalt“, der in ihr genau ebenso Inhalt ist,
genauso im thematischen Blick bewusst, in der Weise des Vermutens
bewusst sein.
Wieder sind wir ebenso thematisch auf dasselbe, auf denselben
Inhalt gerichtet in der „entsprechenden“ Frage, im entsprechenden
25 Zweifel,2 während die „Weise“ des Gerichtetseins, die Weise des
Bewussthabens die des Fragens, des Zweifelns ist. Die Weise des
Bewussthabens affiziert in gewisser Art den thematischen Inhalt. Er
ist in verschiedener Weise charakterisiert, und diese verschiedene
Charakterisierung fällt nicht selbst in den thematischen Blick, sie
30 gehört nicht selbst zum Thema. Das thematische Bewusstsein mit
seinen verschiedenen Modi, seinen verschiedenen „Qualitäten“ hat
etwas zum Thema, aber Qualität ist nicht selbst Thema der Quali-
tät.3

1 Blick = Hinwendung-auf = Erfassung, Setzung etc.


2 Aber die Qualität des Themas ist eine andere.
3 Paradox: korrelative Qualität.
text nr. 5 73

Jede Qualität lässt sich in den thematischen Inhalt hineinziehen!


Und zwar in einem neuen thematischen Bewusstsein, näher einem
Gewissheitsbewusstsein. Das geschieht in der Weise, dass der ge-
samte thematische Inhalt des zu modifizierenden Aktes zu einem
5 nominalen Objekt, einem Gegenstand-worüber gemacht wird (wo-
bei der ursprüngliche thematische Inhalt verwandelt wird in eine
„Eigenbedeutung“ von ihm selbst, also in ein nominales Eigen-
thema).1 Was ist nun das Prädikat des zu bildenden „kategorischen
Urteils“? Nun, ein entnehmendes Objektivieren erfasst in der Weise,
10 wie eben das Thema „charakterisiert“ ist, das Prädikat „gewiss“.
Dass S p ist, das ist gewiss.
Doch ist die Redeweise nicht bedenklich? Das Subjekt, der Gegen-
stand-worüber, ist nicht das Subjektthema. Im Thema (ebenso the-
matischer Inhalt) „S p ist dasselbe wie M n“ treten Themata auf. S p
15 ist eins, M n ist ein anderes und verknüpft sind sie durch die thema-
tische Form „dasselbe“. Andererseits sagen wir in gutem Sinne: Der
Subjektgegenstand ist derselbe wie der Objektgegenstand, und dass
er derselbe sei, das ist gerade die „Meinung“ des Urteils, das ist es ja,
dessen wir gewiss sind, das ist der thematische Inhalt der Gewissheit.
20 Und wie wir zwischen Subjekt und Subjektthema, Gegenstand des no-
minalen Themas und nominalem Thema selbst scheiden, so unter-
scheiden wir auch zwischen Prädikatthema und Prädikat selbst. Und
so überall für alle Glieder des Themas, und schließlich für das ganze
Thema selbst. Wir unterscheiden es von seinem „Gegenständlichen“,
25 das das thematisch Gemeinte ist im ontologischen Sinn. Die Rede
von der Richtung des Bewusstseins, von der Richtung des „Urteilens
auf“, oder davon, dass Bewusstsein „Bewusstsein von“ ist, ist zwei-
deutig. Wir müssen unterscheiden den t he m a t i s che n Bl ic k a l s
B e wu s sts e i n v o m T he ma, das in der Tat ein im Bewusstsein
30 selbst vorzufindendes Gerichtetsein ist, und das B e zo ge ns e i n a uf
de n Ge g e n st a n d – d i e t he m a t i s c h e B ew us s t s e i ns b e z i e hun g
un d d ie g eg e n s tä n d li c h e.
Wenn nun im Urteilsbewusstsein das „S ist p“ bewusst ist in Ge-
wissheitsweise, und wir sagten, das „S ist p“ stehe im Charakter der
35 Gewissheit (oder Wahrheit) da, so ist zu sagen: Im Urteilsbewusst-

1 S ist p! Dass S p ist, ist wahr!


74 zur intentionalität der objektivation

sein, wo der Blick auf das Thema gerichtet ist, ist der thematische
Inhalt in gewisser Weise charakterisiert: „S ist p!“, „Dieses Papier ist
weiß!“ Wir können sagen, das ist der Charakter der Gewissheit, der
am thematischen Inhalt haftet, ohne dass er aber zum thematischen
5 Inhalt gehört. Machen wir aber aus dem thematischen Inhalt ein
nominales Thema, so wird (nicht der Sachverhalt „S ist p“, aber) der
thematische Inhalt zum Objekt, das Thema erhält nun das Prädikat
der Gewissheit. Also wäre es doch ganz unbedenklich und korrekt.
Woher kam mein Bedenken?
10 Nun, man darf nicht verwechseln das Bewusstsein der Gewissheit
und die Gewissheit selbst, die da als Prädikat fungiert. Man könnte
nämlich denken: Das Urteilsbewusstsein ist eben das Phänomen „S ist
p!“, und scheide ich dabei das Thema und die Qualität, so scheide ich
phänomenologisch. Also wenn ich das Urteilsbewusstsein vollziehe
15 und dann reflektiv urteile „Dass S p ist, ist gewiss“, so sage ich damit
aus, dass der thematische Inhalt den Charakter der Gewissheit hat,
und das hat er natürlich, er steht eben so da. Aber das Urteil „Dass
S p ist, ist gewiss“ hat den Wert von „Dass S p ist, ist wahr“, und
dieses Urteil kann falsch sein, trotzdem es mir im Urteil „S ist p!“ so
20 „erschien“. Also phänomenologisch entspricht dem phänomenologi-
schen Moment „thematischer Inhalt“ der thematische Inhalt selbst,
und dem phänomenologischen Moment „Gewissheit“ die Gewissheit
selbst. Und ob dem Thema wahrheitsgemäß Gewissheit zukommt, das
ist nicht gesagt dadurch, dass gesagt wurde, es sei im Urteil das Thema
25 als gewiss charakterisiert (immer Thema = thematischer Inhalt). Und
das überträgt sich auf alle anderen Fälle.
Also in dieser Weise ist jedes thematische Bewusstsein thema-
tisch gerichtet, und das Thema hat einen „Charakter“, und jedes
lässt sich überführen in ein Gewissheitsbewusstsein, in welchem das
30 Thema (der thematische Inhalt) zum Gegenstand-worüber geworden
ist in einem nominalen Eigenthema und in welchem der Charak-
ter objektiviert, d. i. durch ein entsprechendes Prädikatthema, einen
eigentümlichen Qualitätsbegriff, vertreten ist. E s e r wa c hs e n s o
d i e m o da l en Be g ri f f e a ls K or r e l a t e d e r Ur t e i l s qu a l i t ä t e n
35 und als Prädikate von thematischen Inhalten. Als Prädikate treten
sie dann (durch die modalen Prädikatbegriffe) selbst in thematische
Inhalte ein („zweifelhaft“, „fraglich“, „möglich“, „wahrscheinlich“).
Selbstverständlich können aber d i e se thematischen Inhalte – wie
text nr. 5 75

alle – nicht nur solche von Gewissheiten, sondern auch solche von
Vermutungen, Zweifeln etc. werden.
Nun wären freilich noch die Wesensbeziehungen zwischen dem
unmodifizierten und dem modifizierten, nämlich in Prädikation über
5 Gewissheit verwandelten Urteil und so überall zwischen modifizierter
und unmodifizierter Vermutung etc. zu erörtern: die „Deckungs-
beziehungen“, die Vernunftbeziehungen (noetisch: Es ist evident,
dass die betreffenden Paare unmittelbar „gleichwertig“ sind) usw.
Es wäre dann noch zu erwägen d as blo ße Si c h- De nke n, der
10 stellungsfreie Akt. Hier können wir auch die Modifikation zu machen
versuchen: „S ist p“, dass S p ist, ist gedacht, ist ein „bloßer Gedanke“.
Aber näher besehen ist das kein objektives Prädikat von der Sorte
der modalen, wie dann das „Sich-Denken“ nicht Qualität ist in dem
Sinn wie Gewisssein etc. Man kann wohl sagen, es ist ein bloßes
15 Bewusstsein von einer qualitätslosen, modal unqualifizierten Materie,
d. h. ein Bewusstsein vom bloß thematischen Inhalt, nicht ein solches,
wo das Thema Objekt ist, sondern ein thematisches Bewusstsein mit
der thematischen „Richtung“ auf das qualitätslose, modal uncharak-
terisierte Thema.
20 Nun möchte man aber fragen: Wie verhält sich dieses Bewusstsein
als „Bewusstsein“ zu dem Gewissheitsbewusstsein, Wahrscheinlich-
keitsbewusstsein usw.? Das Gedankenbewusstsein heißt doch wohl
nicht Gedankenbewusstsein in demselben Sinn, wie das Wahrheits-
bewusstsein Wahrheitsbewusstsein, das Wahrscheinlichkeitsbewusst-
25 sein Wahrscheinlichkeitsbewusstsein heißt? Nämlich phänomenolo-
gisch ist die Sachlage prinzipiell eine ganz andere. Im stellungnehmen-
den Bewusstsein haben wir Richtung (thematische Richtung) auf das
Thema, und das Thema ist mit einem Charakter begabt. Dagegen im
bloßen Sich-Denken haben wir eine thematische Richtung, aber das
30 Thema hat keinen „Charakter“.1
Kann man aber sagen, dass im stellungnehmenden Bewusstsein ein
Komplex vorliege aus dem bloßen Sich-Denken und dem Moment der
Stellungnahme?2 Das wird nun von neuem überlegt werden müssen.3

1 Aber doch einen Quasi-Charakter, ich denke mir „S ist p“, „S ist vermutlich p“,

„Ist S p?“.
2 Natürlich nicht.
3 In den vorstehenden Blättern hatte ich ursprünglich den Begriff des Themas

gefasst im Sinn der bloßen Materie (ohne Qualifizierung) und dann durchgehend
76 zur intentionalität der objektivation

§ 2. Das thematische Bewusstsein als unselbständige


Schicht. Stellungnahme und Thema bei den
synthetischen Akten und beim Gemütsbewusstsein

Sind wir in der Einsicht in die Struktur des Bewusstseins soweit


5 gekommen und haben wir erkannt, dass jedes „thematisch“ stellung-
nehmende Bewusstsein eine Schicht des thematischen Inhalts hat
und eine Schicht des Charakters, so hängt es jetzt von der Inter-
pretation des bloßen Sich-Denkens ab als eventuelles Bestandstück
in allem „thematischen Bewusstsein“, ob wir den Begriff und Ter-
10 minus „thematisches Bewusstsein“ festhalten können.1 Denn müs-
sen wir nun nicht sagen, dass jedes meinende Bewusstsein im Sinn
der δξα ein Thema hat, eben vermöge der thematischen Bewusst-
seinsschicht, die dem Inhalt entspricht, die das eigentlich so zu nen-
nende thematische Bewusstsein wäre, und dass darüber hinaus eben
15 der „Urteilsakt“, die δξα, charakterisiert ist durch die eigentliche
„Aktschicht“,2 durch die doxische?
Wir hätten dann zu sagen: Das Thema gibt insofern die „Richtung
auf den Gegenstand“, als Richtung auf den Gegenstand eben Rich-
tung auf das Thema (in einem anderen Sinn von Richtung) voraus-
20 setzt. Es bleibt dabei, dass die eigentlich objektivierenden Akte die
„meinenden“, nämlich die doxischen sind: Das bloß thematische Be-
wusstsein wäre kein Akt im prägnanten Sinn – schon darum nicht,
weil es eine unselbständige Schicht ist – und zudem, das wären bloß
die „Stellungnahmen“. Doch wäre der Name Akt am besten hier zu
25 vermeiden, wobei freilich ein passender Terminus fehlt. (Vernunft-

ausgebessert, nämlich Thema gefasst als das Ganze von Inhalt und Qualität (also
korrelativ zum intentionalen Wesen der Logischen Untersuchungen) und, wo früher
„Thema“ stand, geschrieben „thematischer Inhalt“. Es ist aber zu überlegen, ob es
nicht einen sehr guten Sinn hat, die bloße Materie als Thema zu bezeichnen (so dass ein
Urteil „S ist p“ und die entsprechende Vermutung und Frage dasselbe Thema hätten).
Doxischer Charakter = Aktcharakter der Objektivation, theoretische Qualität, und
zwar als wirkliche Stellungnahme verstanden.
1 Hier (bis 18 = S. 80,5–81,28) heißt Thema immer so viel wie u n q u alifi zierte

Materie (aber nicht phänomenologisch, als Korrelat der Materie der Logischen Un-
tersuchungen).
2 Das Wort „Schicht“ ist leicht irreführend, da es sich um Unselbständigkeiten

handelt.
text nr. 5 77

akt sagt zu viel. Vielleicht doch „Intention“.) Akt wäre also etwas
Unselbständiges.1 Der Akt der δξα hat sein Thema und setzt das
„bloße“ thematische Bewusstsein voraus, das ihm Richtung auf das
Thema gibt.2
5 Nun gibt es einfache Akte und zusammengesetzte, einschichtige
und fundierte. Die Frage ist, wie sich „Akt“ und Thema bei den
fundierten Akten verhalten. Sollen wir sagen, dass Akte überhaupt
Stellungnahmen zu Themen (in denen sich qualitative Themen, Ur-
teile etc. konstituieren) sind, dass aber die Richtung auf das Thema
10 bzw. die Stellungnahme zu ihm bald eine unmittelbare, bald eine
mittelbare sein kann?3
Zunächst machen auch die z u sam men ge set z ten Akt e ihre
Schwierigkeiten und die Art wie D en k ak te (doxische) in Denkak-
ten bzw. in „bloßen Vorstellungen“4 fundiert sein können. Wenn ich
15 vermute, dass der Kaiser nach Rom reisen wird, so enthält doch das
„Thema“-Bewusstsein der Vermutung bereits doxische Stellungnah-
men, und dasselbe Thema kann Thema einer Gewissheit, einer Frage
etc. sein. Wenn die thematische Reflexion das Thema zum Gegen-
stand macht, so gehört zum Thema da und dort ein „Setzungscharak-
20 ter“, der nur nicht prädikativ und begrifflich gefasst ist.
Nur das Thema, die Materie, der untersten, nicht fundierten Akte
ist charakterlos. Sowie sich ein höherer Akt, ein fundierter erbaut,
tritt in sein Thema der Charakter ein, der dem Thema der untersten
Stufe durch den Akt unterster Stufe erteilt ist. So haben die Themen
25 der synthetischen Denkakte positionale (doxische) Charaktere in
sich.5 Dabei sind die Themen selbst in verschiedener Stufe gebaut,
eben mit Rücksicht darauf, dass sie Charaktere enthalten, die ih-
rerseits einen thematischen Kern haben, der seinerseits wieder im
Thema positionale Charaktere und thematische Inhalte derselben

1 Ebenso aber das Bewusstsein vom „Inhalt“ des Aktes.


2 Aber dieses bloß thematische Bewusstsein ist eine unselbständige, abstrakte
Schicht.
3 Die Richtung des Aktes? Im Akt ist bewusst das Qualifizierte, das Korrelat der

Stellungnahme gehört mit zu dem, worauf der „Blick“ des Aktes geht.
4 Das ist keine Fundierung durch Akte.
5 Nicht Rücksicht genommen ist da auf die Fundierung durch Gedanken, durch

Quasi-Akte, wo sich im Quasi dasselbe wiederholt. All das bedarf aber gründlicher
Erörterung. Es ist fundamental.
78 zur intentionalität der objektivation

enthält usw. Das ist ja in der Sphäre der Urteilsakte die Lehre von der
verschiedenstufigen Gliederung der apophantischen Bedeutungen.
Ich habe so viele Jahre geglaubt, dass das bloße Sich-Denken,
das bloße „Vorstellen“ eine Parallele sei des Urteilens (als Gewiss-
5 seins), derart, dass beide eine gemeinsame, aber abstrakte Schicht
haben des Themas („Materie“) und beiderseits eine verschiedene
„Qualität“.1 Aber da ergibt sich eben die Unzuträglichkeit, dass
die Vorstellungsqualität das Thema nicht qualifiziert und nicht für
Gegenständlichkeit konstitutiv ist, dass das Vorstellungsbewusstsein
10 kein Vernunftbewusstsein ist usw.
Ich habe ferner auch geglaubt, dass jedes Gemütsbewusstsein not-
wendig in einem „objektivierenden“ Bewusstsein fundiert ist; näm-
lich in Konsequenz davon, dass jedes Gemütsbewusstsein ein Thema
„hat“, also eine thematische Bewusstseinsschicht impliziert. Würden
15 wir uns dafür entscheiden, dass eine bloße thematische Schicht keine
„Vorstellungsqualität“ haben muss, keinerlei doxische Qualität oder
Quasi-Qualität, um als Unterschicht eines Gemütsbewussteins zu fun-
gieren, so wären auch Gemütsakte direkt auf ein Thema bezogen. So
das Gefallen an einem bloß Phantasierten oder Abgebildeten, einem
20 Schönheitswerten, das sich um Sein oder Nichtsein nicht kümmert.
Und das wird wieder richtig sein.
Was die versuchte Theorie hier besonders schwierig macht und
höchst bedenklich – nämlich die obige Theorie, welche wieder zu
B r e nt a no zurückmündend jedem Akt ein bloßes Sich-Denken zu-
25 grunde legen möchte –, ist, dass wir doch in der bloßen Phanta-
sie mannigfaltiges bloß Phantasiemäßiges zur Einheit bringen. Der
Zentaur in verschiedenen Erscheinungen steht als Einheit da und
synthetisch als identisches Subjekt der und jener Prädikate, in diesen
Prädikaten bezogen auf ein anderes Phantasieobjekt usw. Da haben
30 wir Gegenbilder von allen synthetischen Charakteren und Formen,
auch von den Charakteren.
Nun ist Phantasie und Sich-Denken nicht dasselbe, aber was wir
sagten, gilt doch ebenso vom Sich-bloß-Denken. Bilden sich da bloße

1 Dem ist nun Rechnung zu tragen dadurch, dass zu jeder stellungnehmenden Quali-
tät als „wirkliche“ Qualität gegenübergestellt wird eine Quasi-Qualität, jedem echten
„Akt“-bewusstsein ein Quasi-Bewusstsein. Und dann ist alles in Ordnung.
text nr. 5 79

Materien? Aber wenn das bloß „Vorgestellte“ zur Materie einer Ge-
wissheit werden sollte, so könnte nicht einfach eine Gewissheit sich
auf diese „Materie“ beziehen, sondern jeder Schritt dabei müsste in
bestimmter Weise, in der Art wie Gewissheit es erfordert, modifiziert
5 werden. Der Zentaur müsste als gewisses Sein, wahrhaftes Sein cha-
rakterisiert werden und ebenso das ihm zukommende Merkmal und
das Zukommen usw. Anstatt der Gewissheitscharakteristik könnten
auch da und dort neben den Gewissheitscharakteren Vermutungs-
charaktere, Zweifelscharaktere etc. auftreten.
10 Soll man sagen: So ist das Wesen des „Bewusstseins“, dass in
sich völlig stellungsfreie bloße Gedanken nicht in beliebiger Weise
stellungnehmende doxische Charaktere annehmen können, sondern
Gedanken sind entweder schlichte oder fundierte, und die Weise der
Fundierung schreibt dann die Art der aktuellen doxischen Charak-
15 terisierungen vor; die höherstufigen können nicht Charaktere haben,
ohne dass vorher die unterstufigen sie haben, und eine synthetisch
so und so geformte Materie kann Materie eines auf sie als Ganzes
bezogenen Charakters nur sein, wenn sie in sich schon Charakter
hat? Ein thematisches Bewusstsein ist also bloß thematisches nur
20 in Hinblick auf einen Akt, dem sie das ganze Thema gibt; anderer-
seits ist ein thematisches Bewusstsein, das synthetisch, also fundiert
ist, niemals ein bloß thematisches, das ist, es schließt als Kompo-
nente und Unterlage ein stellungnehmendes doxisches Bewusstsein
ein.1
25 In jedem doxischen Bewusstsein steht ein charakterisiertes Thema
da (es „erscheint“ in jedem Bewusstsein etwas), und dieses Thema ist
wieder fundiert und hat in der fundierenden thematischen Unterlage
wieder charakterisierte Themen usw.

1 Das ist unrichtig ausgedrückt! Im bloßen Sich-Denken haben wir nicht Charak-

terlosigkeit, sondern die Charaktere sind modifizierte, und bloße Gedanken nehmen
nicht Stellungscharakter an, sondern ihre Charaktere wandeln sich in der Art, die ihr
Wesen vorschreibt, in stellungnehmende um. Was aber die „Materien“ anlangt, so
sind sie in den betreffenden Stellungnahmen, deren Materien sie sind, in ihren unteren
Schichten auch mit Qualitäten ausgestattet, im Übrigen aber unselbständige Schichten
im gesamten Thema. Jede Materie, als Einheit genommen, ist ein Unselbständiges.
80 zur intentionalität der objektivation

§ 3. Das Thema der Freude. Die Scheidung von


Inhalt und Charakter als eine bloße Abstraktion.
Die gedankenhafte Modifikation der positionalen
Charaktere. Ein mehrfacher Begriff des Themas

5 Wie steht es nun mit dem G emü t s be wu sst sei n? Es ist entweder
auf ein pures Thema bezogen, das gar keine Charaktere enthält, oder
es enthält das Thema schon doxische Charaktere, oder es enthält auch
axiologische Charaktere. Wenn es solche Charaktere enthält, dann
kann dem Gemütsakt zugrunde liegen ein doxischer Akt, derart, dass
10 dessen ganzes Thema mit dem zugehörigen Charakter sozusagen als
Gemütsthema fungiert. So bei der Freude. Die Tatsache, dass S p ist,
ist erfreulich. Dem Akt der Freude liegt zugrunde das Urteil „S ist p“;
eventuell das Überwiegend-für-wahrscheinlich-Halten. Die gesamte
Materie des doxischen Aktes gehört zur Materie des Sich-Freuens.
15 Ich urteile: „S ist p“. Dass S p ist, ist das, was mir dabei gewiss ist.
Ich freue mich darüber, dass S p ist: Das Thema der Gewissheit geht
in das ein, dessen ich mich freue. Aber ich freue mich darüber, dass
S p ist, über die Tatsache. So mi t i st da s ni c ht bl oß Th em a d e s
Ur t e i l s , s o nde r n da s c h a r ak t eri si erte T he m a a ls „ T he m a “
20 de r F r e u de z u be z e ic h n e n ( a l s i h r t he m a ti sc he r I nh al t).
Folglich ist die ganze frühere Darstellung, wonach nur die doxi-
schen Akte als thematische bezeichnet werden (mit der Grundauffas-
sung, dass solche Akte allen Akten ein Thema geben), zu verwerfen.
„Th e ma“ bedeutet so viel wie da s Wa s d er St e ll un g na hm e,1 de s
25 „ A k te s “ i n de m n e u e n p r ä g n a n t e n S i nn (also beim Urteil nicht
das logische Urteil „S ist p!“, sondern den „Inhalt“ „S ist p“, beim
Wünschen nicht den Wunsch „S möge p sein!“, bei der Freude nicht
das Erfreutsein von S p, sondern – cf. folgende Seite – die Tatsache,
dass S p ist! usw.).
30 Jeder Akt ist Stellungnahme zu etwas, in jedem ist etwas bewusst
als etwas, zu dem Stellung genommen ist,2 das als so und so quali-

1 Oder das Was einer Qualität, wie es korrelativ lauten muss.


2 Jedes „Stellungnehmen“, jeder Akt im prägnanten Sinn, ist Stellung nehmen zu
etwas. So kann man freilich sagen. Aber nicht ist damit gesagt, dass in jedem Akt,
wie es das Bild vom Stellungnehmen besagt, ein Gegenüber vorliegt zwischen einem
Etwas, zu dem Stellung genommen ist, und einem Stellungnehmen selbst. Dieses Bild
text nr. 5 81

fiziertes Thema vor dem Blick steht. So viele Qualitäten, Gesamt-


qualitäten, so vielartige Akte – dabei ist vorausgesetzt, dass wirklich
„Freude“ und „Urteil“ als Qualitäten gleichstehen (ich meine na-
türlich die ontischen Korrelate). Jeder Akt hat eine thematische
5 „Richtung“, Richtung auf ein Thema, und es bleibt dabei, dass diese
Richtung nicht Richtung auf einen Gegenstand ist, sondern auf das
im Aktbewusstsein eben Bewusste, wie zum Beispiel in der Freude
die Richtung darauf, dass der Garten in Blütenflor steht. Wobei dieser
Satz mit allen seinen Teilen und Formen zum Thema gehört, durch
10 jede Form geht das Freude-Bewusstsein hindurch, auf jede – eben auf
dieses Ganze, wie es dasteht – ist das Freude-Bewusstsein thematisch
„gerichtet“, und dabei gehört auch zum Thema der Freude der Urteil-
scharakter, der das durchtränkt (der Wahrheitscharakter im Thema).
Das Thema ist bewusst durch ein Urteilsbewusstsein, das seinerseits
15 sein Urteilsthema hat, und das letztere stimmt mit dem Freudenthema
völlig überein, bis auf den Freudencharakter, der im bloßen Ur-
teil fortfällt. Das Urteilsthema ist fundiert und enthält Glieder, die
selbst wieder Thema und Charakter unterscheiden lassen, was also
phänomenologisch zurückführt auf ein neues Aktbewusstsein, und
20 zwar hier ein doxisches. Zuletzt kommen wir notwendig auf Themen,
die keinen Charakter mehr enthalten, und phänomenologisch auf
ein Bewusstsein, das keinen Stellungscharakter mehr enthält (bzw.
nach der anderen Auffassung eine abstrakte Bewusstseinsschicht).
(Natürlich bedarf es für die Freude keines begrifflich-ausdrücklichen
25 Urteilsbewusstseins, keiner Prädikation, und hier ist manches nä-
her zu studieren. Auch inwiefern besondere „Gefühlscharaktere“
an „theoretisch“ erfassten Einzelheiten fundierend für die Freude
fungieren etc.)

leitet immer wieder irre. Im Urteilen und ebenso in jedem schlichten intellektiven
Bewusstsein, nämlich in jedem, das kein Zustimmen ist oder Ablehnen, haben wir
kein Gegenüber von einem „Thema“, zu dem Stellung genommen wird, und dem
Stellungnehmen. Vielmehr haben wir nichts weiter als das Was des Bewusstseins, als
das „Urteil“, das Wahrscheinlichsein usw.
Im Grunde ist es nicht viel anders bei den fundierten Akten, Wünschen, Freuden
etc. Denn auch da steht einfach da der Wunsch, das Erwünschtsein, das Erfreulichsein
etc. Aber hier liegt die Sache so, dass das Was, das im Wunsch bewusst ist – das volle
und ganze Was, worauf wir wünschend gerichtet sind –, als Unterschicht ein volles
„logisches“ Urteil hat und überhaupt ein volles „Thema“ eines anderen Aktes, und
dieses erhält nun einen neuen „Charakter“ (neue Qualität).
82 zur intentionalität der objektivation

Wiederholt muss ich überlegen, ob meine Darstellung in der Hin-


sicht korrekt ist, als ich sage, dass ein stellungnehmendes Bewusst-
sein dem „Thema“ (Materie) zugewendet ist, zu dem der Charakter
(Qualität) n ic ht gehört.1 Ist es nicht korrekter zu sagen, dass das
5 Bewusstsein zugewendet ist dem „vollen“ Thema, dass aber zu m
T hem a eb en d er C ha ra kt er g ehö rt, und so war doch meine
Auffassung in der Lehre von den Kategorialien etc.2 Die Scheidung
von Inhalt (Materie) und Charakter ist doch nur eine Abstraktion.
Ich kann diese Abstraktion jederzeit vollziehen, aber wenn ich ur-
10 teile, ist das Urteilsbewusstsein gerichtet eben auf das Urteil (im
thematischen Sinn), auf das „S ist p!“ Und da ist nicht ein Thema
und davon irgendwie geschieden, in einer anderen Schicht liegend,
ein Charakter, sondern eben das „S ist p!“; aber jederzeit kann ich
hier eine Unterscheidung vollziehen und sehen, dass dieses selbe „S
15 ist p“ auch in einer Vermutung vermutet, in einem bloßen Gedanken
bloß gedacht sein kann.
E s wi r d wo h l a u c h n i c h t ang ehe n, d as bl oße G eda nk en -
b e wu s st se i n a l s e i n ch ar ak t er lo ses anz us e he n, s ta t t z u
s a g e n , e s s e i a n st e l l e de s „ wi rk l ic he n “ C h a ra kt e r s e in
20 mo di f i z i e r t e r. Es treten doch in dem Verstehen eines nach Grund-
setzungen und Daraufsetzung falschen Satzes – z. B. „Jedes regelmä-
ßige Dekaeder wird von jeder Ebene in 22 Graden geschnitten“ –
eben alle Grundsetzungen und Daraufsetzungen auf, das Subjekt
steht im Seinscharakter da etc. Aber alle diese positionalen Cha-
25 raktere sind „modifiziert“ ins „Gedankenhafte“. Verwandelt sich
ein solches bloßes Verstehen in ein Gewissheitsurteilen, so verwan-
delt sich jeder modifizierte Charakter in einen wirklichen Charakter.
Nicht aber, als ob die modifizierten Charaktere erhalten blieben, in
dem Gewissheitsbewusstsein auch daständen und dazu die wirklichen
30 Geltungscharaktere.3

1 Revision. – In den Seitenbemerkungen der vorigen Blätter ist dem schon Rechnung

getragen.
2 Im Folgenden: Thema = qualifizierter thematischer Inhalt.
3 Oder es verwandelten sich die modifizierten Charaktere, die die gesamte Quali-

tät „Urteil“, vermeinte Wahrheit fundieren und Wahrheitswert haben, in wirkliche


Wahrheitswerte etc.
text nr. 5 83

Es ergibt sich also ein meh rf ach er B eg ri ff v on Th em a:


1) Jedes Bewusstsein ist Bewusstsein von etwas, hat ein Thema,
es ist auf etwas gerichtet, und nur dadurch kommt ihm „Beziehung
auf eine Gegenständlichkeit“ zu; wobei aber die Gegenständlichkeit
5 die intentionale Gegenständlichkeit heißt und vom Thema zu unter-
scheiden ist.1
2) Das Thema hat einen t h em a ti sc he n In h al t und einen the -
m at is c h en C h ara kt er. Dieser thematische Inhalt bildet einen
zweiten Begriff von Thema. Wir sagen aber besser th em at i s che r
10 I n h al t.2
Es wäre dann ferner zu sagen – zunächst für die Sphäre der
doxischen Akte –, jedem Urteil entspricht ein modifizierter Akt
(sozusagen ein inaktueller, ein gedankenhafter) und dementspre-
chend: Jedem aktuellen Thema entspricht ein inaktuelles oder je-
15 dem „wirklichen“ Thema ein thematischer „Gedanke“. Da der the-
matische Gedanke dem thematischen Inhalt nach übereinstimmt mit
dem wirklichen Thema, so kann man in Form des Gedankens jedes
Thema modifizieren bzw. jeden thematischen Inhalt gedankenmäßig
„isolieren“. Das sagt darum etwas, weil sich nicht willkürlich jedes
20 Urteil, aber willkürlich jeder Gedanke „bilden“ lässt. Ich meinte
nun weiter, d a s s d e r G e g e ns a t z v o n „ w i rkl i ch em “ Ak t un d
g e d a n k e nh a f te r Mo di f i k a ti o n d ur ch a ll e G a t tu ng e n des
B e w uss t se i n s hi n du r c hg e h t.

§ 4. Die Möglichkeit der Verwandlung jedes Themas in


25 ein objektivierendes Thema. Der thematische
Inhalt des Wunsches. Inwieweit Gewissheit und
Gewissheitsmodi bei allen Akten auftreten
können. Schwierigkeiten in der doxischen Sphäre

Aus jedem unmodifizierten (aktuellen) Bewusstsein lässt sich nun


30 ein doxologisches unmodifiziertes Bewusstsein bilden, das ihm eine
ihm eigentümliche und seinem Thema entsprechende Objektität ent-

1 Das Thema in diesem ersten Sinn ist der „Satz“ im Sinn der Ideen.
2 Thematischer Inhalt ist der „Sinn“.
84 zur intentionalität der objektivation

nimmt. Das sagt: Jedes Bewusstsein ist Bewusstsein eines Themas.


Und damit gleichwertig ist (unmodifiziertes, aktuelles Bewusstsein
vorausgesetzt): In jedem Bewusstsein „erscheint“ etwas. Im Wunsch-
bewusstsein „Es möge S p sein“ ist dieses Thema bewusst, und dazu
5 gehört das entnehmende Urteil: „Dass S p sei, das ist erwünscht“.
Nun wird geurteilt, und das Thema dieses Urteils ist „prätendierte
Wahrheit“, es ist das Urteil im objektiv-logischen Sinn.
Nun sagt man: Im Wünschen ist mir der Wunsch bewusst (der
Wunsch ist hier das Thema); andererseits, im Wünschen steht mir
10 etwas als wünschenswert charakterisiert da. In der Freude steht mir
etwas, eine Tatsache als erfreulich da. Ich freue mich, und mit der
Freude wende ich mich der erfreulichen, mir urteilsmäßig bewussten
„Tatsache“ zu. Sie hat bewusstseinsmäßig den Erfreulichkeitscha-
rakter, aber dieser ist nicht in die Objektivation aufgenommen. Das
15 ist: Objektiv stehen die und die Gegenstände da und objektiv ihre
Eigenschaften und Verhältnisse. O bj ekt i vi tä t s bew us s ts ei n i st
n u r B e wu s s t s e i n do x i sc her A rt , ei n B ew us st se i n m i t e i nem
d o x i s c he n Th e ma. Das alles ist richtig. Also im Wünschen ist
der Wunschcharakter nicht objektiviert, aber er kann objektiviert
20 werden.
Also jedes Bewusstsein (jedes aktuelle) hat ein Thema, aber nicht
jedes hat ein objektivierendes Thema. Jedes Thema lässt sich in ein
solches verwandeln, ihm lässt sich ein objektivierendes, das in ihm
verborgen ist, entnehmen. In jedem Bewusstsein „erscheint etwas“;
25 es bedarf aber eines Objektivierens, um ihm durch ein objektivieren-
des Thema den Gegenstand zu „entnehmen“.
Ich hatte also am Anfang unter Thema immer das objektivierende
Thema verstanden1 oder vielmehr seinen Inhalt; und zum Thema
machen, ein thematisches Bewusstsein etablieren, das hieße, in die
30 Urteilsstellung übergehen, die das zum Bewusstseinswesen gehörige
Bezogensein-auf-eine-eigenartige-Gegenständlichkeit herausholt.
Das objektivierende Bewusstsein ist von vornherein auf Gegen-
ständlichkeit bezogen dadurch, dass es ein objektivierendes Thema
hat. Jedes andere birgt in seinem Wesen die Möglichkeit gewisser
35 Objektivationen. Wir stellen dabei in Parallele: das beliebige aktuelle

1 Dritter Begriff von Thema. Engster Begriff: objektivierendes Thema.


text nr. 5 85

Bewusstsein und das Wahrnehmungsbewusstsein, das letztere, bevor


es Grundlage eines Urteilsbewusstseins geworden ist.
Geht man der Struktur des Bewusstseins in lebendiger Intuition
nach, so lasse man sich nicht durch die Sprache zu sehr leiten und
5 eventuell irreführen. Sage ich: „Es ist zu vermuten“ oder „Ich ver-
mute, dass S p ist“ und wieder „Ich wünsche, dass S p ist“, so scheint
es, als ob einfach beiderseits ein und derselbe thematische Inhalt in
verschiedener Weise des Bewusstseins gegeben ist bzw. dass verschie-
denes Bewusstsein auf dasselbe gerichtet ist. Näher besehen haben
10 wir im Vermutungsbewusstsein den thematischen Inhalt „dass S p ist“
in der Vermutungscharakteristik, aber nicht einfach denselben Inhalt
in der gleichstehenden Wunschcharakteristik. Nämlich der themati-
sche Inhalt ist zwar da, aber in der Charakteristik der Erfreulichkeit,
und das alles gedankenhaft modifiziert. Es liegt also zugrunde das
15 modifizierte Bewusstsein der Freude darüber, dass S p ist, genauer
die Urteilsmodifikation „S ist p“, charakterisiert in der Modifikation
der Freude. Und erst darüber baut sich der aktuelle Charakter des
Wunsches auf.
Der thematische Inhalt des Wunsches wäre danach der Gedanke
20 der Erfreulichkeit des „S ist p“, nur dass dieser Gedanke wieder
nicht in dieser doxologischen Form zugrunde liegt, die ihm jeder-
zeit gegeben werden kann. Es ist kein doxologischer Gedanke. Der
Wunsch, das Seinsollensbewusstsein, richtet sich auf den erfreulichen
Gedanken, Wertgedanken als thematischen Inhalt, und intentional
25 ist er bezogen auf das gedachte Erfreulichsein, auf den gedachten
Seinswert, der in ihm sozusagen gilt als Seinsollendes. Und wohl
noch eine Stufe höher liegt der Wille. Das Seinsollende im Sinn des
Seinsollensbewusstseins ist sozusagen der eigentümliche Gegenstand
des Willens, wie sein Thema das Seinsollende selbst ist (nicht das
30 Wünschen). Das „Erwünschte als solches“ ist das praktisch Gesetzte.1
Ich glaubte ferner annehmen zu können, dass Ge w i s s he i t ,
Z w ei f e l e t c. M od i s i nd , d i e be i a ll e n Ak te n a uf t r e t e n
kö n nen, also auch bei den doxischen, und dass somit zwischen
doxologischer Gewissheit (Urteil in prägnantem Sinn) und jeder an-
35 deren Gewissheit zu unterscheiden ist, wobei aber jede nicht-doxische

1 Wenn wir von „erwünscht“ sprechen, so ist oft das Seinsollende gemeint.
86 zur intentionalität der objektivation

in eine doxische überzuführen ist. Wie jedes Urteil kann ja auch


das Urteil „Dass S p ist, ist erfreulich, erwünscht etc.“ als solches
Gewissheitscharakter haben, von da übergehen in Zweifel etc. Und
schließlich gilt dasselbe auch von Vermutung etc. Dass irgendetwas
5 vermutlich ist, ist eine Gewissheit, die ihre Parallele hat in einer
entsprechenden Vermutung etc.
Es ergeben sich aber in der doxischen Sphäre Schwierigkeiten.
„Dass S p ist, ist gewiss“, das kann nun selbst wieder ungewiss,
zweifelhaft, vermutlich werden etc. Ist nun das Gewissheitsbewusst-
10 sein etwas, das Modi der Gewissheit haben kann? Da ist in der Tat
eine Schwierigkeit. Geht die Gewissheit, das Urteil „S ist p!“, in
eine bloße Vermutung über, sofern ich Gegenmotive erfasse, oder
in einen Zweifel, so verliert das Urteil „Dass S p ist, ist gewiss“
selbst seinen Gewissheitscharakter und verwandelt sich in „Dass S
15 p ist, ist vermutlich, ist zweifelhaft“, aber doch nicht in das Urteil
„Es ist vermutlich, dass S p ist, gewiss = wahr ist“? Nun sind das
Äquivalenzen, aber wie klären die sich auf?
Das wäre verständlich,1 wenn d i e Ve rm u tu ng e in f u ndi e rt e r
Ak t wäre, nämlich we n n nur d i e G e w i ssh ei t u nf un di er t wäre,
20 di e Ve r mu t u ng a be r a l s ih r e n ei gen tü m l ic he n t he m at i -
sc he n I n ha l t hä t te d i e U r te i l s m od i f ik at i on „ S is t p! “ (ähn-
lich wie wir es oben beim Wünschen ausführten).2 Auf die vorgestellte
Wahrheit, Gewissheit wäre dann die Vermutung gerichtet: „Ich ver-
mute, dass S p wahr ist“. Ebenso die Frage, der Zweifel, auch die
25 Negation, endlich auch die Affirmation. Ich denke mir, dass S p ist,
gedankenhaft steht mir die „Wahrheit“ da und sie „stimmt“; sie ist
die durch irgendwelche Gewissheitsmotive geforderte.
Das sind feine Sachen, und es ist schwer, sich hier zu entscheiden.
Jedenfalls hat diese Auffassung, wonach nur Gewissheit ein schlichter
30 stellungnehmender Akt ist, während alle modalen Unterschiede auf
Fundierung durch Modifikationen der Gewissheit (durch gedanken-
hafte, quasi-urteilende Akte) beruhen, viel für sich.3 Aber festlegen

1 Nein!
2 Ob modale Abwandlungen des Urteils im engeren Sinn in Urteilsgedanken fundiert
sind. Die Ansicht wird aber später widerlegt, p. 24 = S. 90,24–92,16.
3 Das Gegenteil stellt sich als richtig heraus.
text nr. 5 87

möchte ich das nicht.1 Wir müssen ja auch überlegen, dass wieder eine
Vermutung, ein Für-Wahrscheinlich-Halten ins Schwanken kommen
und selbst wieder vermutlich werden kann, sofern ja das entspre-
chende Wahrscheinlichkeitsurteil „Es ist wahrscheinlich, dass …“
5 aus Gewissheit in bloße Vermutung übergehen kann usw. Überlegen
wir näher. 2

§ 5. Inwieweit und in welcher Hinsicht Urteil


und Gedanke ein gemeinsames Wesen haben

Das Verhältnis zwischen Materie und Qualität im doxischen Akt


10 (im theoretisch stellungnehmenden Akt, sagen wir: im prädizieren-
den Akt). Ein Urteil, etwa „Das S und das Q stehen in der Bezie-
hung R zueinander“, und eine entsprechende Vermutung, der ent-
sprechende Zweifel, haben den thematischen Inhalt, die „Materie“
gemein. Das volle Was, das volle Thema ist einmal: „S und Q stehen
15 in der Beziehung etc.!“, „Vermutlich stehen S und Q etc.“, „Ob
wohl S und Q etc.?“ Was haben diese Themen, das Urteilsthema, das
Vermutungsthema, das Fragethema miteinander gemein? Unmittel-
bar gehört der Gewissheitscharakter zu dem In-Bezug-Stehen, und
ebenso gehört dazu der Vermutungs- und Fragecharakter.
20 Mindestens bei dem Fall der Gewissheit kann ich nicht annehmen,
dass das In-Bezug-Stehen „bloß gedacht“ ist, wobei es die der Gewiss-
heit gegenüberstehende Quasi-Qualität haben müsste, als ob darin
der Gewissheitscharakter fundiert wäre. Das In-Bezug-Stehen, das
in Gewissheitsweise dasteht, hat ein Wesen, das ebenso vorhanden
25 ist wie im Fall der bloß gedankenhaften Gegebenheitsweise. Würde
sich der Vermutlichkeitscharakter und Fraglichkeitscharakter unmit-
telbar mit diesem „Wesen“ verbinden, so hätten wir also überall ein
gemeinsames Wesen, nur anders charakterisiert. In dieser Hinsicht
ergeben sich je nach der Stellung, die wir da einnehmen, sehr verschie-
30 dene Auffassungen von dem, was das „Wesen“ hier besagt. Lassen wir

1 Gründe dagegen 24 = S. 90,24–92,16.


2 Das Problem wird nach einer vorausgeschickten allgemeineren Überlegung aufge-
nommen 232 = S. 89,21–90,23 oder 24 = S. 90,24–92,16.
88 zur intentionalität der objektivation

das zunächst noch ruhen und überlegen wir, wie dieses „Wesen“ des
In-Bezug-Stehens sich zu der übrigen „Materie“ verhält. Es handelt
sich um etwas in Relation zu diesem Übrigen Unselbständiges.
„S und Q stehen in der Beziehung φ.“ Vom phänomenologischen
5 Standpunkt aus sagen wir: Der Stellungscharakter der Gewissheit
ist fundiert mitsamt seinem unmittelbaren Inhalt in den Akten „S“
und „Q“ bzw. in dem konjunktiv stellungnehmenden Akt „S und
Q“. Oder: In der Weise der Gewissheit gesetzt ist das In-Bezug-
Stehen als dasjenige der schon als seiend gesetzten S und Q und ihrer
10 Konjunktion. Und so ist auch im Thema der Gewissheitscharakter des
ganzen Themas fundiert in den Gewissheitscharakteren der Glieder;
und eben dasselbe hat zu gelten von dem Vermutlichkeitscharakter
und Fraglichkeitscharakter.
Der entsprechende bloße Gedanke lautet: „S und Q stehen in der
15 Beziehung φ“, wobei das S und Q im bloßen Denken in der Weise
von „nominalen Setzungen“, und zwar von Gewissheitssetzungen
enthalten sind, so dass das bloße Sich-Denken seine Unterlage hat
in gewissen „unmodifizierten“ Stellungnahmen. Und das ist wie-
der thematisch (noematisch) zu interpretieren, ebenso wie noetisch
20 (phansisch).
Vergleichen wir die parallelen Akte (die vollen intentionalen Er-
lebnisse) bzw. die parallelen Themata, so können wir ein gemeinsames
Wesen herausheben, und dieses Wesen enthält, was die Themata
anlangt, die wirklichen, unmodifizierten Themata S und Q, also nicht
25 etwa die subjektiven Erlebnisse, sondern die Sätze, die, wie ich sa-
gen würde, von vornherein ideale Einheiten sind und als solche in
allgemeine Wesen eintreten können. Denn das Wesen, das wir hier
bilden, ist ein allgemeines, das, was im idealen Gegenstand, genannt
Thema, beiderseits zu finden ist. Deutlicher gesprochen: Einmal in
30 dem „logischen Urteil“ und das andere Mal im „logischen Gedan-
ken“, das dritte Mal in der logischen Vermutlichkeit (Wahrschein-
lichkeitssatz) usw.
Andererseits, von den intentionalen Erlebnissen sagen wir, dass
sie das Allgemein-Wesentliche eigentümlich haben. Mehrere Urteils-
35 erlebnisse können wesentliche Gemeinsamkeiten haben, sofern sie
dasselbe „Urteil“ urteilen, also identisch dasselbe Thema haben.
Mehrere intentionale Erlebnisse können das gemein haben, dass sie
so fundierte sind, dass hinsichtlich der fundierenden Akte diese Iden-
text nr. 5 89

tität des Themas besteht, also eine entsprechende Wesensgemein-


schaft in diesen Akten, dass andererseits hinsichtlich der fundierten
Erlebnisse eine allgemeinere Gemeinschaft des Wesens besteht, die
eben der allgemeinen Wesensgemeinschaft der Themata entspricht.
5 Also in dieser Hinsicht ist wohl alles klar.
Gehen wir nun auf das angeregte Problem zurück, wie die Wesens-
gemeinschaft von theoretischen Themen, von Urteil, Gedanke und
wieder von Urteil, Wahrscheinlichkeitssätzen, Frage etc. aufzuklären
ist. Im Urteilen ist geurteilt „S ist p!“, im Sich-bloß-Denken ist ge-
10 dacht „S ist p“. Durch Ideation, in welcher wir die beiden Themata zu
Gegenständen machen, erfassen wir als gemeinsame allgemeine Idee
das Wesen des Urteils als identisch mit dem Wesen des Gedankens?
Nein, das Wesen des Urteils ist Urteil, das Wesen des Gedankens
ist Gedanke, wird man sagen. Aber ist das Wesen des Rots rot, das
15 Wesen des Dinges Ding? Das Wesen des Rots ist „Rot“, das Wesen
des Dinges ist „Ding“, so ist das Wesen des Urteils „Urteil“. Das
Wesen des Gedankens ist „Gedanke“, das heißt, jeder Gedanke steht
unter der allgemeinen Idee Gedanke (Eidos Gedanke), jedes Urteil
unter der allgemeinen Idee Urteil, jedes Rot unter der allgemeinen
20 Idee „Rot“. Dabei ist es gleich, ob mir Urteil, Gedanke, Rot aktuell
gegeben ist oder „eingebildet“. Frage ich aber, was haben das wahrge-
nommene Rot und das phantasierte Rot, das wahrgenommene Ding
und das phantasierte Ding „als solches“ gemein, so ist das nicht genau
dieselbe Frage wie die unsere, denn es handelt sich um das Thema
25 der Rotwahrnehmung als Rotsetzung und um das Thema des Rot-
Denkens, nicht aber um das gemeinsam Gegebene in der Rotwahr-
nehmung und des Rot-Phantasierens. Im Rot-Wahrnehmen steht
dasselbe als seiendes Rot gegeben da, was im Rot-Phantasieren als
Rot-Phantasma, als „vorschwebendes“ und quasi-seiendes bewusst
30 ist. Müssen wir nicht sagen, dass das ein Letztes ist, ein Irreduzibles?
Im R ot - W ah r n e hm e n u nd R o t - P ha n ta s i e r e n kann ich
durch Ideation das W e s en (Eidos) Rot entnehmen; es ist darin gege-
ben.1 I m R ot - S e t ze n un d R o t - De n ke n kann ich durch Ideation
nicht das Wesen Rot entnehmen, sondern das Wesen Rot-Gemeintes
35 als solches. Nehmen wir „rundes Viereck“, so gibt es gar nicht das

1 Wie die beiden Akte selbst-gebende, quasi-gebende sind.


90 zur intentionalität der objektivation

Wesen „rundes Viereck“, aber wohl das Wesen „Rundes-Viereck-


Gemeintes“ (das Thema, genauer der thematische Inhalt). Also im-
mer wieder ist daran zu mahnen, dass nicht Gedanke und Phan-
tasie verwechselt wird. Ist das richtig gestellt, so können wir wohl
5 nicht anders sagen als, das ist eine ursprüngliche Gemeinschaft;
ein allgemeines Wesen ist bei Urteil (Satz) und Satzgedanken zu
entnehmen.

§ 6. Ist die Vermutung in einem bloßen Gedanken


fundiert oder stehen sich alle Qualitäten und ihre
10 gedankenhaften Modifikationen einander gleich?

Wie steht es nun mit den modalen Unterschieden des Urteils,


der Vermutung, der Frage? Natürlich kann man hier ebenso sa-
gen, sie haben denselben thematischen Inhalt, und zwar haben wir
hier zwei Möglichkeiten der Interpretation. Entweder wir sagen: Im
15 Urteil ist dieser Inhalt unmittelbar charakterisiert als Gewissheit und
ebenso unmittelbar charakterisiert als Wahrscheinlichkeit, Möglich-
keit, Fraglichkeit. Oder wir sagen: Hier ist die Charakteristik keine so
unmittelbare, vielmehr ist der Inhalt zunächst gedankenhafter Inhalt,
und durch das Medium dieser Quasi-Charakteristik ist er als wahr-
20 scheinlich, fraglich charakterisiert. Dieser Inhalt ist zunächst Inhalt
eines Gedankens und als solcher derselbe wie der des entsprechenden
Urteils, und der Gedanke ist unmittelbar als Thema oder thematischer
Inhalt der Vermutlichkeit charakterisiert.
Dann hätten wir die Analogie mit der Freude (Werthaltung). Die
25 Tatsache ist erfreulich (wert). Oder noch mehr mit dem Seinsollensbe-
wusstsein: Guthaltung. Das als erfreulich Gedachte ist erwünscht, ist
ein Seinsollendes. Die Setzungsweise des „Sein-Sollens“ „setzt“ ein
gedachtes Sein als gedachte Materie einer Erfreulichkeit.1 So ist das
„vermutlich“ eine Setzungsweise, und diese Setzungsweise betrifft
30 ein gedachtes Sein. Ebenso das „fraglich“. Ein gedachtes Sein wird
gesetzt in der Weise des „fraglich“. Aber auch ebenso im Fall der
„Anerkennung“, der Zustimmung. Ein gedachtes Sein wird gesetzt

1 Materie der Guthaltung bzw. des Gutseins.


text nr. 5 91

als „Es ist wirklich so, in der Tat so“. Und im Fall der Verwerfung,
des Nichtigkeitsbewusstseins: Ein gedachtes Sein wird gesetzt in der
Weise des „nicht so“.
Aber man kann dieser Auffassung Folgendes e nt ge g e ns et z en:
5 In der Erwägung vermittelt ein gedachtes Sein; aber sollte eine
schlichte Seinsanmutung nicht genauso einfach sein wie ein schlichter
Glaube? Bei der Vermutung haben wir freilich oft – als Bewusst-
sein nämlich verstanden von überragender Wahrscheinlichkeit – eine
Komplikation. „S ist p“ steht in der Weise passiver Anmutung da,
10 zugleich spricht allerlei dagegen, es ist durch negative Anmutungen
charakterisiert, und eine Entscheidung geht als Bewusstsein des Vor-
zugs auf die eine Seite. Aber sollte da noch eine weitere Kompli-
kation durch Unterlegung von Gedanken statthaben? Das ist doch
nicht (oder ich vermag es jetzt nicht) durch Analyse zu konstatieren.
15 Natürlich kann man auch sagen, der Gedanke „dass S p ist“ ist frag-
lich, dafür spricht etwas, er ist wahrscheinlich. Aber besagt das Wort
„Gedanke“ hier das, worauf es ankommt, und nicht vielleicht eben
das, was wir thematischen Inhalt nennen? Oder das Bewusstsein von
diesem Inhalt, der ja nach jeder Auffassung eine Komponente ist des
20 betreffenden intentionalen Erlebnisses? Also hier finde ich ke in e
e nt s c h e i d e nd e n Mo t i v e , di e S t e l l u n gna h me d er L og is c hen
U n t e rs uc h u n ge n z u v er ä nde r n. Aber die früher, auf p. 212 = S.
86,11–87,6 vorgebrachten Motive für eine solche Fundierung sind
durch das nicht berührt worden! Und einen Unterschied nicht sehen,
25 ihn nicht konstatieren können, heißt nicht, dass er nicht da und bei
besserer Analyse schließlich zu konstatieren sei.
Wie klärt sich die Äquivalenz auf zwischen „Vermutlich ist S p“
(„Dass S p ist, ist vermutlich“) und „Vermutlich ist, dass S p ist,
wahr“? Ginge die Vermutung auf den gedachten Sachverhalt, so
30 hätten wir die Quasi-Wahrheit „S ist p“ vor Augen, etwa so, dass
S als Wirklichkeit unmodifiziert dasteht und dieses in Wirklichkeits-
weise bewusste S „gedacht“ wäre als p, nämlich darauf eine Quasi-
Setzung „ist p“ gegründet wäre. Auf dieses gedachte „Wirklichsein“,
„Wirklichsosein“ richtet sich nun die Vermutung. „Vermutlich ist es
35 so“ und „Vermutlich ist es wirklich so“ ist ein und dasselbe. Sach-
lich dann. Ein Unterschied besteht darin, dass einmal der schlichte
Gedanke (das schlichte Quasi-Urteil) „S ist p“ vollzogen ist, das
andere Mal der Reflexionsgedanke „S ist wirklich p“, und beide sind
92 zur intentionalität der objektivation

ja miteinander äquivalent, sofern zum Wesen des Urteils gehört, dass


das Geurteilte in Wirklichkeitsweise bewusst ist, aber nicht (was ein
unendlicher Regress wäre) prädikativ vom Urteilsinhalt ausgesagt ist;
was aber jederzeit möglich ist.
5 Es ist also, scheint es, klar, dass die unmittelbare Äquivalenz
der beiden Wahrscheinlichkeiten eine Konsequenz des Aufbaus der
Vermutung wäre, ihre Fundierung in dem Gedanken, dem Quasi-
Urteil. Es würde sich überhaupt erklären, warum wir in Vermutungen
hinsichtlich der Vermutungsinhalte Äquivalentes durch Äquivalentes
10 ersetzen können: bei Äquivalenz der Vermutung selbst. Ebenso bei
der Frage etc. Wäre die Vermutung dessen, dass S p ist, eine direkte
Charakterisierung des „Inhalts“ „S ist p“, so würde die Prädikation
„Dass S p ist, ist vermutlich“ bloß auseinanderlegen Charakter und
Inhalt, und es wäre nicht verständlich, wie nun der Inhalt durch einen
15 äquivalenten ersetzbar wäre: für das prädikative Wahrscheinlichkeits-
urteil. Dagegen: Ist das alles wirklich völlig klar?
Die Wahrscheinlichkeit mag in einem Gedanken fundiert sein,
aber wahrscheinlich ist nicht der Gedanke (der ja als Gedanke ist),
sondern eben dies, „dass S p ist“. Und ändere ich diesen „Inhalt“
20 (sei es auch in logischer Äquivalenz), so ist die Vermutung doch
eine andere. Es ist und bleibt ein ursprüngliches Gesetz, dass jede
Veränderung des Vermutungsinhalts, der die „Sachlage“ ungeändert
erhält – also innerhalb der Sphäre unmittelbarer Äquivalenz, der
Äquivalenz im eigenen Wesen –, Wahrscheinlichkeiten konstituiert,
25 die ebenfalls äquivalent sind. Ebenso wie es ein ursprüngliches Gesetz
des Urteils ist, dass Urteile verschiedenen Inhalts dieselbe Sachlage
konstituieren können. Hier haben wir bloß zu sagen: Es gibt so etwas
wie Äquivalenz.
Ja aber, wird man sagen: Sage ich aus „Dass S p ist, ist wahrschein-
30 lich“, so ist das ein Urteil. Und in jedem Urteil kann ich äquivalente
Glieder durch äquivalente ersetzen. „Dass S p ist“ kann ich eben be-
liebig in der Sphäre der Äquivalenz verschieben. Das bleibt aber, ob
die Anmutung durch Gedanken oder nicht durch Gedanken fundiert
ist.
35 Indessen, das ist ein T ru g sc h l us s. Das Subjekt des Wahrschein-
lichkeitssatzes ist der unqualifizierte Sachverhalt, das Prädikat ist
„wahrscheinlich“. Als Gegenstand genommen ist er immer wieder
ein anderer, möge ich auch Äquivalentes nehmen. Der Inhalt als
text nr. 5 93

Inhalt ist nicht äquivalent mit dem anderen Inhalt: Für Inhalte gibt es
keine Äquivalenz. Äquivalenz sagt Gleichwertigkeit in der Wahrheit;
wenn das eine wahr ist, so ist das andere wahr. Wenn das eine
besteht, ist, so ist das andere, in Bezug auf Sosein und Sein. Der
5 Inhalt als Gegenstand ist aber immer, was er ist.
Man könnte auch Folgendes überlegen: Ich stelle mir bloß vor,
dass S p ist. Ich urteile nicht. Von dem so Vorgestellten sage ich dann
aus, dass es wahrscheinlich ist. In der Vermutung liegt diese bloße
Vorstellung zugrunde, das Vorgestellte hat den Charakter vermutlich,
10 wahrscheinlich, aber ich prädiziere nur nicht. Was ist das für ein bloßes
Vorstellen? Wenn ich prädiziere „Dass S p ist, ist wahrscheinlich“,
setze ich den „nominal vorgestellten“ Sachverhalt nicht als wahren,
nicht als Tatsache, Sachbestand. Aber es ist in diesem kategorischen
Urteil an Subjektstelle doch etwas gesetzt. Dies, dass S p ist, dieser
15 „Sachverhalt“ – ich setze ihn, aber nicht besteht das Setzen in der
Setzung der Tatsächlichkeit, sondern in der Subjektsetzung für die
jetzige Wahrheit, und in dieser ist gesetzt der bloße unqualifizierte
Sachverhalt. Aber kann ich diese Setzung vollziehen, ohne zunächst
„S ist p“ vorzustellen (vor der nominalen Umwendung), und ist dieses
20 Vorstellen nicht ein Sich-Denken?
Ein Sachverhalt ist entweder wirklich gegeben bzw., wenn nicht
das, in Wahrheitsweise gesetzt (vollzogenes Urteil), oder er ist im
Denkbewusstsein quasi-vollzogen. Anders kann ich ihn nicht zur
Verfügung haben; er ist entweder Urteilsinhalt oder er ist Inhalt einer
25 bloß „propositionalen“ Vorstellung. Nichts anderes als dieser Inhalt
kann doch das Subjekt des prädikativen Wahrscheinlichkeitsurteil
sein; ich kann ihn hier nicht aus einem wirklichen Urteil entnehmen,
also muss ich ihn aus einem modifizierten, aus einem bloßen Sich-
Denken entnehmen.
30 Nun wird man aber sagen: Ist das nicht-prädikative, schlichte
Wahrscheinlichkeitsbewusstsein eine unmittelbare Verbindung von
diesem Inhalt und der „Qualität“ „wahrscheinlich“, dann kann ich
ihn ja aus dem Wahrscheinlichkeitsbewusstsein selbst entnehmen.
Freilich, die sprachliche Bildung des Ausdrucks für das Wahrschein-
35 lichkeitsbewusstsein ist entweder prädikativ „Dass S p ist, ist wahr-
scheinlich“ oder „S ist wahrscheinlicherweise p“, „S dürfte p sein“,
wobei es zweifelhaft ist, ob Prädikation zugrunde liegt. Jedenfalls ist
der Ausdruck der versuchten Auffassung nicht günstig.
94 zur intentionalität der objektivation

Es ist angedeutet, dass „S ist p“ (bzw. das „ist p“) „vorstellig ist“
und darauf sich die formale Fassung des „wahrscheinlich“ gründet,
als Charakter. Spricht aber nicht die Vergegenwärtigung der Bewusst-
seinslage für die durch den sprachlichen Ausdruck ohnehin nahe ge-
5 legte Auffassung? Das Wetter dürfte trüb bleiben. Es wird vermutlich
so bleiben. Das „Es wird bleiben“ ist doch ein bloßes Sich-Denken
und darauf gegründet das Vermuten, und objektiv: Die prädikativ
gefasste Sachlichkeit, der prädikative Sachverhalt ist in gedanklicher
Weise bewusst, und den gedachten Sachverhalt finde ich als Träger
10 des auf ihn bezogenen „wahrscheinlich“ oder „vermutlich“.
Sowie man aber geneigt ist, die Frage für entschieden zu halten,
wird man wieder auf die Gegenseite hinübergeführt durch die Ant-
wort: Wenn ich den bloßen Gedanken bilde, so ist jede „Qualität“ ins
Gedankenhafte hinübergeführt (von einzelnen ausgenommen). Was
15 ist es mit diesen gedankenhaften Modifikationen der Qualitäten?
Sind sie mit da, neben der Vermutungsqualität? Ist nicht vielmehr die
Sache so, dass im bloßen Sich-Denken die betreffenden Qualitäten
in Modifikation bewusst sind (wie wenn ich mir denke, dass es jetzt
schneit), während, wenn ich vermute, an ihrer Stelle Vermutungs-
20 modifikationen sind? Dann wäre die Sache so, dass jeder logischen
Form entspricht ein Vollzug im Charakter „wahr“ und ein Vollzug im
Charakter „wahrscheinlich“; wir hätten überall dieselben Synthesen
und Syntaxen, alles genau gleich. Es wären alle Akte genau dieselben,
nur in einer gewissen Charakteränderung, bzw. in den Korrelaten
25 hätten wir alles gleich, nur die Qualitäten verschieden: Das Gleiche
wären die „Materien“, die Abstrakta sind.
Demgemäß würden die prädikativen Formen „Dass S p ist, ist
wahrscheinlich“, „Dass S p ist, ist fraglich“, ebenso „Dass S p ist, ist
wahr“ einander ganz gleichstehen und auf nicht-reflexiv-prädikative
30 Formen zurückweisen. Natürlich kann ich überall zunächst die Ge-
dankenbildung vollziehen, aber der Gedanke als solcher ist nicht
wahr etc., sondern der thematische Inhalt ist identisch mit dem Inhalt
einer Wahrheit, Wahrscheinlichkeit etc. und kann als Subjekt einer
Prädikation von wahr etc. fungieren.
beilage vii 95

Beilage VII
Die Beziehungen zwischen thematischem und doxischem
Bewusstsein. Prädikation über den Gegenstand und seine
Eigenschaften einerseits und über den Charakter
5 der Wirklichkeit und des Wertes andererseits.
Die Möglichkeit der Objektivation des Themas1

Seite 20 = S. 83,29–85,18 sage ich: Objektiv stehen die und die Ge-
genstände mit den und den Eigenschaften und Verhältnissen da in einem
Objektivitätsbewusstsein doxischer Art, einem Bewusstsein mit einem do-
10 xischen Thema. Im Wünschen selbst ist aber der „Wunschcharakter“ nicht
objektiviert, er kann aber objektiviert werden. Das Wünschen hat als Thema
den Wunsch, es ist aber kein objektivierendes Thema. Die große Frage ist hier
die, das thematische Bewusstsein und so überhaupt jederlei „Bewusstsein-
von“ (also auch das gedankenhaft modifizierte Bewusstsein) in die richtige
15 Beziehung zu setzen zum doxischen Bewusstsein und die nähere Bestim-
mung dieses letzteren selbst.
Im Wünschen steht der Wunsch da, ist das „S möge p sein“ bewusst, in der
Freude steht das Erfreulichsein da, im Sich-Entschließen steht der Entschluss
da. W a s is t d a s f ü r e in D a st e hen?
20 Ich kann, während ich mich über etwas freue, das erfreuliche Objekt in
„theoretischem Interesse“ betrachten, um es „näher kennenzulernen“. Ich
freue mich als Naturforscher über ein neues Element und lebe nicht in der
Freude in dem Sinn, dass ich auf das Erfreuliche achte, sondern ich freue
mich, betrachte aber das Objekt, „studiere“ seine Eigenschaften etc. Ich
25 begehre nach dem Besitz eines Landguts. Ich durchwandere, betrachte es,
prüfe seine Vorzüge, die Begierde schweigt nicht, aber ich bin beschäftigt mit
der Kenntnisnahme des Objekts, ich interessiere mich dafür, wie es ist und
nicht ist. Genauer besehen stelle ich fest, wie es ist, aber alsbald auch, was
es wert ist. Ich betrachte die Nützlichkeiten, die Güter, und das wieder um
30 Feststellung, ob es wirklich so „begehrenswert“ ist (in Relation zu anderem,
was ich auch haben könnte, zu dem, was ich an Werten dafür dahingeben
soll), ob es die begehrende Schätzung bestätigt.
Was ist das: Freude, Begehren und dgl. erleben, den Objekten aber
theoretisch zugewendet sein, sie in theoretischem Interesse betrachten? Ich
35 bin da gerichtet auf Sein, auf Wahrheit. Wenn ich die Schönheit, Güte, den
Begehrungswert etc. hereinziehe in die „Objektivation“, so bin ich nicht

1 Wohl 1911. – Anm. der Hrsg.


96 zur intentionalität der objektivation

gerichtet auf das Schönsein, Gutsein, auf das Seinsollen etc. in der Weise des
ästhetischen Schätzens, des praktischen Wertens etc., sondern in der Weise
der Urteilsrichtung. Das ist klar – aber freilich auch sehr unklar.
Ist es so, dass durch das jeweilige Gesamtbewusstsein eine Objektität hö-
5 herer Stufe bloß „konstituiert“ ist, das Erfassen, das Ein-Sein-erfassend-(ein
Objekt im Seinscharakter)-sich-Hinwenden, geht aber nur auf eine Schicht,
einen Teil des Konstituierten. Also etwa so, wie ich ein ganzes Objekt vor
Augen habe, aber nur auf einen Teil achte?
Hier aber wird man sagen: Das ist doch etwas ganz anderes. Beim Objekt,
10 das in der theoretischen Wahrnehmung erfasst ist, ist nicht das Sein erfasst,
sondern das Objekt; um das Sein zu erfassen, muss ich prädizieren und sagen:
A existiert und dgl. Indessen, dem wird man mit Recht entgegnen, dass das
Erfasste das Objekt nicht als bloßer Inhalt ist, sondern das Seinsobjekt, das
heißt, der Gegenstand ist eo ipso der „wirkliche“ Gegenstand. Zum Thema
15 gehört mit der Charakter der Tatsache, er wird nicht prädiziert, so wenig sonst
etwas, was zum Gegenstand, näher zu seinem Inhalt gehört, prädiziert wird,
scil. in der schlichten Erfassung. Freilich gehört das Sein nicht zum Inhalt, es
ist „Charakter“.
So hat nun derselbe Inhalt eventuell noch einen zweiten Charakter (oder
20 der schon charakterisierte Inhalt hat einen neuen Charakter). Ich kann nun
neue Prädikationen bilden: 1) einerseits solche über den Gegenstand und
seine Eigenschaften; dann expliziere und prädiziere ich aufgrund der Expli-
kation, und all das hält sich in der Schicht des Wirklichkeitsbewusstseins.
Was das ist, müsste nun beschrieben werden. Ich urteile fortgesetzt, ohne auf
25 „Wirklichkeit“ zu reflektieren oder auf Werte etc.
2) Ich kann dann urteilen über Wahrheit und Falschheit, über Existenz
und Nichtexistenz, und wieder über Wert und Unwert, über Seinsollen etc.
Wie steht es mit dem Bewusstsein, in dem der Charakter der „Tatsache“,
der „Existenz“, Wirklichkeit, andererseits der Charakter des Wertes, des
30 Schönen, des Guten etc. gegeben ist?
Ein Gegenstand ist gegeben, im weitesten Sinn erfasst = ein erfassen-
des Bewusstsein erfasst (erschaut etc.) einen Gegenstand. Und es ist ein
„Seinsbewusstsein“, der Gegenstand steht (im Modus der Gewissheit, Wahr-
scheinlichkeit etc.) als seiend da, ein Wirkliches steht da (modifiziert ein
35 Quasi-Wirkliches); ein Wert ist gegeben.
Aufgrund jederlei Bewusstseins lässt sich sein Thema objektivierend fas-
sen, und zwar so, dass der thematische Inhalt zum Subjekt eines Prädikats
„wahr“, „wahrscheinlich“, „existierend“, „schön“, „gut“ etc. wird. Aber
wie kommt es, dass diese Urteile „Der Sachverhalt besteht“, „Der Satz ist
40 wahr“, „Die Tatsache ist erfreulich“, „Der Sachverhalt ist seinsollender“,
„Der Sachverhalt ist Inhalt einer Frage“, „Der Gegenstand existiert, ist schön
beilage vii 97

und gut“ nur aussagen, was in dem betreffenden Bewusstsein „erscheint“?


Diese Urteile legen auseinander, was der betreffende Akt vermeint. Alle
diese Akte sind vermeinend und als solche haben sie ein Thema, und das
Thema auseinandergelegt in jenen Prädikationen ergibt, was da vermeint ist:
5 Vermeintlich ist der Gegenstand schön, er „erscheint“ als schön; vermeintlich
ist ein Sachverhalt wahr, er erscheint als wahrer usw. Alle solche Urteile
haben eine bestimmte Anpassung an das Bewusstsein und haben über sich
„Normen“.
Dabei haben wir doppelte Urteile: 1) Die Urteile: „Dass S p ist, das ist
10 wahr, das ist so“ (ich urteile nämlich), „Der Gegenstand ist schön, gefällig“
(ich betrachte ihn mit Gefallen).
2) Die Urteile: „Ich urteile, dass S p ist, und in diesem Urteil erscheint
‚dass S p ist‘ als wahr.“ „Ich habe Gefallen an G und in diesem Gefallen
erscheint der Gegenstand als gefällig usw.“ Die letzteren Urteile sind evident.
15 Evident ist, dass mir jetzt ein Urteilsthema bewusst ist (ich urteile) und dass
darin der thematische Inhalt bewusst ist im Charakter wahr usw. Urteil als
Korrelat des Urteilens = Thema = thematischer Inhalt im Urteilscharakter
und Urteilscharakter (ontisch) = vermeintlich wahr.
Nun ist aber das Merkwürdige eben der Gegensatz von vermeintlich wahr
20 und wirklich wahr, von Urteil und Wahrheit (vermeintliche Wahrheit und
Wahrheit selbst), und so überall. Und dem soll entsprechen das Gegenüber
zwischen Urteilsbewusstsein und Evidenzbewusstsein, kategoriale Wahrneh-
mung und Erfüllung von Urteil durch kategoriale Wahrnehmung etc. Das
Prädikat „Geltung“ weist hin auf „Auswertung“ der Wertvermeintheiten,
25 und Auswertung ist der Prozess der Erfüllung, des Rückgangs auf Gründe
und Begründung.
Nr. 6

D as M ei ne n als B ew u sst s ein v on e in e m Inh al t


un d v on e in er g egen s tä n d l ic he n E i nhe i t 1

§ 1. Das Meinen und sein Gemeintes als solches.


5 Ein auf das Gemeinte gerichtetes Hinblicken
und eine darauf gegründete Denksetzung.
Objektivieren niederer und höherer Stufe

Was heißt das „als Gegenstand dastehen“? Was heißt das „Indem
ich Bewusstsein habe, habe ich Bew us st sei n v om G e ge n st a nd“,
10 „Ich bin auf einen Gegenstand gerichtet“? Und andererseits heißt es
doch: Bewusstsein ist seinem Wesen nach B ew us s t se in v on ei ne m
I n ha l t, Bewusstsein ist Haben einer Meinung.
Natürlich liegt nicht im Meinen zweierlei, als ob es irgendwie
zwei unterscheidbare Seiten oder Momente hätte, darin eines sagte
15 „Haben eines Inhalts“ und das andere „Richtung auf einen Gegen-
stand“. Wie sollte das auch hierdurch verständlich werden? Das Mei-
nen ist in sich Meinen und nichts anderes als Meinen, und das Erste,
was uns die phänomenologische Beschreibung des Meinens hergibt,
ist, dass es ein Was hat, ein Gemeintes als solches, eine Meinung.
20 (In der Reflexion aber, d.h. im Vollzug der Beschreibung des reel-
len Gehaltes der cogitatio, finden wir Abschattung, Apperzeption
etc.) Das Was des Meinens, sagte ich, ist das Erste. Nämlich: Was ist
im Meinen, fragte ich, „wirklich gegeben“? Nicht: Was ist Erlebnis,
sondern was ist in diesem Erlebnis als einem Bewusstsein Bewuss-
25 tes? Nehme ich es genau so, wie es bewusst ist, so gewinne ich ein
evident „Gegebenes“, eben das „Gemeinte als solches“. Wenn ich
jetzt davon spreche, sehe ich darauf hin, setze es als dieses, urteile dar-
über. Natürlich im puren Meinen stecken nicht diese Dies-Setzungen,
diese Denk-, Urteilsinhalte und all das, was zu ihnen gehört. Es ist
30 einfach ein Meinen Erlebnis, und dieses ist eben Bewusstsein, und

1 Wohl Frühjahr 1911. – Anm. der Hrsg.


text nr. 6 99

wenn ich auch im Hinblicken es konstatiere, so ist es doch evident,


dass auch ohne Hinblicken darauf das Bewusstsein seinem Wesen
nach „Bewusstsein von“ ist, vom „Inhalt“. Und wenn nun Meinen in
Meinen übergeht, wenn sich Einheitsmeinungen bilden, so sind das
5 wieder Meinungen, synthetische Meinungen von einer Einheit und
je nachdem in Wirklichkeitscharakter oder Unwirklichkeitscharakter
usw.
Nun kommt das Denken, das sich auf Meinungen gründet (auf
Akte des Meinens) und welches nun sagt: „Dies!“, welches in einer
10 Synthese unterscheidet und wieder identifiziert, aussagt „Dies und
jenes ist dasselbe“ oder „Dies jetzt in der Lage seiend ist dasselbe
wie das, das dann in der Lage ist“ usw.
Denken ist wieder Meinen, Urteilen ist Meinen „S ist P!“, und
das ist sein Inhalt; dieses Setzen ist eben das Bewusstsein „Dies!“,
15 und das ist sein Inhalt, von dem ist es Bewusstsein. Nun kann ein
neues Meinen, etwa ein „Hinblicken“, sich „auf den Inhalt richten“,
auf das oder jenes in ihm achten; es kann auf dieses schauende,
hinblickende Meinen sich ein Denkmeinen gründen, ein Dies-Setzen,
ein prädizierendes Urteilen usw., und es ist dabei gleich, ob ich zuerst
20 hatte ein vorstellendes, urteilendes, wünschendes, wollendes Meinen.
Immer wieder kann ein „Hinblicken“, ein schlichtes Erfassen als ein
neues Meinen sich etablieren etc. Sehe ich einen Baum, so „habe“
ich die Wahrnehmungsmeinung, die Meinung dieser äußeren Wahr-
nehmung. Dies ist Grundlage für ein denkmäßiges „Dies!“, und etwa
25 als „dieser Baum“.
Ich kann auch eine andere Denksetzung vollziehen; nämlich indem
ich sage „diese Wahrnehmungsmeinung!“ Aber dann ist vorausge-
setzt ein Neues, ein Hinsehen, so etwas wie „Wahrnehmen“ (aber
nicht im eigentlichen Sinn!), das sich auf die Wahrnehmungsmeinung
30 (Gemeintheit) „richtet“. Das gewöhnliche Wahrnehmen selbst ist
„H i n se he n a u f d e n Ge g e n s t a nd“, das aber heißt gar nichts
anderes als eben, wahrnehmendes Meinen hat die und die Wahr-
nehmungsmeinung. Fragt man aber: Woher wissen wir von diesem
„Wahrnehmungsmeinung-Haben“, so lautet die Antwort: eben durch
35 solches Hinblicken und durch die Evidenz, dass das, was ich da in
der eben vollzogenen Wahrnehmung, auf sie reflektierend, als ihr Was
erfasste, nicht etwas jetzt erst durch mein Hinblicken ihr Eingelegtes
sei.
100 zur intentionalität der objektivation

Beim Wahrnehmen müssen wir nun unterscheiden: 1) Da s , w a s


S ac h e des Wa h rne hm en s selb s t i st; wir erfassen also den Gegen-
stand, das ist eben Wahrnehmen, Bewusstsein des Inhalts haben. Und
im Fortgang des Wahrnehmens fassen wir den Gegenstand als Einheit
5 in der fortlaufenden Synthesis der Meinungen der wahrnehmenden
Phasen. Ich blicke über „den“ Gegenstand hin, immer wieder habe
ich andere Erscheinungen, aber in einheitlicher Verbindung; ich fasse
die Einheit (das ist nichts anderes, als ich erlebe kontinuierlich Einheit
von Wahrnehmungsakten, ich habe diese Synthese, Einheit in der
10 Kontinuität der Meinung). Und so steht eines da, und an ihm achte
ich immer wieder auf Neues, auf seine Farbe, auf seine Form, auf
die und jene Merkmale. 2) Andererseits aber ist zu betonen, dass
gesondert bleibt, das, was Sache des b egri ff li c he n F a s se ns, des
Urteilens, Aussagens ist.1 Erst da haben wir Merkmale, haben wir
15 einen G e g e ns t a n d - w o rüb er und ihn, der Merkmale etc. hat, die
ihm „zukommen“.
Sowohl beim Vorstellen als auch beim Denken handelt es sich
um ein Objektivieren: ein Objektivieren niederer, ein Objektivieren
höherer, spezifisch verstandesmäßiger Stufe.
20 Das D e nk e n ist es, das den Ge gen st a nd i m p r äg nan te n
S i n n „ s e t z t “, nämlich als Gegenstand-worüber; ein Gegenstand,
der ein „Dies“ ist und die und die Eigenschaften hat. Vor dem
Denken steht aber schon die Einheit da, die noch ungedachte, noch
nicht d e nk m äß i g g e s e t z t e und erkannte, bestimmte Einheit. D i e
25 E i nh e it de s Vo r s t e l l e n s i s t „ u nb e s ti mm te “ E i nh ei t. Im Vor-
stellen geht seinem Was nach Meinung in Meinung einheitlich über;
die b e vor z ug e nd e M ei n un g, die den oder jenen Teil, dieses oder
jenes Element an der Einheit zum spezifisch Intendierten macht, ist
noch nicht wirkliche „Teilsetzung“, ist noch nicht Merkmalsetzung.
30 Ebenso wenig wie die auf die Einheit ständig gerichtete Meinung Set-
zung ist als Gegenstand-worüber (d. h. als „dies“, woran sich knüpft
„welches“ oder „ist eine“). Es sind Hebungen, Heraushebungen etc.,
und immerfort ist dabei Einheit bewusst, und Einheit der Meinung
ist im zusammenhängenden Meinen als Inhalt gehabt. Ich mache nun

1 Beziehendes Perzipieren vor dem Begreifen muss doch angenommen werden. Also

das Begreifen lassen wir sein und dafür nur die spontane Synthese.
text nr. 6 101

diese Einheit zum Gegenstand-worüber, ich sage „dies“, ich sage


nun weiter aus: „Dies ist α etc.“ Es kann aber auch sein, dass Einheit
erscheint, aber nicht besonders gemeint ist, vielmehr ausschließlich
gemeint ist ein Moment in der Einheit, diese Form und dgl. Dann
5 wird sie für sich und nicht in dem Einheitlichen zum „dies“.
Nun aber „erscheint“ im kategorialen Akt wieder ein Gegenstand.
Es ist ja ein Bewusstsein von einem Inhalt, und zwar so, dass in
diesem Inhalt ein Gegenständliches bedeutet ist: der Sachverhalt.
Darauf kann wieder hingesehen und ein Denken darauf gerichtet
10 werden. D e r Sa c h ver h al t w i rd z u m „ di e s “ und zum Subjekt
von bestimmenden Denkakten.

§ 2. Das spezifische Meinen als Meinen von


Einheit. Urteilen über die gegenständliche Einheit
und Urteilen über den vergegenständlichten
15 Inhalt. Der gemeinte Gegenstand schlechthin
und der gemeinte Gegenstand im Wie

Mit all dem ist die Sache noch nicht ganz geklärt. Wir haben
also schlichte, unterste „Vorstellungen“, immanente, transiente.1 Jede
Vorstellung ist Bewusstsein eines Was, und das ist immer Bewusst-
20 sein von einer Einheit. Denn eine Phase einer Anschauung ist eine
bloße Abstraktion. Aber auch wenn der Inhalt sich nicht verändert,
so haben wir ein Kontinuum; es erscheint eine Dauer und in ihr
ein Einheitliches. In dem Fall der Veränderung allerdings haben wir
immer wieder einen anderen Inhalt, ein stetiges Inhaltskontinuum,
25 aber so, dass in diesem stetig veränderten Inhalt eine Einheit „liegt“.
Jed e s v o rs te l l e n de B e wu s s t s e i n i s t e i n E i n he i ts be -
w u ss ts e i n , B e wu s s ts e i n v on E i nh e it. Habe ich dieser Bewusst-
seinseinheit hinreichend gut Rechnung getragen in den vorstehen-
den Blättern? M us s i ch n i c ht s a g e n: In j e de m v or s t el l e nde n
30 B e w us s t se i n li e g t e in e r se i t s B e wu s s ts e i n v o n e i n e m
I n h al t, a nd er e r se i ts B e w us s ts e i n v o n e i n e r E i nh e i t d e s

1 Jede konkrete Perzeption ist stetige Perzeption und als solche Bewusstsein einer

Einheit, der Einheit in der Dauer, und jedem Moment entspricht ein anderer Inhalt.
102 zur intentionalität der objektivation

Inh alt s – oder im Inhalt: eben Bewusstsein vom „Gegenstand“?


Und wenn wir das vorstellende Bewusstsein als ein im spezifischen
Sinn meinendes Bewusstsein nehmen, so geht doch das Meinen eben
auf die Einheit, auf Einheit als Gesamteinheit, die zum gesamten
5 stetigen Inhalt gehört, auf die Momente der Einheit: auf diese Fläche,
diese Färbung der Fläche etc., nur nicht in denkmäßiger Fassung, in
prädikativer.
Was ist darauf zu sagen? Muss ich nicht unterscheiden, wie ich es
ja getan habe, bei jedem vorstellenden Bewusstsein d i e Ma nn i gfa l-
10 t i g k e it im G an z en st et i g i ne i na nd er ü be rg eh en d er I nh al t e
un d d i e E i n hei t des I nh a lt s? Im Wahrnehmen lebend unter-
scheide ich natürlich nicht. Bewusst habe ich immerfort Einheit.
Ich habe nämlich nur Bewusstsein von dem sich so und so Kon-
stituierenden, und das ist Bewusstsein einer Einheit. Das spezifische
15 Meinen (Merken) ist immer Meinen von Einheit. Sollen wir da sagen:
Bewusst ist dabei der Inhalt, gemeint die Einheit? Aber auch, wo
wir im Besonderen auf Seinsmerkmale, auf eine Form oder Farbe
meinend gerichtet sind, sind Einheiten das Gemeinte. M e in e n i st
i m me r u n d n ot w e ndi g M e in e n v on E i nhe it, Meinen von Ge-
20 samteinheit, die doch Einheit des Gegenstandes ist und Meinen-von
von Partialeinheiten, die „impliziert“ sind in der gegenständlichen
Einheit und die durch das Sondermeinen nur zur „E x p li ka t io n“
kommen.
Und soll ich weiter sagen: Es könne nun doppelt geurteilt werden?
25 Einmal könne solche Anmessung des Urteilens an das Vorstellen,
wir dachten hier an Wahrnehmen, statthaben, dass eben eigentümli-
che Deckung besteht, die überall vorliegt, wo wir von irgendeinem
Urteilen (und jedem) sagen, indem es urteile, liege ihm ein Vorstel-
len der Gegenstände-worüber zugrunde (ein Vorstellen, das sie so
30 vorstellt, wie es das Urteil eben „fordere“). Und das andere Mal
urteile ich anders; ich blicke auf den „Inhalt“ der Wahrnehmung hin,
der von Phase zu Phase ein anderer werden kann, und sage etwa:
Dieser Inhalt, sich konstituierend, sei immer wieder ein anderer,
und es sei ein Inhalt, in dem bei aller Änderung Einheit sich be-
35 kunde, Bedeutung „von“ Einheit. Dabei setze ich offenbar Inhalt
und Gegenstand in Bezug; ich vollziehe also beiderlei Urteilsweisen
und verbinde sie logisch, wie es dieses Relationsbewusstsein eben
fordert.
text nr. 6 103

B ew u sst s ein d es un d d es s i ch ba ld v er änd er n de n , b a l d


u n verän d ern den I n h alt s „ h ab en “, das is t g e g en st än dl i ch
ger ic ht et s ei n. Näm li c h , so lc h es B ew us sts e in hab en , das
ist , al le B e di n gu n gen erf üll t h ab en fü r e in s ch li c ht si ch
5 an m es sen des Ur t e il en ü b er d en Ge g e ns tan d , ü b er d ie
E i nh e it. Aber so geartet ist das Bewusstsein, dass auch noch jener
„Hinblick“ möglich ist, der dem Bewusstsein sein Was entnimmt, den
In h al t z um G egen st an d m ac ht und neue Urteile nun auf dieser
neuen Vorstellungsunterlage ermöglicht.
10 So geartet ist Bewusstsein, dass d ie se z we i U rte i l sw ei se n
un d d a zu noc h w ei t e re m ög li c h sind und dem vorstellenden
Bewusstsein kann mehrerlei „entnommen“ werden. Es ist Richtung-
auf den Gegenstand, es ist Bewussthaben eines „Inhalts“, u nd de r
I n ha l t i s t d a b ei n i ch t a n de rs al s d ie E i nh ei t , so w ie si e
15 s i ch v on P ha s e z u Pha s e vor st el lt, so und so orientiert, in
dem klar, in jenem unbestimmt etc. Aber wenn ich nun die ganze,
in mannigfaltigen Phasen sich fortbewegende Wahrnehmung nehme,
so ist der ganze Inhalt doch das Eine, das sich von Phase zu Phase
in bald derselben, bald neuer Orientierung etc. zeigt. I nha l t ist doch
20 von vornherein eines oder et wa s , d as si ch s o un d so v or st el l t,
und in dieser Kontinuität etwas, das unbeschadet der verschiedenen
Vorstellungsweise immerfort dasselbe ist. Und auch in diesem ganzen
Zusammenhang genommen hat es seine Weise, und in einem ande-
ren Zusammenhang, etwa in der Fortführung der kontinuierlichen
25 Wahrnehmung in eine sich anschließende Kontinuität neuer Wahr-
nehmung, is t d a s se l b e i n e i ne m n eu e n W i e der Me i nu ng
bewusst. Und auch jetzt bleibt vieles unbestimmt und unklar, das
Eine, so wie es sich da vorstellt, ist in dieser Phasenkontinuität so und
so Bestimmtes und sich Klärendes, aber so und so immer unbestimmt
30 und offen Bleibendes.
Aber ist es nicht ein Unterschied, au f E i nh e i t zu  a c ht e n
un d au f da s W i e de r G e ge b e nh e i t de r E in h e i t z u  a c ht e n?
Gewiss. Ich kann einfach im Bewusstsein der betreffenden Anschau-
ung leben, und ich kann unterscheidend auf das jeweilige Wie der
35 Gegebenheit achten, auf die verschiedene Weise der Orientierung des
bestimmt und klar Gegebenseins nach der Seite und den Momenten,
der Unbestimmtheit nach jener usw. Muss man andererseits aber nicht
sagen, Bewusstsein ist eo ipso Bewusstsein einer sich in der und der
104 zur intentionalität der objektivation

Weise gebenden Einheit und die sich in der Weise gebende Einheit
ist Einheit der „Meinung“?1
Meinung ist hier nicht Meinen, sondern Gemeintes als solches, ge-
meinter Gegenstand als solcher in seinem jeweiligen Wie. Es kann in
5 immer neuen Akten mit ihren immer neuen Meinungen das Gemeinte
dasselbe sein, nicht als ob die Verschiedenheit jener Meinungen auf-
gehoben würde, sondern es konstituiert sich Einheit der Meinung im
synthetischen Vereinigungsakt, und in der Einheit der Meinung ist
das hier so und dort so Gemeinte als Eines gemeint. Was sagt das
10 aber?
Das sagt, dass eben das Meinen mit Meinen und korrelativ Mei-
nungen mit Meinungen sich in der Einheit eines meinenden Aktes
als Inhalt zusammenschließen können zu einer Meinung und dass
eine Meinung wieder zerteilt und innerlich unterschieden werden
15 kann in Meinungen (etwa den Zeitteilen der Wahrnehmung entspre-
chend) und dass diese Einigung der Meinung eine solche ist, dass
evident gesagt werden kann: „Gemeint ist in der Einheit ein Etwas,
das sich jetzt so und jetzt so darstellt, jetzt in der, jetzt in jener
Orientierung erscheint etc.“ Oder, das Etwas, das zu jeder dieser
20 Teilmeinungen gehört und das das ist, was in der oder jener Weise
erscheint, ist in allen Teilmeinungen der einheitlichen Meinung ein
und dasselbe. „Ist“, das heißt: ist im Sinn aller dieser Meinungen
dasselbe, ist dasselbe Gemeinte. Jede Meinung meint also etwas,
das sagt, sie meint Eines = Etwas und meint es in den oder jenen
25 Bestimmtheiten und in den oder jenen Unbestimmtheiten so und
so, teils eigentlich anschaulich, teils unanschaulich etc. A n j e dem
G em ein t e n h a b e n wi r e i n E t wa s ode r E in e s a l s G em ei nt es
un d e i n W ie d es ge m e i n t e n Et w as zu un te r sc he i d en. U nd
be i ve r s ch i e d en e m W i e d e s G em e i n te n a l s s ol c he n ka n n
30 Id e nt i t ät de s E i ne s od e r Et w a s s t a t t ha be n , da s g e m e i nt is t.
Das gehört zum ursprünglichen Wesen des Gemeinten; ein solches
Gemeintes (etwas in einem Wie) bewusst zu haben, das ist das Wesen

1 Hier ist zu beachten, dass „Meinen“ hier nur ein anderes Wort ist für Bewusst-

sein, und Gemeintes (Gemeintheit, Meinung) für Bewusstes als solches. Also jedes
Perzipieren ist Meinen und das Perzipierte als solches die gemeinte Einheit. Denn das
„Meinen“ in dem speziellen Sinn des Herausmeinens, des Zugewendetsein etc. kann
hier nicht bevorzugt werden.
text nr. 6 105

des Meinens. Das Etwas ist der gem ein t e Ge ge ns ta n d schlecht-


hin. Das Etwas aber ist nur etwas im Wie, das ist der g e me i n te
G eg ens t and i m Wi e.
Nr. 7

C o g itat io un d ih r Ko r re l at. D er z ur
c o gi ta ti o ge hö r e nd e Ic hs tr ahl . Das K or re la t
a ls Ve rm e in t h ei t sch l e c h t h i n. E vi den z a ls
5 h ö h er st u f ig er Ch ar ak t er vo n Ko rr el at en 1

Cogitatio und ihr Korrelat, z. B. Wahrnehmung oder auch va-


ger Gedanke. Der wahrgenommene Gegenstand als „Kor re lat“.
Dem „entspricht“ die ideale Möglichkeit, die cogitatio in gewisse
Deckungszusammenhänge mit anderen cogitationes zu bringen (z. B.
10 die Wahrnehmung in Zusammenhang mit anderen Wahrnehmungen,
Erinnerungen etc.) und dazugehörig die Evidenz: gemeint ist das-
selbe. Jede dieser cogitationes hat verschiedenen r e el l e n G e ha l t,
sie ist als cogitatio verschieden: Achte ich auf die Verschiedenheit,
so kann sie in verschiedener Richtung liegen. Zum Beispiel, ich
15 urteile „2 mal 2 ist 4“ einmal klar, das andere Mal unklar, einmal
deutlich (in sich absetzenden Schritten artikuliert), das andere Mal
undeutlich. Das Was, das Urteil ist dasselbe. Auch kann ich z. B.
ein und dasselbe mit lebhafter Überzeugung urteilen, das andere
Mal mit geringer Überzeugung etc. Oder viele Wahrnehmungen von
20 einem Gegenstand: In jeder kommt etwas anderes vom Gegenstand
zu „wirklicher“ Wahrnehmung, in jeder ist die „Orientierung“ des
Gegenstandes zu mir geändert. Auch ist das Zeitliche ein anderes:
Das Dauernde ist dasselbe, aber aus der Dauer ist immer wieder ein
anderer Zeitpunkt des Gegenstandes „gegenwärtig“, und von der
25 Dauer des Gegenstandes ist in jedem Jetzt ein anderer Aspekt der
Dauer, die zeitliche Orientierung eine andere.
Eine andere Serie von Verschiedenheiten ist aber die: Ich achte
auf die darstellenden Momente, in denen sich der Gegenstand nach
den oder jenen Beschaffenheiten eben darstellt. Und ich achte auf
30 das „Was“ der Darstellung von dem und dem. Die Beziehung auf das
Dargestellte hängt nicht am „Gegenstand“, sondern am Darstellen-
den. Ich unt e rs c h ei d e i n de r Re f l e x i on di e c o g i t a t i o s e l bs t
u n d d a s d a r in C og i t i e rt e. Die „cogitatio“ sagt hier, ich kann

1 Wohl 1911, mit Zusätzen aus der Zeit nach 1913. – Anm. der Hrsg.
text nr. 7 107

„reflektieren“ und Darstellung finden und Darstellung von dem


finden und die Evidenz gewinnen: „Das ist in gewisser Weise schon
‚Erlebnis‘ gewesen, wenn ich darauf auch nicht den ‚Blick‘ gerich-
tet hatte“. Ich hatte ursprünglich den Blick „natürlich“ auf den
5 „Gegenstand“ gerichtet.
Ferner die Unterscheidung zwischen dem identischen Was, dem
Intendierten, das aber bald Aufgemerktes ist, bald nebenbei Beach-
tetes, bald im Hintergrund Verschwimmendes, und wieder dem Etwas,
das „Gegenstand“ ist, das als „wirklich“ charakterisiert sein kann,
10 als durchgestrichene Wirklichkeit, als nichtig, als vermutlich etc. Ich
unterscheide im Korrelat „Gegenstand“ und Charakter. Ich sage: Ich
bin aufmerksam auf den Gegenstand, der Gegenstand ist im Mit-
telpunkt meiner Aufmerksamkeit, er ist mein Thema, er ist Subjekt
meines Urteils etc., oder der Gegenstand ist mitbemerkt. Oder der
15 Gegenstand ist für wirklich gehalten, oder ich setze ihn als wirklich;
ich halte ihn für nichtig, ich glaube nicht an seine Wirklichkeit, an
sein Sein, ich bezweifle sein Sein etc. Dem „Gegenstand“ zugewandt
und aussagend, was ich an ihm finde, sage ich: Der „Gegenstand“
ist wirklich, ist nichts, ist vielleicht. Andererseits, „normal urteilend“
20 sage ich: Der Gegenstand ist rot, ist ein Haus etc. Und dabei rede ich
vom wirklichen Gegenstand, nämlich dem in der Weise „wirklich“
gesetzten und nicht von dem Gegenstand in Anführungszeichen.
Phänomenologisch: Ich nehme wahr, und das Wahrgenommene ist
in eins der Gegenstandsinhalt (der „Gegenstand“) und „Charakter“,
25 und dieses Ganze ist selbst wieder Gegenstand in Anführungszei-
chen, sofern ich ja jetzt phänomenologische Reduktion übe; a ls o
G e ge n s ta n d i n A n f ü hr un g s ze i c h e n i s t do ppe l sin ni g.1 Im
ganzen Intentionale scheiden sich I nh a l t und Ch a r a kte r, und zwar
habe ich wieder zu scheiden das Intentionale der Wahrnehmung,
30 wo diese Scheidung nicht vollzogen, wo eben das Wahrgenommene
Wahrgenommenes ist, und die Reflexion, in der ich das „Etwas“ setze
und den Charakter daran setze. Wie erfasse ich das „Wahrgenom-
mene schlechthin“ phänomenologisch? Ich nehme nicht einfach wahr
(oder versetze mich nicht einfach in ein Wahrnehmen, etwa in der

1 Das heißt, in der Redeweise der Ideen, es scheidet sich bloßer „Sinn“ und Satz.
108 zur intentionalität der objektivation

Erinnerung oder Phantasie), ich reflektiere und sage, es ist eine Ein-
heit da, und diese zerlege ich in das Etwas und seinen Charakter.
Wie st eh en nu n d ie C har akt er e z ur „ Su bj ek ti v i tät “?
Das kann sagen: z um „ I c h “. Es kann aber auch gefragt werden,
5 was da S ac he d e r c ogi tat io W ah rn ehm u ng ist. Ich habe dem
„Etwas“ der Wahrnehmung entsprechend, das da dauerndes, so und
so bestimmtes Etwas ist, nicht den reinen Einheitspunkt, sondern den
Einheitspunkt in einer Zeitform und mit einem Gehalt an wieder
räumlich bezogenem Bestimmungsmaterial, an Darstellungsmaterial
10 und „Auffassung“-als und dazu Material motivierender Empfindung
(Sinnliches). Im Fortgang der Wahrnehmung habe ich das „ein und
dasselbe“, das „kontinuierlich eins“, aber das gehört zum Korrelat.
Ich finde eine gewisse „Beziehung“ des Darstellungsmaterials auf
das (jetzt in anderer Einstellung bewusste) Etwas, Haus etc.
15 Und wo ist das „Ich halte für wirklich“, „Ich zweifle“, „Ich ver-
mute“? Muss ich nicht sagen, eben da ist di e B e zi e h un g zum
I ch, das keineswegs die Person besagt, sondern vor aller Objek-
tivierung der Person etwas zu m We sen d es „ Ak te s “ s el bs t
Ge h ö ri g e s i s t? Ein Ichstrahl gehört zur cogitatio, und der termi-
20 niert im Korrelat, und zwar in dem Charakter „wirklich“ des Gegen-
standes, eine Weise ihn zu charakterisieren, so dass er dann jenen
Charakter hat.1 Jede cogitatio hat ihren Ichstrahl, und rein ihrem
Wesen nach hat sie ihren subjektiven Identitätspunkt i m r ei ne n Ic h
de r t r a n sze n d en t al e n A p p er z e pt i o n, jede cogitatio, die eben zu
25 einem Ich gehört (abgesehen von der Person). Und zum Ich gehört
auch die „Auffassung“ in ihrem Modus als Wahrnehmungsauffas-
sung, Phantasie etc.: Ich nehme wahr, ich habe die Einbildung. Aber
hier besteht eine gewisse I c h f er ne. Ich fasse auf, ich setze als wirk-
lich, halte für wirklich, für gefällig (ich habe Gefallen an), ich liebe, ich
30 hasse. (Haben nicht Gemütsstrahlen die größte Ichnähe oder nicht
vielmehr, wenn ich im Gemütsakt „lebe“? Im Aufmerken, Klarma-
chen etc. bringe ich es mir näher.) Da s D ar s te l l u ng s ma t e r i a l
h a t di e gr ö ßt e Ic h f e rn e, im „Bewusstsein“ die größte Ferne vom

1 Husserl hat hinter diesen Satz ein Fragezeichen gesetzt. Darauf bezieht sich seine
Randbemerkung: „Ja, als Zuwendung. Aber ohne Zuwendung doch wohl nicht, oder
in anderem Sinn?“ – Anm. der Hrsg.
text nr. 7 109

Ichpunkt. Die Stellungnahme und insbesondere die Stellungnahme,


in der Hinwendung-auf statthat, die führt am nächsten zum Ich-
punkt.
Es fragt sich nun, wie es mit dem Recht der Rede von „Korrelaten“
5 steht im Gegensatz zu dem „Entsprechenden“ auf Seiten der cogita-
tio. Das Recht der Unterscheidung wird doch wohl nicht anfechtbar
sein. Das Korrelat besagt nichts anderes als das vorgestellte, geur-
teilte, bewertete etc. Was. Das heißt: Evident ist bei jeder cogitatio
auszusagen, dass sie etwas bewusst hat und mit den und den Charak-
10 teren bewusst hat, und diese Beschreibung nennen wir Beschreibung
des Korrelats (des Vermeinten als solchen).
Auf das „Haben“ des Korrelats, auf das Sich-Beziehen auf das
Korrelat, bezieht sich die N o r m i e r u n g: Das Korrelat „besteht in
Wahrheit“, der „Gegenstand a ist wirklich“: In Wahrheit besteht
15 das; in Wahrheit besteht es, dass der Gegenstand a nicht wirklich ist,
vermutlich ist usw.: Das sehe ich, das ist evident gegeben, wenn das
Phänomen im Zusammenhang einer Begründung steht und ich in ihr
liegend das Korrelat identisch sich durchhaltend finde und finde, dass
es dabei den C h a ra k t e r h ö he r er S t u fe „ w ah rha f t so “ annimmt.
20 Aber ist dieser Charakter nur ein n eu er C h ar ak te r, also ein ne u es
Ko r r e l a t? Komme ich nicht in einen Zirkel? Das Korrelat a l s
v e r m e in t e s ist immer evident gegeben. Aber gegeben ist da dabei
nur dies, dass das Phänomen das und das vermeint, dass das Vermeinte
ist als Vermeintes dieses Phänomens. Jetzt aber ist etwas Neues ge-
25 geben, nämlich wenn das Phänomen ein „stellungnehmendes“, ein
„setzendes“ ist. Dann ist im Fall der Evidenz das Meinen nicht ein
leeres, sondern ein erfülltes Meinen, ein begründetes, rechtmäßiges.
Der n eu e Ch a r a kt e r ist Charakter des identisch Vermeinten, der
hindurchgeht; der Charakter des „wahr“, des „Es besteht recht-
30 mäßig“, des „Es trifft zu“ trifft das ganze Korrelat des Phänomens,
das ein Rechtsbewusstsein ist (oder unvollkommenes wie das Be-
wusstsein des Gegebenhabens der Wahrnehmung) und dann den
Inhalt des Rechtsbewusstseins ausmacht. Fälle: Das Vermeinen als
Nichtgegebenhaben, das Gegebenhaben, das immer vollkommenere
35 Gegebenhaben; das bestätigend Gegebenhaben, welches das vorgän-
gige Gegebenhaben selbst wieder bestätigt und uns aussagen lässt, das
Gegebenhaben war wahres Gegebenhaben, seine Richtigkeit zeige
sich im Fortgang.
110 zur intentionalität der objektivation

A lso au c h d as G egeb en ha ben is t e ve nt ue ll z un äc hs t


ein Verm ein en gegeb en zu h ab en, und das Ausweisen des
Gegebenhabens ist ein Vermeinen des Ausweisens, und so kommen
wir in manchen Gruppen von Fällen (äußerer Natur) zu unendli-
5 chen Reihen aufeinander bezogener Unterschiede von vermeintlich
und wahrhaftig, vermeintliche Wahrheit – wahrhaftige Wahrhaftig-
keit usw. Demgegenüber ad ä q ua t e G ege b en he i t gegenüber der
D ars t e ll un gsg egeb enh ei t: unendlich viele mögliche Darstellun-
gen, das Etwas von unendlich vielen möglichen Seiten in unendlich
10 vielen Orientierungen zu geben. Jedes Gegebenhaben ist nicht nur
einseitig, sondern es hängt davon ab, ob die anderen Seiten „zu
haben“ sind, ob das Haben und Gegebenhaben wirkliches Gege-
benhaben ist und nicht bloß vermeintliches.
Im Falle adäquaten Gegebenhabens habe ich keine Darstellung,
15 keine Einseitigkeit, nichts, was offen geblieben, nichts, was unbe-
stimmt geblieben ist, nichts, was sich erst zeigen soll und ob es sich
wirklich zeigen lässt, alles, was Inhalt ist und gesetzt ist als seiend,
ist gegeben und ist absolut gegeben, nicht relativ und in Abschattung
gegeben.
20 Korrelat des adäquaten Gegebenhabens oder der Evidenz: das
„Objektiv-evident“-Sein, das Absolut-zweifellos-Sein, das Wahr-
und-wirklich-Sein. Aber: Dieses Korrelat hat die Auszeichnung, dass
es keinen Sinn hat, dafür eine weitere Ausweisung zu verlangen.
Im einen Fall habe ich d a s P h ä n om e n un d se i n Ve r m ei nt e s,
25 das als Vermeintes evident dem Phänomen zukommt, im anderen
nicht nur das, sondern wie das Phänomen ist, absolut, ist auch das
Vermeinte und nicht bloß als Vermeintes. Das bloß Vermeinte: das
sagt, es ist nicht etwa absolut seiend (gegeben und zu Gebendes),
sondern es ist ungegeben Vermeintes; es ist gegeben, dass es vermeint
30 ist.
Eine Idee ist absolut: Sie ist einsichtig zu geben; eine Idee einer
gebenden und absolut erfüllten Meinung, die sie gibt, ist möglich, und
die Idee dieser gebenden Meinung besteht in Korrelation zur Idee des
Gegebenen, die dann Idee und gegebene Idee ist. Die Ideen haben
35 einen notwendigen Zusammenhang.
D a s , wa s ge g e be n i s t , h a t ke i n e An fü hr u ng s ze i c he n ?
W as b esa g en d ie An f ü hr u n g s ze i c h e n? Das Nicht-Urteilen über
das Sein, die phänomenologische Reduktion? Sie betrifft die Natur,
text nr. 7 111

überhaupt, sie betrifft das Sein, dessen Erkenntnismöglichkeit ich


jeweils untersuche. Wo ich Evidenzgegebenheit habe, da habe ich
absolutes Sein und in idealer Überlegung Idee des absoluten Seins.
Wo ich anderes Vermeinen habe, da habe ich das Vermeinte als
5 Vermeintes. Ich habe eben die Evidenz, dass ich auf Grund dieses Ver-
meinens über sein Was aussagen kann, was es meint. Das Was ist aber
eben „Vermeintes“, und al le s V erm ein te i n ein e r Ka te go ri e :
Ver m ei n t es.
Dagegen, besteht das Vermeinte, das heißt, entspricht der Ver-
10 meintheit eine Wahrheit, dann ist die Wahrheit eben nicht bloß Ver-
meintheit. Die Wahrheit „2 × 2 = 4“ habe ich gegeben im evidenten
Urteil. Aber ist darin nicht auch eine Vermeintheit? Ja freilich. Die
Wahrheit ist auch ein „Urteil“ (Urteilsvermeintes). Aber das Urteil
finde ich nicht bloß als Urteil, sondern als Inhalt einer Wahrheit,
15 und die Wahrheit finde ich. Und wie steht es mit dem Charakter
„wahr“? Jener, der in der Evidenz zum Urteil gehört und das ganze
Urteil durch und durch charakterisiert: Es ist nun gegebener Sach-
verhalt, „anschaulich“ nach allem gegeben, vollkommen. Nun, es ist
ein eigener Grundcharakter, den nicht jedes Urteil annehmen kann
20 (natürlich nicht der Begriff „wahr“, sondern das „wahr“ selbst), und
er gehört zum Urteil nicht in Bezug auf den zufälligen oder beson-
deren Akt, sondern zum Urteil seinem Wesen nach gehört als dieser
Vermeintheit, welchen Vermeinens immer, das „wahr“. Das heißt,
rein durch das „2 × 2 = 4“ ist das „wahr“ vorgezeichnet. Nämlich
25 mit ihm ist das „wahr“ verträglich, und zwar ideal: nicht bezogen
auf den zufälligen Akt. Es besteht die ideale Möglichkeit, das Urteil
„einsichtig zu machen“, es besteht die ideale Möglichkeit der Einsicht
bzw. die ideale Möglichkeit dieses Korrelats Urteilswahrheit, das
nicht für jedes Urteil besteht!
30 K o rre l a t besagt nicht Vermeintheit im Gegensatz zu Wahrheit,
sondern V e r me i n th e i t s c hl e c h t hi n, und Vermeintheit ist eben
solche, die eventuell evident ist oder nicht; und E v i de n z ist im-
mer schon ein Charakter von Korrelaten, ein Ch a r a kt e r höh er er
St uf e, der aber selbst ins Korrelat gehört. Dieser Charakter kann
35 sich mit gewissen Korrelaten verbinden (in entsprechenden cogita-
tiones also), mit anderen nicht: immer im Rahmen der Gegebenheit.
Es bedarf einer Formenlehre möglicher Korrelate nach allen Stufen
als Analogon der Formenlehre der Bedeutungen. Und dazu gehört
112 zur intentionalität der objektivation

auch die Erwägung, zu welchen Korrelaten das Charaktermoment


„Evidenz“, gegebenes „wahr“, hinzutreten kann und zu welchen
nicht, ob es auch zu ihm selbst hinzutreten kann etc. Tritt es hinzu, so
heißt der Gegenstand gegeben oder in seiner Wirklichkeit gegeben, in
5 seinem Sein, denn das charakterisiert das „Gegenstand im Charakter
wirklich“; es heißt die Vermutlichkeit des Gegenstandes gegeben,
denn das charakterisiert das „Gegenstand im Charakter vermutlich“.
Gegeben kann sein „S ist p“ – der „Sachverhalt“ ist gegeben, das
Urteil steht da als wahr. Wirklich ist S p, vermutlich ist S p – das
10 Urteil, die Vermutung: „das Sp ist wirklich“.

Beilage VIII
Der Blick des reinen Ich auf die
Phänomene. Das Übergehen des Blickes vom
Phänomen zu dem in ihm Erscheinenden1

15 De r B lic k a uf Einzelnes (Individuelles), auf Allgemeines, zunächst im


Sinn eines Wesens, auf Individuelles als Einzelnes des Wesens als eines
„Allgemeinen“, auf ein Allgemeines im Sinn der Gattung, auf eine Art
als Art der Gattung, auf Einzelnes und ein anderes Einzelnes, nämlich auf
„beide zusammen“, nicht auf Einzelnes, aber auf eins von zwei Einzelheiten,
20 auf Einzelnes als „Teil“ eines anderen Einzelnen, auf sonstige „Relationen“
usw.
„Der Blick auf“: ein bestimmter Sinn von „meinender“ und „setzender“
Zuwendung. Haben nun dieser „Blick“, diese „setzende Zuwendung“ nicht
ihre „Weisen“, ihre Formen, denen korrelate Formen des Gemeinten als sol-
25 chem entsprechen? Ist er nicht selbst in einem neuen „Blick“ als Phänomen
zu fassen? Wobei dieser neue Blick eben wieder „Blick“ ist auf?
Nun eben dieser Blick geht auch auf das in den Phänomenen „Intentio-
nale“, und zum Wesen des durch ein Phänomen hindurchgehenden Blickes
gehört es, dass eben auch der Blick auf das Phänomen zu richten ist, durch
30 welches der Blick geht. Oder es gehört zum Wesen von Gemeintheiten einer
großen Klasse, dass eine Reflexion des Blickes möglich ist auf die Phänomene,
„durch“ welche das direkte Meinen ging. Der Blick und die „Ein h e it d e r
t r a ns z e nde n ta l en Ap pe rz e pt io n“ K an ts, das „Ich denke“, das alle
meine Vorstellungen muss begleiten können.

1 Sommersemester 1911.
beilage viii 113

Phänomenologie als Wesenslehre der puren Phänomene nach ihren reel-


len Momenten und nach ihren intentionalen Beständen. Ihrem Wesen nach
begründen Phänomene Einheiten der Identifikation und Unterscheidung. Sie
treten in Einheitsphänomene der Identifikation und Unterscheidung durch
5 ihr Wesen ein. Dabei aber sagen wir, es ist „evident“, dass die so in Ein-
heit tretenden Phänomene „dasselbe meinen“, in dem Sinn, dass dieselbe
„Gegenständlichkeit“ in diesen Phänomenen „bewusst“ ist, dass dasselbe
gedacht ist oder erscheint, anschaulich ist etc. Betrifft das unmittelbar alle
Phänomene oder nur seinssetzende oder quasi-setzende Phänomene, wäh-
10 rend andere Phänomene ihrem Wesen nach in Seinssetzung oder Quasi-
Setzung eintreten können? Noch ist also nicht letzte Klarheit erlangt über
das, was das Thema und den Sinn der Phänomenologie ausmacht.
Ausgang vom „Dies da“, vom Phänomen, z. B. Phänomen des Gedan-
kens, Phänomen einer Beweisführung, Phänomen eines Aussagens, Phä-
15 nomen einer Wahrnehmung etwa jetzt, Phänomen des indirekten Sehens,
Doppelbild etc. Phänomen des Hintergrunds, auf das ich „nachträglich“
die „Aufmerksamkeit“ lenke. Die Unterschiede der Aufmerksamkeit, des
Übergangs von „Beachtung“ des Phänomens und jenes Phänomens und die
zugehörige attentionale Modifikation usw. Das F u n d am en t : Ei n B li c k
20 d e r S ch a u un g ri ch t et si c h a u f e in P h ä no m en und richtet sich bald
auf dies, bald auf jenes Phänomen in einem phänomenalen Zusammenhang,
und der Blick richtet sich eventuell auch auf sich selbst und richtet sich also
darauf, dass sich ein Blick auf dies und jenes gerichtet hat und noch richtet
oder im Übergang ist.
25 Soll man das zur Id e e d es „ r e in e n I c h “, „der reinen Apperzeption“, in
Beziehung bringen und sagen, wir unterscheiden hier einerseits verschiedene
Blicke und andererseits sagen wir, der Blick geht von dem zu jenem über.1
Was an reduzierten Phänomenen in die Einheit eines Blickes, der von dem
zu jenem übergeht und der ein I d en t i sch e s b eh ält, das Identische, das
30 das „I c h blicke“ ausmacht, fällt und was in die Einheit eines Ichblicks fallen
kann, das macht eine E in h ei t d e s I ch b ew uss t s ein s aus, nämlich macht
eine Einheit von Phänomenen aus, die zu demselben reinen Ich „gehören“. 2
Der Blick geht von Phänomen zu Phänomen fort, er geht aber auch
von dem Phänomen, das Jetzt-Erblicktes und Jetzt-Phänomen ist, zu dem
35 vergangenen Phänomen als erblickt gewesenem zurück; er geht aber auch zu

1 Eine Setzung geht auf a und b und ist mehr als Setzung von a und von b. Alles,

was in die Einheit einer Setzung eintreten kann, gehört einem Bewusstsein an.
2 Das bedarf aber der genaueren Bestimmung. Cf. Kolleg über natürlichen Weltbe-

griff 1910/11, 44 ff. = Husserliana XIII, Beilage XXVI (S. 219).


114 zur intentionalität der objektivation

dem vergangenen Hintergrund des gewesenen Phänomens über und bringt


in einen Blick die Erinnerung, was nicht aktuell erblickt war, und erfasst die
Möglichkeit, dass das hätte „damals erblickt sein können“, obschon es nicht
erblickt war. Der Blick der Schauung, der identischer schauender Ichblick ist
5 oder in getrennten Akten doch ein Identisches „enthält“, ist genauer besehen
gegenwärtigender, „wahrnehmender“ Blick, Blick in die Gegenwart, aber
auch Blick in die Vergangenheit.
Der „Blick“ des reinen Ich, die „reine Apperzeption“. „Blick“ in die
unmittelbare retentionale Vergangenheit oder Blick in die „wiedererinnerte
10 Vergangenheit“, Blick in die Zukunft, Vorblick, der wieder anders ist. So
der Blick auf die „ P h ä no m e n e “, die wieder ihre „Zeit“-Ordnung und
Zeiterstreckung haben, sie sind „jetzt“, „vergangen“, künftig.
Aber „derselbe Blick“ geht wie von Phänomen zu Phänomen, z. B. von
diesem Undeutlichkeitsphänomen (des visuellen Hintergrundes) zu jenem
15 oder vom Übergangsphänomen des Blickübergangs zu jenem Blickübergang
etc., so von dem Phänomen über zu dem, w a s in ihm als Dingphänomen
etwa erscheint. Das Undeutlichkeitsphänomen ist, sagen wir, Phänomen von
einer Uhr, ich achte aber auf, blicke aber auf das Phänomen selbst, das
immer wieder ein anderes ist, wenn ich das Auge darauf richte, es in Deut-
20 lichkeitsphänomene überführe. Andererseits wendet sich nun der schauende
„Blick der ‚reinen Apperzeption‘ “ (des reinen Ich) darauf, dass das Phäno-
men und jedes Phänomen dieser Reihe und der kontinuierliche Übergang
vom „undeutlichen“ Phänomen zum deutlichen immerfort Phänomen von
der einen und selben Uhr ist, die bald deutlicher, bald weniger deutlich
25 „erscheint“. Derselbe Blick geht über vom „Phänomen“ selbst zu dem in
ihm Erscheinenden. Das, was vorhin Anlass gab, von einer Identität im Blick
(reines Ich) zu sprechen, besteht hier fort. Ebenso in der Erinnerung und
Erwartung, ebenso aber auch bei den „Denkphänomenen“, der Blick richtet
sich auf das vage Vorgestellte, auf das logisch Gedachte anstatt auf das „leere
30 Vorstellen“, auf das Phänomen des Leervorstellens, oder auf das Phänomen
des Aussagens, wie es da abläuft, oder auf das Phänomen des Begründens
etc.
Das wäre soweit alles gut: Aber wie zeichne ich von vornherein den
B e g r i f f de s P hä n om e n s aus? Brauche ich da nicht schon eben diesen Ge-
35 gensatz zwischen Phänomen und dem, was im Phänomen „bewusst“ ist? Die
Frage ist also, w i e f än g t e i ne a bs o lu t e B e t ra c ht u ng an , d i e wir k li ch
ni c ht s v or a u s se tz t und an die Grundunterschiede führt? Und was heißt
das für eine ab s o lu te B e tr ac h tu n g: „ n i ch ts vo r a us s e tz t “, und was
heißt „absolute Betrachtung“ selbst? Anheben mit der phänomenologischen
40 Reduktion, das heißt schon anheben mit dem betreffenden Unterschied
zwischen Erscheinung und Erscheinendem usw.
beilage viii 115

Gibt es da einen anderen Weg als den, vom natürlichen Bewusstsein aus-
zugehen, die skeptische Betrachtung durchführen, dann zu den Reduktionen
übergehen, da s r e i n e P h ä n om e n u n d d a s r ei n e Ic h, den „Blick der
Schauung“ postieren? Das „ Ic h “, das r ein e Ic h , s e tz t d as P h än o m en
5 u n d se t z t s ic h se l bs t.
Alle Skepsis, sagt man, setzt voraus, dass etwas außer allem Zweifel
verbleibt. W as is t di e Gr e nz e d e s Zw ei fe ls: das „Ich“ als re in es Ic h
u n d se in F e ld v o n P hä no m e n e n und alles, was darin zur selben reinen
Gegebenheit zu bringen ist wie das Ich und seine Phänomene?
II. ZUR ANALYSE DER EXPLIKATIVEN
UND PRÄDIKATIVEN SYNTHESEN
UND IHRER FUNDAMENTE

Nr. 8

5  Di e Un te r schi e de u nd Ve rhä l tni sse


zwi sch e n Ex p l ika ti on , b ez i ehe nde r
S y nt h e s is u nd Prä di ka tio n 1 2

§ 1. Partialerfassungen auf dem Grund einer


Gesamterfassung. Das Im-Griff-Behalten des
10 thematischen Ganzen. Das Sondererfasste
kann selbst zum Thema werden

1) Schlichte Erfassung eines Dinggegenstandes. Es mögen an ihm


schon einzelne Teile oder Momente gehoben sein, aber sie sind nicht
erfasst für sich.

1 September 1911, zweite Hälfte. – Neue, außerordentlich sorgfältige und durchaus

auf strenger Intuition gegründete Überlegung. Vgl. weiter unten Πλ = Text Nr. 10:
Die Weisen der Erfassung und ihrer Synthesis (S. 175).
2 Es scheint mir, dass ein wichtiger Mangel der Ausführungen in diesem Stück

ist, dass ich nicht von vornherein das begreifende Erkennen, das überhaupt erst
das Urteilen macht, in Betracht gezogen habe. Es muss genau erwogen werden, ob
nicht alle Unterschiede, die ich tatsächlich zwischen Explikation und Prädikation
machte, im Verborgenen voraussetzten, dass Erkennung statthat, die allein urteils-
mäßige „Bestimmung“ ausmacht. Die sinnliche Bestimmung in der Klarlegung des
sich explizierenden Objekts bereichert dieses, fügt ihm Klarheiten ein, und zwar auch
solche, die es nicht gehabt hat, es bereichert seinen sensuellen Sinn, aber denkmäßig
bestimmt sich das Objekt als Erkenntnisobjekt, also durch Erkennung. Das als a
Erkannte wird dann neu erkannt, das ist, eben prädikativ erkannt als b, und das ist das
Erste für alle weiteren Urteilsbildungen. Das τ
ς wird zum ποιν.

© Springer Nature Switzerland AG 2020 117


U. Melle, T. Vongehr (Hrsg.), Studien zur Struktur des Bewusstseins, Husserliana:
Edmund Husserl – Gesammelte Werke 43-I, https://doi.org/10.1007/978-3-030-35788-7_2
118 explikative und prädikative synthesen

2) Übergang in Partialerfassungen. Das erste, das schlichte Sich-


Zuwenden und Ergreifen ist eine Spontaneität, ebenso sind die Par-
tialerfassungen spontane „Tätigkeiten“.
Wenn ich aber die Partialerfassungen übe, so ist mit der schlich-
5 ten Erfassung eine Veränderung vorgegangen und in verschiedener
Hinsicht. Was uns hier interessiert, ist, dass sie kein Erfassen mehr
ist, kein Ergreifen, sondern ein gewisses phänomenologisch wohl-
unterschiedenes Behalten. Wenn ich schlichte Erfassung übe ohne
Partialbetrachtung, zum Beispiel, wenn ich einem einfachen Ton eine
10 Weile erfassend zugewendet bin, ohne an ihm etwas zu unterscheiden,
oder einem undeutlichen Objekt im indirekten Sehen, das ich eine
Weile geistig fixiere, ehe ich Unterschiede finde und finden kann (ich
wähle solche Beispiele, weil bei deutlichen Objekten sehr schnell
das schlichte Erfassen in Explizieren übergeht), so haben wir ein
15 dauerndes Erfassen als eine dauernde Spontaneität. Ich bin dauernd,
wird man vielleicht sagen, „aufmerksam“ auf das Objekt, ohne in
Aufmerksamkeit auf die Teile überzugehen. Nun, dann ist dieses
Aufmerken die Spontaneität.
Wenn ich nun in Partialbetrachtung übergehe, so lebe ich im Ein-
20 zelnen, ich erfasse dieses spontan, das Ganze aber erfasse ich nicht
mehr in dieser Weise, aber habe es noch im Griff. Dieser Griff ist ein
dauernder, ruhender Zustand und nicht ein Greifen.
Genau besehen kann man hier noch Unterschiede machen. Der
Griff kann mehr oder minder fest sein, er kann fest sein und sich
25 lockern, wohl auch locker sein und wieder fester werden, und er kann
aufhören, und das Objekt schlüpft aus dem Griff. Man wird natürlich
auch in dieser Hinsicht geneigt sein, von verschiedenen Graden der
Aufmerksamkeit zu sprechen, aber es handelt sich nicht um Worte,
sondern um Beschreibung von Phänomenen.
30 Wenn ich ein sehr „interessantes“ Objekt erblicke, eine seltene
Geige (ich bin Liebhaber) etc., so betrachte ich sie mit „konzentrier-
ter Aufmerksamkeit“. Auf das ganze Objekt bin ich fest gerich-
tet, ich habe es erfasst und halte es ganz erfasst. Während ich die
Einzelheiten besonders erfasse, die schöne Schnecke, den Lack, die
35 Rundung des Rückens usw., vollziehe ich immer neue spontane Zu-
wendungen und Erfassungen, die ihre Vorzüglichkeit haben und das
Erfasste vorzüglich hervortreten lassen. Das momentan nicht par-
tial Erfasste, aber eben erfasst Gewesene, wird dabei „behalten“?
text nr. 8 119

Es fragt sich, ob man das sagen kann bzw. in welchem Sinn man es
sagen kann.
Und wieder, was uns hier noch vorher interessiert, fragt es sich,
wie es sich dann mit dem Gesamterfassen, dem Erfassen der Geige,
5 verhält. Die ist es doch immer, die ich „betrachte“. Muss man nicht
sagen, dass die Geige immerfort erfasst bleibt, dass ich ihr erfas-
send immer zugewandt bin und dass sich mit dieser Erfassung die
Partialerfassungen „decken“, derart, dass ich nicht nebeneinander
Erfassungen übe, sondern so, dass ich in der Partialerfassung zugleich
10 das ganze Substrat erfasse, sofern es den „Teil“ übergreift und in
diesem Übergreifen bewusst ist?
Das alles ist gut. Aber der Unterschied ist nicht zu übersehen,
dass in der ersten Erfassung des Ganzen, mit noch „unverteilter“
Partialspontaneität („Aufmerksamkeit“), ein Strom der Spontaneität
15 sozusagen auf das verworren-einheitliche Objekt ging, und ebenso,
wenn die explizierende Betrachtung inszeniert ist, ein ebensolcher
Strom originärer Spontaneität auf die betreffenden „Teile“ im Fluss
der betreffenden Partialerscheinungen geht. Dagegen verbleibt nun
nicht etwa ein Strom solcher urquellender Spontaneität gerichtet auf
20 das „Ganze“. Sie hat sich offenbar verändert. Wenn es heißt, wir
bleiben erfassend auf das ganze Objekt gerichtet, es sei ja gerade das
Objekt der Betrachtung, so ist es nicht ein Verbleiben der spontanen
Erfassung in der ursprünglichen und ursprünglich lebendigen Form.
Die ursprüngliche Erfassung verwandelt sich in Substraterfassung
25 bzw. thematische Erfassung, wie ich es sonst auch nannte. Das Phä-
nomen ist dem Allgemeinen nach dasselbe in den Fällen, wo wir uns
einem Objekt in spontanem Erfassen zugewandt haben und dann
zu einem anderen (und ihm nicht als Teil Eingeordneten oder als
Ganzes Übergeordneten) in gleicher Zuwendung übergehen, ohne
30 unser erstes Objekt aus dem Griff zu lassen (also hinzunehmen und
zusammennehmen, wobei anderes erblickt sein kann, aber nicht als
Thema erfasst ist). Es handelt sich nicht um ein bloßes Phänomen
der ursprünglichen „Erinnerung“, des noch im Bewusstsein Bleibens,
obschon auch das statthat. Denn es ist zweierlei: „noch bewusst ha-
35 ben“ in dem Sinn des Perzipiert-Habens und noch Erscheinens und
Noch-im-Griff-Haben, Noch-Halten.
Ich kann meine Aufmerksamkeit abwenden, ohne festzuhalten.
Es kann das Objekt dabei sich noch stark abheben: aber es ist nicht
120 explikative und prädikative synthesen

nur nicht originär erfasst, sondern auch nicht „noch im Griff“. In


jedem zusammennehmenden Erfassen (auch wenn es nicht ein Per-
zipieren ist im Sinn eines Dingwahrnehmens, woran wir jetzt immer
gedacht hatten) haben wir eine Folge von originären Erfassungen,
5 wobei eine Einheit des Bewusstseins erwächst, in welcher bei jedem
Schritt eine originäre Erfassung verbunden ist mit solchen Noch-
im-Griff-Behaltungen. Und schließlich kann eine Zusammenhaltung
übrig sein, nachdem die letzte originäre Erfassung auch in Behaltung
übergegangen ist, die kein Originärglied mehr enthält und doch Zu-
10 sammenfassung ist. Der „Vollzug“ der Zusammenfassung besteht in
diesem Prozess (und das Ende ist eine dunkle Zusammenfassung).
Doch muss noch unterschieden werden dieses Festhalten im Griff
und das Festhalten im Thema, wie schon in der spontanen Zuwen-
dung und Erfassung die Erfassung überhaupt und die Erfassung als
15 Thema.
Gehen wir nun wieder zurück zum Fall der Explikation, der Be-
trachtung eines Gegenstandes in Prozessen der Einzelerfassung, der
explizierenden „Kenntnisnahme von ihm“. Das Ganze verbleibt also
im Griff, während die ursprünglich spontanen Erfassungen der Teile
20 aufeinanderfolgen. Es ist aber zu bemerken, dass es auch dem Griff
entschlüpfen kann: Das heißt, es wird nicht mehr festgehalten, ein
„eigenes Interesse“ geht dann auf den Teil, der nun nicht mehr als
Teil erfasst ist. Bei der Betrachtung des Gegenstandes ist, sagten
wir, im Sondererfassten das Ganze expliziert. Nennen wir das Son-
25 dererfasste, sofern es hier in der Explikation des Ganzen erfasst ist
und eigentlich in ihm das Ganze in der betreffenden Besonderung
erfasst ist, das „Explikat“. Sowie das Ganze nicht mehr Thema ist, aus
der thematischen Erfassung herausrückt, verliert das Sondererfasste
den Charakter des Explikats und wird selbst zum Thema oder zum
30 Erblickten.
Dabei ist aber wohl zu beachten, dass ganz wohl die Einheit des
Ganzen auch ohne Erfassung bewusst sein kann und seine besondere
Abhebung besitzen kann gegenüber dem sonstigen Hintergrund. Und
eine Deckung besteht immerfort: Der aktuell erfasste Teil ist zwar
35 nicht als Explikat oder als Teil, nämlich auf dem Untergrund der
Gesamtfassung erfasst, aber die auf ihn bezogene Erfassung greift
etwas heraus, was einer umfassenden Auffassung, einem umfassenden
Erscheinungsganzen eingeordnet ist, und wenn die Partialerfassun-
text nr. 8 121

gen fortschreiten, so bewegen sie sich auf dem Grund einer einheitlich
abgehobenen Erscheinung, in der das ganze Objekt erscheint, das
aber nicht erfasst ist. Endlich scheint es, dass wir auch Unterschiede
des fester und lockerer Im-Griff-Habens unterscheiden müssen, wie
5 schon oben gesagt.

§ 2. Das Fungieren der Partialakte im Prozess


der Kenntnisnahme. Die Bereicherung der
Gesamtobjekterfassung durch die Einzelerfassungen.
Die explikative Synthesis als Grundlage der Prädikation

10 Nun ist es aber ein Problem, zu verstehen, wie in der Folge der
gegenständliche „Kenntnis“ gebenden Partialakte, der explizieren-
den (die gegenständliche Intention der Totalvorstellung schrittweise
erfüllenden), die Partialakte eigentlich fungieren, und wie es mit
dem „Im-Griff-Bleiben“ ihrer originär erfassten Objekte nach der
15 Erfassung sich verhält. In gewisser Weise ist dies natürlich der Fall.
Der ganze Prozess der Kenntnisnahme ist eine „Einheit des Bewusst-
seins“ (der Prozess der Betrachtung ist Prozess der Kenntnisnahme
insofern, als dadurch als Ergebnis Kenntnis gewonnen wird: blei-
bende Kenntnis, Dispositionen zur Erinnerung solcher expliziten Vor-
20 stellungen in der Erinnerung, Aussagen darüber etc.). Es ist aber zu
beobachten, dass im einfachen Fortlaufen des Betrachtens nicht be-
sondere Zusammennehmungen die herausgehobenen Teile oder Ei-
genschaften des Objekts verbinden. Wäre aber ein In-jedem-Schritt-
das-originär-Erfasste-des-vorigen-Schritts-Festhalten nicht soviel wie
25 schrittweise Zusammennehmung üben oder Zueinanderhinzuneh-
mung? Es ist ja ein Unterschied, notierend, aufzählend zu sagen „S
ist p, q, r …“ und „S ist (p und q …), ist all das zusammen“.
Man wird sagen müssen, dass Zusammennehmung erfolgen kann,
aber im Allgemeinen nicht zur Explikation gehört, und dass das
30 Zurückbehalten, das ihr zugehört, nicht eigentlich ein Festhalten im
erfassenden Sinne ist. Bildlich kann man sagen, die in der stetigen
Gesamtbehaltung (der thematischen) des ganzen Objekts enthaltene
Objektauffassung hat all die herausgehobenen Einzelheiten in sich
aufgeschluckt, bzw. das Im-Griff-Haben des in Explikation stehen-
35 den Objekts ist nicht ein Im-Griff-Haben desselben, „so wie es“ vor
122 explikative und prädikative synthesen

der Explikation bewusst war, vielmehr so, wie es mit jedem neuen
Schritt bewusst ist, und das ist es verschieden. Oder: D e r Gr i ff
d es G esa mt ob jek t s ist ei n so l c her , d e r in j ed e m S ch ri t t
d as ei nz el n E r gri f f en e i n sic h au f ni m m t. Die Einzelergrei-
5 fungen verwandeln sich nicht in festhaltende Einzelgriffe, sondern
in Modifikationen des Gesamtgriffs, in Bereicherungen seines In-
halts.1
Die Erfassung des Ganzen, die ein Erfassthaben ist, ist also im-
merfort in Bewegung, und immerfort findet eine Synthese statt, eine
10 „Deckung“ nach Auffassung und nach den Zuwendungen. Die Hin-
wendung auf das Ganze und die Hinwendung auf den Teil, hier
originäre Erfassung des Teils, sind einander nicht äußerlich. Und
die Partialerfassung erfasst das Ganze „nach diesem Teil“ in die-
sem Explikat, nämlich sofern sie eben nicht bloße Einzelerfassung
15 ist, sondern in dieser eigentümlichen Weise auf dem „Grund“ der
Gesamtobjekt-Erfassung (-Haltung) statthat. Und man kann auch
sagen, in dieser Deckungseinheit, die Deckungseinheit insofern
ist, als die Partialerfassung doch ein neuer spontaner „Akt“ ist,
der sich mit dem bisherigen Gesamterfassen deckt, geht die Sache
20 so zu, dass der unbestimmte, ungeklärte, unverdeutlichte Teil, eine
eingeschmolzene Komponente der Gesamtintention des zu explizie-
renden Gegenstandes, mit dem eben Bestimmten, durch die Partialer-
fassung Herausgezogenen, -gehobenen sich deckt: Aber sie bleiben
nicht zwei und sind nicht zwei kongruente Sachen, sondern das un-
25 bestimmte Ganze erhält anstelle des Unbestimmten, Unabgegrenz-
ten, vage Eingewobenen den bestimmten und eventuell klaren Teil,
der nun umgeben ist von dem Medium der sonstigen Unbestimmt-
heit des Noch-nicht-Bestimmten. S o wi r d da s G a nz e in j ed e m
Sc h r itt e i n a n de r s B e wu ss t es, es erhält explikative Bestimmtheit
30 innerhalb des Mediums der Unbestimmtheiten, und in dieser Weise
ist da s B e wu s s ts e i n d e s G an z e n e i n so l c he s , d a s i m me r

1 Vielleicht sagt man auch so, es gibt zweierlei Modifikationen des spontanen Er-

greifens. Die erste besteht darin, dass kein Ergreifen mehr statthat, aber ein Im-Griff-
Festhalten: Das Erfasste ist noch erfasst, aber in anderer Weise. Die andere besteht
darin, dass kein Erfassen mehr statthat und Erfasst-Verbleiben, sondern ein Haben
des Erfassten ohne Erfasstsein, ohne Im-Griff-Sein. Und die ermöglicht und macht
aus die Bereicherung des Inhalts des ganzen, immerfort ergriffenen Objekts.
text nr. 8 123

n eu sic h be reic her t , n äml i ch d u rc h D e ut l i ch ke i ts pa rt i e n ,


d u rc h S on d er u nge n i nn erh alb d es Me di um s d er „ V er w o r -
renh eit “. Andererseits ist bei diesem Prozess das Bewusstsein vom
Ganzen immerfort Bewusstsein von demselben Gegenstand, es waltet
5 durch die „Einheit gegenständlicher Beziehung“.
Den Prozess dachten wir so: Eine originäre Zuwendung und Er-
fassung geht auf G und dann folgen einander die verdeutlichenden
Explikationen, Partialauffassungen. Dem entspricht prädikativ das
„G ist α, β, γ …“. Aber ist das wirklich schon die Sachlage, die, wenn
10 wir von der Schicht der Begrifflichkeit absehen, zu diesem Prädizieren
gehört? Das ist nun die große Frage.
Zunächst sieht man, dass hier doch Unterschiede sich aufdrängen.
Wenn ich voll eigentlich vollziehe „Das Tintenfass ist aus Messing,
gelb glänzend, hat eine Untertasse …“, muss ich da nicht sagen
15 „Das Tintenfass ist aus Messing, ist gelb glänzend“, „G ist a, ist
b, ist c“, und werde ich da nicht gezwungen, auf das G, während
ich es in stetigem Erfassen halte, immer wieder zurückzugehen, es
in neuen originären Erfassungen zu erfassen? Natürlich. Natürlich
habe ich keine Trennungen, also nicht etwa „G ist a, G ist b, G ist
20 c“. Das kann ich auch haben, und wenn das G fortdauernd erscheint,
so wird eine Einheit hergestellt, eben durch diese „Identität“ der
Erscheinung.
Etwas anderes ist es aber, wenn ich G originär erfasse und nun
an ihm das a explizierend erfasse, wenn ich, das als a bestimmte G
25 festhaltend (im Griff haltend), eine neue originäre Erfassung G voll-
ziehe, wodurch kontinuierlich einheitlich das jetzt originär Erfasste
(als a bestimmte G) und das soeben im Griff Gefasste sich decken.
Und nun wird eine neue Einzelerfassung geübt usw.
Dabei ist nicht zu verwechseln: Da s wi e d e rh ol t e r fa s s t e G
30 erf a s st zw a r d a s G , d a s s c h on a l s a v e rd e ut li ch t i s t , a be r e s
er f ass t n ich t G a t t r ib u t i v, „G, welches a ist“, das heißt, es wird
nicht G in Bezug auf das in einem Erfassen vorstellige a erfasst, in
einem komplexen Akt, der eine eigene Festhaltung des a impliziert.
Das ist vielmehr eine neue Sache.
35 Nun bleibt es aber (nach der oben gegebenen Darstellung) offen,
dass, wenn eine einfache Explikation des G statthat (ohne Rück-
kehr zu erneuten ursprünglichen Erfassungen des G), dass der erste
Schritt der Explikation, der das erste Bestandsstück des G zur par-
124 explikative und prädikative synthesen

tialen ursprünglichen Erfassung bringt, zugleich diejenige Synthesis


darstelle, die in ausdrücklich-begrifflicher Fassung sich ausspricht
als „G ist α“ oder „G hat α“. Ohne hier in Näheres des Wesens
der Prädikation und des Sinnes des „ist“ und „hat“ einzugehen,
5 sehen wir doch bald ein, d as s s o lc he Sy nt he s i s h ie r no ch n ich t
v or li egt. Oder eine Synthesis liegt zwar vor in einem gewissen Sinne,
aber n i c h t s ch on völ l ig das, was zum prädikativen Zusammen-
hang erforderlich ist, n ic ht di e präd ik at i ve S yn th es i s. Freilich,
hier bedarf es großer Vorsicht, und ich spreche mit allem Vorbe-
10 halt.
Vertiefe ich mich intuitiv in eine volle, eigentliche Prädikation, so
besteht sie ja nicht darin, dass ich mit der Subjektsetzung anfange,
„ist“ sage und mich dann umsehe, was sich wohl als Prädikat ergeben
möchte. Da hätte ich ja eine indirekte Vorstellung von einem zu
15 Prädizierenden im Voraus. Sehen wir natürlich davon ab, so ist es
klar, dass ich prädizierend jene „Synthese“, von der wir oben gespro-
chen haben, schon vollzogen habe, dass sie zugrunde liegt. E r st
s e he n w ir un s d e n G e g en s t an d a n , „ b et r ac ht e n “ i hn , und
d a nn p rä d i z i e r e n w i r : A u f g run d d er dur c h d i e B et r ac ht un g
20 e r l a n g t e n Ke n n tn i s v o l l z ie h e n w i r ur t ei l en de E r ke nnt ni s.
Bei der „Betrachtung“ vollziehen wir die G-Erfassung und, das G
festhaltend, vollziehen wir „im Rahmen“ des G die Partialerfassung.
Wir können sagen, die Partialerfassung, Explikaterfassung, fasst her-
ausgrenzend, was bloß implicite im G-Erfassen schon erfasst war und
25 immerfort erfasst bleibt. Das ist wichtig. Es stehen sich nicht zwei
gesonderte Erfassungen gegenüber, um sich dann zu decken, sondern
in die eine schießt die andere hinein.

§ 3. Der Übergang von der Explikation zur


Prädikation. Die Prädikation als Wiederholung des
30 explikativen Prozesses in geänderter Einstellung. Die
prädikative Synthesis als schöpferische Erzeugung
des Sachverhalts. Die Sachverhaltsreflexion

Nun ist die Frage, was die Erfassung „G ist α“ eigentlich her-
einbringt. Und hier ist auch die Stelle, um sogleich den wichtigen
35 Unterschied geltend zu machen zwischen dem Ist-Inhalt, G ist α,
text nr. 8 125

und dem entsprechenden Relationsinhalt (der aber auch ein Beschaf-


fenheitsinhalt ist),1 G hat T.
G ist weiß. G hat Weiße. G ist Ganzes von „weiß“ als Teil. Ich fühle
mich darin gar nicht sicher. Aber die bisherigen Analysen dürften
5 uns schon geholfen haben. Ich habe immer von „Partialerfassung“
gesprochen: Ist das wirklich Erfassung des Teils? „Objektiv“ ja. Die
Weiße ist ein Moment am Gegenstand, und gerichtet bin ich in der
Explikation auf das Moment. Aber „Teil“ drückt eine kategoriale
Form aus, und der Teil ist als Teil nur erfasst im artikulierten synthe-
10 tischen Relationsbewusstsein: T ist Teil von G und G umfasst T, T ist
in G, G hat T.
In der Explikation betrachte ich das Papier, und in dieser Betrach-
tung bin ich auf das Papier gerichtet als Substrat, und „innerhalb“
dieser Richtung erfasse ich das Weiß:2 Es wird nicht für sich, sagte
15 ich, zum Gegenstand, sondern es ist Verdeutlichung, Explikat des
Gegenstandes, das heißt, in ihm betrachte ich den Gegenstand, ihn
verdeutlichend, ihn nach einer Sonderheit erfassend, aber in ihr eben
den Gegenstand erfassend nur „nach“ dieser Sonderheit, oder viel-
mehr den Gegenstand als so sich verdeutlichend, sich bestimmend.
20 Gerichtet bin ich dabei auf den Gegenstand und diesen „Teil“ am
Gegenstand in eins und ungeschieden; aber nicht gerichtet auf das
„Sein“, auf den Sachverhalt „G ist weiß“: in seiner artikulierten und
sozusagen auseinandergelegten Einheit.
Sollen wir also sagen, dass e t w a s N e ue s eintritt? Z ue r st f än de
25 E x p li ka t i on st a t t u nd da n n e i n e n eue E i ns te l l ung , ei ne
n e ue R ic h t u ng a u f d a s , wa s du r c h d i e E x pl i ka ti on ko nst i -
t u ie r t i s t? Und die Frage ist, ob das Neue Sache des Ausdrucks ist
und der begrifflichen Fassung. Nun, die Worte, Wortlaute können wir
lassen. Also kommt dann in Betracht die Dies-Setzung oder Subjekt-
30 Setzung des G und die Setzung des Weiß nicht als Setzung eines
„Gegenstandes für sich“, sondern als „Bestimmung“. Der „Blick“
richtet sich, wird man sagen, auf das G, das als das durch die Explika-
tionsbewegung als weiß Bestimmtes bewusst ist und in der Wieder-

1 Hinter den in Klammern stehenden Satzteil hat Husserl später ein Fragezeichen
gesetzt. – Anm. der Hrsg.
2 Gute Ausdrücke sind „Explikand“, „Explikat“.
126 explikative und prädikative synthesen

holung dieses Übergangs auf die Einheit, auf das „Identische“, auf
das „Ist“, in dem das explizierte G sich mit dem Explikat identifiziert:
und das kommt in der Prädikation zum Ausdruck, zur begrifflichen
Fassung.
5 Was besagt das aber, der Blick richtet sich? Habe ich nach erster
Ausführung der Explikationsbewegung ein Resultat, etwa ein Gan-
zes? Nun, das Ergebnis ist das „im Weiß verdeutlichte Objekt“. Das
Weiß ist das, was im vollen Licht steht, was im besonderen Sinne
erfasst ist, aber auf dem Grund der Richtung auf das Papier, das,
10 soweit es mehr ist als das Weiß, nicht im vollen Licht steht. Auf das
„Ergebnis“ bin ich eo ipso gerichtet, eben indem ich auf das Weiß
hinsehe und es in dieser Weise, am Ende dieses Prozesses gegeben
habe. Aber ich kann nun die „Aufmerksamkeit“ auf das Ganze (G)
richten und es ins Licht setzen und darin liegt, das Ganze (G) in
15 neuer Spontaneität erfassen, ihm eine neue spontane Zuwendung
zukommen lassen: Aber das Ganze (G) ist nicht das Ganze vor
dem expliziten Prozess, sondern nach ihm: Das Weiß ist lebendig
erfasst auf dem Grund der vorangegangenen G-Erfassung, die in der
lebendigen Weiß-Erfassung noch als Griff da ist und mit ihr sich
20 „deckt“, und so gehe ich vom Griff in ein neues Ergreifen über,
während das lebendig erfasste Weiß in den Griff übergeht. Kann ich
also etwa sagen: Das Resultat der Explikation ist ein Ganzes, etwa
ein synthetisches Ganzes, das ich nun „analysiere“, also expliziere?
Das doch natürlich nicht.1
25 Wenn ich eine Explikation vollzogen habe, eine durchlaufende
Gegenstandsbetrachtung, so kann ich auf den Prozess zurückschauen,
einen schlichten Blick darauf werfen, ihn zum Thema einer Explika-
tion machen. Auf den Prozess: das Nacheinander, in dem zuerst das
schlicht erfasste G steht, dann das verdeutlichende Erfassen des α in
30 G usw. Die Einstellung ist also ontisch. Und die Explikation dieser
sukzessiven Einheit erfolgt im Durchlaufen der Sukzession, also im
Erneuern der Explikation „in der Erinnerung“.2 Aber Explikation ist
Explikation. Und was hier zur Wiederholung der Explikation in der

1 Das wäre ja ein unendlicher Regress, wie ich auch folgende Seite = S. 127,30–32
sage.
2 Besser darstellen.
text nr. 8 127

Erinnerung hinzutritt, ist, dass sie selbst als explizierend auftritt für
die schlichte thematische Erinnerung an die Explikation. Aber das
geht uns hier nicht an. Nicht um dieses Resultat der ursprünglichen
Explikation handelt es sich, nicht um den Prozess, der in ihr sich
5 konstituiert.
Worauf blicke ich also, wenn es sich mir, nachdem der betrach-
tende Blick von G zu α, vom Papier (in der schlichten Erfassung)
zum „weiß“ gegangen ist, darum handelt auszusagen „G ist weiß“?
Ich blicke nicht auf das Nacheinander des Prozesses zurück. Blicke
10 ich etwa1 auf das Ineinander, auf die Deckungseinheit, die sich in ihm
konstituiert? Aber wie das? Blicke ich auf den Prozess zurück, aber
nicht er interessiert mich überhaupt, nicht ihn mache ich zum Thema,
sondern nur die in ihm und durch ihn sich konstituierende Einheit
der Deckung zwischen „G“ und „α“, die im Endpunkt konstituiert
15 ist, aber nicht Thema ist? Aber man wird hier seine Bedenken haben
dürfen, wenn das besagen soll, dass ohne „Wiederholung“ des Pro-
zesses und ohne geänderte Einstellung bei dieser Wiederholung ein
schlichter Blick zurückgeht und Deckungseinheit in schlichter Weise
erfassen sollte. Man kann doch nicht sagen, dass die angeblich schlicht
20 erfasste Deckungseinheit zum Thema wird, dass sie Explikation er-
fährt in dem Sinn, wie die Erfassung des Papiers als Gegenstand,
als Substrat, das Thema gibt für die weitere Explikation in „weiß“,
„viereckig“ usw.
Das zeigt sich ja auch daran, dass jede Explikation sich „entfaltet“
25 in Prädikation, wobei das Explikationssubstrat zum Subjekt wird und
die Explikate zu Prädikaten. Die angeblich schlicht erfasste Einheit
aber, die hier übergeführt werden soll in die entfaltete Einheit eines
Sachverhalts, wird nicht zum Subjekt und die Sachverhaltsbestand-
stücke zu Prädikaten. Aber ist dann so etwas wie Erfassung einer
30 schlichten Einheit nachweisbar? Wäre sie schlicht erfassbar, dann
wäre ja die Auseinanderlegung Explikation und es drohen unendliche
Regresse.
Ich muss also wohl einerseits sagen: I c h v e r bl e i be ni c ht i n
d e r b loß e n Ex p l i ka t i on , e s g e sc h ieh t e t w a s Ne u e s; und
35 andererseits ist sicher: Der Blick wendet sich zu der verborgenen

1 Cf. 7a = S. 128,20–130,15.
128 explikative und prädikative synthesen

Einheit, die Einheit, konstituiert im Prozess, der beiden Glieder ist.


Aber dieser Einheit sich zuwenden, das heißt, in geänderter Ein-
stellung den Prozess erneuern. Sie ist nichts, was in einer schlichten
Zuwendung erfasst werden, sondern nur im wiederholten Durch-
5 laufen in den Blick treten kann. Das wiederholte Durchlaufen fin-
det, sagte ich, unter geänderter Einstellung statt: I c h vol lz i ehe
n ic h t w i e der ei ne b l o ß b e tr a c h t en d e E xp li k at i on , so nde r n
ei n e p räd ik at ive Id ent i f i ka t i o n, und das ist ei n e rfa s s en des
B ew us st sei n sy nt h et i sc her Art. Synthetisch vollziehe ich die
10 Erfassung von G, und sie dient als Subjektion: Von ihr geht ein
bestimmendes „Identifizieren“ zu weiß. Der erfassende Blick lebt im
Identifizieren, im Erfassen des Ist, im Erfassen des Sich-Bestimmens
als weiß. Im Explizieren bestimmt sich das Objekt implicite als weiß,
nämlich es verdeutlicht sich, aber das „Sich-Bestimmen-als“ ist nicht
15 erfasst. Erfassend im Blick sich bestimmen kann nur, was explikativ
schon bestimmt ist. Das originäre Erfassen von „G ist weiß“ setzt die
Explikation voraus, und das als weiß explizierte G erhält die Funktion
des Subjekts und ist der notwendige Anfang für den prädikativen
Prozess, der nur verlaufen kann in der Form „G ist α“.
20 Danach ist das Erfassen des G jetzt ein anderes als vorhin. Al-
lerdings darf man nicht zuviel Wert darauf legen, dass das G von
vornherein als „weiß Seiendes“ an der Spitze einer Wiederholung
steht, obschon das wahr ist. Denn wenn wir bloß die Explikation
wiederholen, ohne Prädikation zu vollziehen, würde sich das ebenso
25 verhalten, und wir hätten noch keine Prädikation. (Man wird natür-
lich nicht verwechseln das als weiß verdeutlichte G und das attributiv
aufgrund einer Prädikation aufgefasste G, welches weiß ist.)1
Ein Zweifel: Wenn wir wiederholte Explikation vollziehen des-
selben Inhalts, so vollziehen wir immer wieder das Deckungsbe-
30 wusstsein, in dem sich doch die Einheit konstituiert. Warum sollte
da nicht schlichte Reflexion möglich sein auf die Einheit? Man kann
antworten: auf welche Einheit? Natürlich kann ich im schlichten Blick

1 Das explikativ Verdeutlichte steht als Verdeutlichtes da und wird zum Subjekt

der prädikativen Bestimmung. Dann aber ist es wieder als prädikativ Bestimmtes
charakterisiert, und vollziehe ich vermöge neuer Explikationen neue Prädikationen,
so kann ich „G, welches α ist”, oder Gα als Subjekt bilden. Wiederholt cf. 6a =
S. 126,21–128,19.
text nr. 8 129

auf die Verdeutlichungsübergänge gerichtet sein und kann sich dem


Blick die Einheitsform dieses Übergangs aufdrängen (genau so, wie
sich im wiederholten Übergehen von einem Ton zu einem anderen,
einem leiseren zu einem lauteren, die Form, die Form der Steigerung
5 leiser – lauter, aufdrängen kann und vorher schon das gesamte „a
leiser – b lauter“, der konkrete Übergang vom leiseren zum lauteren
Ton in seinem Typus vermöge dieser Form). Aber auf diese Form,
auf den Formcharakter eingestellt sein ist nicht, die bestimmende
Synthese vollziehen (die natürlich keine Explikation des Übergangs
10 in die Form ist).
Ich setze G und bestimme es als weiß: G ist weiß. Und das Ist
ist nicht eine bloße Form, die zwei Sachen in eins setzt, die Form
in jenem Übergang ist Form der Phänomene, des Phänomens des
zu Explizierenden, des Explikanden-Phänomens, und des Explikat-
15 Phänomens. Gesetzt ist aber in der Prädikation das G und die Be-
stimmung (die als solche ihre Form hat). Das G muss expliziert
bewusst sein, aber gesetzt ist es schlechthin als G, das identisch ist,
wie immer es expliziert werden mag. Andererseits gehört zu seiner
Form, dass es Explikand ist (nicht Explikand-Phänomen), und das
20 „weiß“ drückt das Explikat aus, aber nicht das Explikat-Phänomen.
Im Ist kommt die Form der Synthese zwischen Explikand und Ex-
plikat zum Ausdruck (und zwar jedes in seiner Form), und sie ist in
der Prädikation Bestandstück des ganzen, zur Setzung kommenden
„Sachverhalts“.
25 Der Sachverhalt, der im „Urteil“ gesetzt ist (freilich sprechen wir
hier nur von der prädikativen Synthese), ist darin ni cht s ch li c hte s ,
so n de r n s yn t h e t i s c h s i c h e r ze u g end e s un d e r zeu g t es
T he ma . Es i s t k e i n Ob j e kt e in es s ch l ic ht be t r a c ht e nde n,
s on de r n e i ne s s c h ö pf er i s c h e r ze u g e nde n Ak te s. In der
30 schöpferischen Erzeugung konstituiert es sich schöpferisch und wird
so erfasst (schöpferisches Erfassen). Nachher bleibt es eventuell noch
„im Griff“. Der Unterschied zwischen spontanem Ergreifen und
zuständlichem Im-Griff-Sein besteht auch hier. Ferner kann eine Re-
flexion statthaben, welche auf den synthetisch erzeugten und noch im
35 Griff seienden Gegenstand einen Blick schlichter Art wirft: eben den
Blick der S a c hv e rh a l t sr ef l e x i on. Di es e s „ s ch l i c h te E r f a s -
se n “ d e s S a ch v e rh a l ts i st a b e r ke i n or i g i nä r e s E r fa ss en ,
k ei n e G eg e b e nh e i t , e r „ w e i s t a u f e i n o r i g i n ä r e s E r f a ss e n
130 explikative und prädikative synthesen

z u rüc k “. D as gil t f ür a l le syn t h eti sc h s i c h ko ns ti t ui e r e n -


d en O bj ek t e, was ja nichts anderes sagt als für Objekte, die eine
originär synthetische Konstitution haben. Wie steht es bei ihnen mit
der Explikation?
5 Jede Explikation erfordert Rückgang auf originäre (artikulierte,
nicht „anschauliche“) Konstitution, und originäre Konstitution lässt
eine Einstellung der „schlichten“ Objektivation zu, welche, auf sie
zurückbezogen, die Teile und Momente „explizierend“ entnimmt. Ich
wiederhole etwa „S ist p“ und habe schon bei der Wiederholung die
10 Einstellung auf den Sachverhalt als „schlichtes“ Objekt. Wir sagen
da lieber, a l s S u bs t rat. I n d er or i gi nä re n Sa ch ver hal tse r fa s-
s un g i s t d er S a ch ver hal t n ic h t S u bs t ra t (im Sachverhalt treten
Substrate auf), aber in der Reflexion aufgrund wiederholter origi-
närer Sachverhaltserfassung wird er zum Substrat und kann dann
15 expliziert werden. In all dem scheint ein wesentlicher Fortschritt in
der Analyse wohl vollzogen zu sein. Aber ist nun alles schon völlig
durchsichtig? Verstehe ich schon aus dem Grund das synthetische
Bewusstsein in aller einfachen Prädikation?

§ 4. Das Verhältnis zwischen prädikativer und


20 beziehender Synthese. Das in der Erfassung und in
der Explikation waltende Absehen. Die Analogie
mit dem Abzielen und Erzielen im Willensgebiet

Zunächst muss scharf gesondert werden das synthetische Bewusst-


sein, in dem die Relation zwischen Ganzem und Teil bewusst wird,
25 in dem ein relationeller Sachverhalt sich konstituiert, gegenüber dem
synthetischen Bewusstsein, in dem sich ein nicht-relationeller prä-
dikativer Sachverhalt, ein Sachverhalt der Art wie „Dieses Papier
ist weiß“ konstituiert. Im G∩T- oder T∩G-Bewusstsein, in den be-
treffenden Übergängen erhält T bzw. G einen Charakter, es erfährt
30 Bestimmung. Und prädikativ heißt es dann „G hat als Teil T“, „T ist
Teil von G“. Besser: „G ist Ganzes von T“.
Parallel damit steht „Dieses Papier ist weiß“, „G ist α“ (wo α eine
innere Bestimmung ist). Das Teil-von, das Ganze-von sind „äußere“
Bestimmungen, relative. Das Weiß-Sein ist innere Bestimmung und
35 keine relative. Es hängt jetzt alles davon ab, den Unterschied ins
text nr. 8 131

Klare zu bringen. Das Gemeinsame ist Bestimmung. Das G erhält


in dem betreffenden Übergang eine Bestimmung; das G setze ich,
und in dem Bewusstsein der „Identifikation“, des Ist, erfasse ich das
Bestimmtsein. (Nämlich das G, als welches es da im Übergangser-
5 lebnis bewusst ist, ist das „Bestimmte“, und ich vollziehe nun die
„Id e nt if i kat io n“ dieses G mit der B est im m un g.)
Ebenso, das Papier wird gesetzt, nämlich die Setzung ist Unterlage
einer „Identifikation“ eines Bewusstseins der Ist-Einheit mit der Be-
stimmung weiß. Nun ist hier das Beirrende, dass man sich gedrängt
10 sieht zu sagen: Das Verhältnis von Papier und „weiß“ ist ein Teilver-
hältnis. Gehe ich vom auffälligen Weiß, das ich zuerst gegenständlich
gemacht habe, über zum Papier, ist das nicht in Bezug auf die Weiße
„Ganzes“? Nehme ich damit nicht ein Mehr in meinen Blick auf, ganz
ähnlich, wie wenn ich von dem Fuß des Aschenbechers übergehe zum
15 Ganzen?
Soll man danach sagen: „Das Papier ist weiß“ hieße soviel wie
„D a s Pa p i e r ha t W e i ße“? Wenn aber die Analyse lehre, dass
jede Relation, jedes Teilverhältnis auf Prädikatseite eine Bestimmung
hat, so ist damit das „größer als b“, „Teil von b“, „umfassend b“ etc.
20 gleichgestellt mit „weiß“, nicht mit „hat Weiße“, nämlich „umfassend
als Teil Weiße“. Sonst hätten wir ja einen unendlichen Regress. Das
„größer als b“, das „Teil von b“ ist gehabt, ist zukommend, und
wäre das Haben ein Teilverhältnis, so wäre auch das „größer b“ ein
Teilverhältnis, und wir müssten sagen, auch das „umfasst b“ besagt
25 „hat den Teil ‚b zu umfassen‘ “ etc. In der Tat, nach unseren Analysen
liegt das Teil-von-b-Sein am G als Bestimmung, als etwas, das G
genauso „ist“, wie es weiß „ist“. Und „G hat Weiße“ muss also
besagen „G ist Weiße habend“ und muss einen ganz anderen Sinn
haben als „G ist weiß“.
30 A b e r wi e kl ä r t s i c h nu n a l l d a s a uf, wie versteht sich der
schlichte Sinn des inneren Prädikats? Ich versuchte früher zu sagen:
Ein Teil ist ein Gegenstand für sich, ist „Objektiviertes“ (selbständi-
ges Thema). Eine Bestimmung ist nicht Objektiviertes, sondern nur
in Identifikation zu Habendes. Ich sehe freilich daraufhin, aber das ist
35 kein „Objektivieren“, kein Zum-„Gegenstand“-Machen. Sowie ich
es tue, was ich kann, habe ich eine Relation. Was ist daran Wahres?
U n d kan n j e de r T e i l zu r B e st i mmun g , j e de B e s t i m mu ng
z u m Te i l we r de n? Es ist nun die Frage nach dem Verhältnis
132 explikative und prädikative synthesen

zwischen prädizierender und relativierender (beziehender) Synthese,


zwischen prädikativem Sachverhalt und Beziehungsverhalt.
Jede Prädikation (das Wort so eng gefasst, dass ihr Korrelat ein
„primitiver“ kategorischer Sachverhalt ist), jede primitive prädika-
5 tive Synthese beruht auf Explikation. Man möchte sagen: Diese voll-
zieht sich doch im Übergang von Totalerfassung zu Partialerfassung;
es kommen also zur Deckung erfasstes Ganzes und erfasster Teil.
Bezieht also nicht ganz selbstverständlich jede prädikative Synthese
Ganzes und Teil aufeinander? Also z. B. „Dieses Papier ist weiß“.
10 Das Weiß ist doch in gutem Sinn Teil des Gegenstandes, näher, seine
Oberflächenfärbung ist Teil der konkret vollen Dingoberfläche. Also,
die prädikative Synthese in „Dieses Papier ist weiß“ ist gerichtet auf
das Subjekt als den Teil habend, und sie bezieht darauf das Prädikat:
den Teil.
15 Sollen wir also sagen (wie das Bo lz ano tut, vielleicht durch
analoge wie die sich hier darbietenden Motive bestimmt), der Proto-
typ der einfachen prädikativen Synthese sei am klarsten ausgedrückt
durch „A hat b“, und sollen wir zudem dies interpretieren durch „A,
das Ganze, hat den Teil“?
20 Um hier tiefer zu sehen, müssen wir tiefere Blicke in das Wesen
der Explikationen werfen. Wir haben sie zwar schon gründlicher
Analyse unterworfen, aber noch haben wir wichtige Momente nicht
zur Abhebung gebracht.
Wir haben bei jeder Explikation unterschieden Explikand und
25 Explikat.1 Das letztere kann wieder als Explikand fungieren usw.
Dabei aber besteht ein Unterschied: Es kann von vornherein die
Erfassungsform haben, die zu einem Explikanden gehört, oder erst
in die Form gebracht werden. Nämlich jeder Explikand hat solch
eine Form, und diese wächst ihm nicht erst im Zusammenhang der
30 aktuellen Explikation zu: als ob er zuerst ohne diese Form wäre
und erst, wenn das Explizieren des Objekts anginge, sie erwüchse.
Natürlich, eine solche ihm zuwachsende Form hat er auch, es ist die

1 Neu ausarbeiten, da die Form des Abgesehenseins, Thematischseins und die des

substantivisch Nominalen verwechselt ist. Vgl. die Blätter 1–3, die nachfolgen, mit den
Hauptbestimmungen zur Umarbeitung = Beilage IX: Schlichte explikative Betrachtung
gegenüber prädikativer Synthesis. Die Übergangssynthese als Grundlage der Prädikation
(S. 148).
text nr. 8 133

spezifische Form des Explikanden als solchen als eines Explikation


Erfahrenden. Aber es gehört zu ihm wesentlich eine schwer zu be-
zeichnende Form, es ist die des Bestimmbaren überhaupt und nicht
nur die des Erfassens als G ege nst an d, a uf de n es a b ge seh e n i st.
5 Es ist ein auf ihn in speziellem Sinn als Gegenstand Gerichtetsein;
in dem Erfassen waltet eine t he ore ti sc he (o bj e kt iv i e re nde )
„ A b si c ht “, ein Abgesehen-Haben und zugleich ein Erfassen als
Bestimmbares.1 Indem der Gegenstand das Abgesehene ist, expliziert
wird, vollzieht sich korrelativ in eigener Weise eine Entfaltung des
10 Absehens. E s z ei gt si ch , wa s im A b s eh en li eg t – es zeigt sich,
was im Abgesehenen liegt: Beides kann man sagen. Nun ist aber
das Wort „absehen“ gerade hier zweideutig, sofern man doch sagen
wird, dass bei einer Explikation das Explikat, das Herausgeholte, in
der Linie des Absehens, in seiner Richtung liegt und somit selbst ab-
15 gesehen ist. Und wenn doch in der Explikation ein besonderer Strahl
des Erfassens auf das Explikat geht, so wird man ebenfalls sagen,
es bestehe darin ein Gerichtetsein auf oder ein Abgesehen-Haben
auf das Explikat. Genauer besehen bestehen hier aber wesentliche
Unterschiede.
20 Von A b si c ht sprechen wir im Wil le n sg eb i et, und wir sprechen
da auch von Abgesehen-Haben-auf, von „eine Absicht haben“ =
einen Entschluss gefasst haben (freilich zuständlich und dispositio-
nal). Es ist ein Abzielen, das noch kein Erzielen ist, und andererseits
sprechen wir vom Erzielen selbst, die Absicht ausführen, den Ent-
25 schluss ausführen.
Es ist nun klar, dass das Abzielen, Absicht haben, und zwar das
Aktuell-sich-Entschließen phänomenologisch anders charakterisiert
ist als das Erzielen, obschon in diesem die Absicht fortgesetzt
„waltet“. Nun, hier haben wir eine genaue Analogie.2 Wir haben
30 eine bloß theoretische Absicht, wir haben ein Absehen auf einen Ge-
genstand. In der Explikation „waltet“ fortgesetzt das Absehen, aber
die explizierenden Sonderakte mit ihren Explikaten sind nicht selbst

1 Es muss scharf geschieden werden das Abgesehen-Haben und die Form des Be-

stimmbaren, die notwendig jeder Explikand haben muss und die ein Explikat even-
tuell annehmen kann, wenn es sie nicht hat.
2 Absicht, Abzielen und Erzielen im voluntativen Sinn und theoretischen Sinn

parallelisiert.
134 explikative und prädikative synthesen

in demselben Sinn absehende Akte, sondern in ihnen waltet Absehen


vermöge ihrer Deckung mit den abzielenden, nämlich Absehen auf
den Explikanden. Es ist vielleicht nicht ausgeschlossen, dass sie in
sich selbst ein Absehen implizieren, ein neues Absehen, aber das
5 ist dann etwas Besonderes und nichts dem Explikat Wesentliches.
Man kann hier wieder auf das Willensgebiet hinweisen. Der abse-
hende Wille kann sich „explizieren“, hier nämlich Ausführung erfah-
ren in einem erzielenden processus, der ungebrochen zum Ziel führt.
Ich will zum Rohns1 gehen und gehe in einem Zug dahin. Es kann aber
10 sein, dass der Wille zum Ziel, die Absicht, nur in gebrochener Linie
erzielbar ist (und im Verborgenen hat ihrem Wesen nach schon die
Absicht die Diskontinuitäten in sich) und erzielt wird. Es vermitteln
dann Akte, die selbst den Charakter von „Absichten“ – unterge-
ordnete, dienende –, von „Entschlüssen“ haben (Entschließungen).
15 So ähnlich hier. Das absehende Erfassen kann sich explizieren in
solcher Weise, dass die Explikat-Akte selbst wieder den Charakter
absehender haben.

§ 5. Schlichter thematischer Akt. Unterschiede


thematischer Richtung schon vor der Explikation:
20 singuläre und plurale thematische Intentionen

Dazu gehören aber wichtige weitere Überlegungen. Von einem


absehenden Akt in dem jetzigen ausgezeichneten Sinn sagen wir,
er setze einen Gegenstand thematisch. Den Ausdruck „thematische
Akte“ werden wir in einem weiteren Sinne nehmen müssen, nämlich
25 setzende Akte, deren Themata thematischen Zusammenhang haben,
worüber später mehr. Eine relative Rede ist das. Thematische Set-
zungen liegen voraus, und thematisch ist dann alles, was mit ihnen
thematische Zusammengehörigkeit hat.
Es ist nun zu beachten: Jeder thematische, ein thematisches Objekt
30 setzende Akt (ein thematisches Objekt: ein Was, das im ausgezeichne-
ten Sinne „Gegenstand“ ist) ist ein spontaner Akt, eine Spontaneität,
eine Tätigkeit der Freiheit – und doch ist es kein Willensakt. Thema-

1 „Der Rohns“ war ein beliebter Gasthof auf dem Hainberg bei Göttingen. – Anm.

der Hrsg.
text nr. 8 135

tisch auf einen Gegenstand als Thema gerichtet sein, ist nicht etwa
gerichtet sein willentlich auf Explikation. Das brauche ich gar nicht.
Ich werfe einen Blick des Interesses auf einen Gegenstand. Ich erfasse
ihn, aber ich gehe nicht in Explikation über, das heißt, ich bin nicht ge-
5 richtet auf mein Tun als ein reales bzw. zu realisierendes in der psycho-
physischen Wirklichkeit, während das, was zur Explikation wirklich
kommt, nur minimal das Thema entfaltet, geschweige denn, dass es es
erschöpft. Eine Tendenz auf Explikation ohne realisierende Objekti-
vierung, die ja schon theoretisches Interesse voraussetzt,1 mag beim
10 thematischen Erfassen vorhanden sein und mag bis zu einem gewissen
Maße Erzielung finden, aber wir unterscheiden diese Tendenz von der
theoretischen „Intention“, von der ihr zugrunde liegenden themati-
schen Richtung auf. Wir lassen das Willentliche nun außer Spiel.
Da wir den Ausdruck thematischer Akt erweitern werden in dem
15 Sinn, dass thematische Akte auch zusammengesetzt sein können aus
thematischen Akten, so wollen wir jetzt von s chl i c ht en t he mat i-
s c he n A kt e n sprechen, die in schlichter Weise auf ein thematisches
Objekt gerichtet sind (also nicht mehrere Akte mit sonderthemati-
schen Objekten enthalten). Ein schlichter thematischer Akt kann,
20 unbeschadet seiner Schlichtheit, nur ein einziges oder auch eine Viel-
heit von thematischen Objekten haben, und er kann im letzteren
Fall die Vielheit der thematischen Objekte in der Einheit eines sie
umspannenden Themas haben.
Man wird vielleicht sagen müssen, jeder thematischer Akt hat
25 zunächst ein Thema, aber dieses kann in seiner Einheit viel enthalten.
Aber wenn es auch zweifellos ist, dass jeder schlichte thematische
Akt zunächst auf eine Einheit geht, so ist darin ein Unterschied,
dass mitunter diese Einheit bloßer Durchgangspunkt für das Bündel
von eigentlichen thematischen Strahlen ist, die auf die eigentlichen
30 Objektthemata gehen, während in anderen Fällen, wie mir scheint,
die Einheit wirklich Thema ist und zugleich Durchgangspunkt für die
thematische Richtung auf gewisse ihrer Glieder.
Geben wir Beispiele. Wenn ich dieses Papier, dieses unbeschrie-
bene weiße Blatt Papier, mir ansehe, den Blick darauf richte, so ist
35 darin das Papier als Thema-Objekt gesetzt. Und es ist der thema-
tische Strahl ein einfacher. Es ist nur eines „gegenständlich“, eben

1 Wir kämen also auf einen unendlichen Regress.


136 explikative und prädikative synthesen

das Papier. Wenn ich, von der Höhe ins Tal blickend, Landstraßen
mit Baumalleen sehe, so kann das Absehen, das „Interesse“, auf die
Alleen gehen; ebenso sehe ich Ortschaften, und das Absehen geht
eben auf die Ortschaften: Sie mögen Komplexe sein von Bäumen,
5 von Häusern, und das gehört natürlich insofern mit zum Abgese-
henen, als es ein Ganzes von solchen Gegenständen ist, ebenso wie
vorhin zum Papier als Abgesehenem gehörte, dass es die Farbe, die
quadratische Form usw. hat. Aber demgegenüber gibt es n oc h ei ne
an d er e W ei se der Ri ch t u n g a uf di e All e e, auf die Ortschaften
10 usw. Die Allee ist z. B. eine Pflaumen-Allee. Und ich blicke hin (und
betrachte eventuell) mit dem Auge des Obstzüchters, des Pächters
und dgl. Dann geht das Absehen nicht schlechthin bloß auf die Al-
lee, sondern gleichsam Strahlen des Absehens, thematische Strahlen
gehen auf die Einzelheiten, auf die Bäume. Wieder anderes Beispiel:
15 Ich sehe meine Kinder herankommen. In einem Blick erfasse ich die
Gruppe, aber gerichtet bin ich auf die Einzelnen zusammen, und doch
nicht eigentlich auf die Gruppe, auf das Zusammen. Ein lebendiges
Bild interessiert mich als Ganzes und zugleich jedes einzelne Glied.
Mögen neben dem, worauf es uns hier ankommt, dem „theoretischen
20 Interesse“, auch Gefühle und dgl. vorhanden und maßgebend sein, in
welcher Hinsicht auch immer: Sicher ist, dass wir U n te rs c hi ed e
d e r t h e m a ti s c he n Ri c h t u n g h a b e n , un d z w ar sc ho n v or de r
E x p l i ka t i o n, schon im einfachen thematischen Erfassen.
In der Einfachheit einer thematischen Setzung können mehrere
25 und viele „thematische Strahlen“ sein.1 Ob das besagt, dass reell
viele unterscheidbare Komponenten unter dem Titel „thematische
Strahlen“ in die Einheit der thematischen Setzung eingeschmolzen
sind (als ein verbundenes Liktorenbündel sozusagen), oder ob das
Eingeschmolzensein ideell zu verstehen ist, und endlich, ob bald
30 das eine, bald das andere, das ist Sache besonderer Untersuchung.
Jedenfalls bezeugen sich hier Wesensunterschiede der thematischen
Setzungen, die sich ausweisen in Unterschieden der Explikation.
Die einen Fälle können wir leicht erledigen, nämlich wenn zu-
nächst eine Einheit, eine Gruppe erfasst wird und durch ihre Ein-
35 heit hindurch der thematische Blick auf die Einzelheiten geht, die
ausschließlich die abgesehenen sind: Dann ist eben das Thema das

1 Für Thema immer thematisches Objekt.


text nr. 8 137

Zusammen als Plural dieser Einzelheiten und nur das. Das besagt
nicht, dass das Zusammen ein singulärer Gegenstand ist, der die
Einzelheiten als Glieder in sich fasst, sondern dass wir hier statt
eines Themas viele Themen haben und nicht etwa die Vielheit, als
5 Einzelheit zusammengenommen, auch noch als Thema. Doch es ist
gut, näher auszuführen.
Wir sagen zunächst: Die thematischen Akte zerfallen in thema-
tische Setzungen eines singulären Themas und in thematische Set-
zungen mehrerer pluraler Themen, und dabei sprechen wir hier von
10 einfachen thematischen Setzungen, die in einer Setzung ein Strah-
lenbündel von thematischen Richtungen-auf haben und so mehrere
Themen als Plural. Die Explikation erfordert hier Sonderexplikation,
das heißt, jedes Thema muss Thema für sich werden in einer eigenen
Setzung und sich in einer eigenen Explikation explizieren. Aber all
15 diese Explikationen müssen sich in der Einheit eines Bewusstseins,
einer Zusammennehmung halten, sonst wäre jedes Thema zwar expli-
ziert, aber nicht die durch die Vielheit der Themen hindurchgehende
Einheit der thematischen Richtung expliziert.
Das ist freilich ein schwer zu beschreibender Punkt. Es ist ein Un-
20 terschied, ob eine plurale thematische Intention Explikation erfährt
oder ob ein Inbegriff Explikation erfährt, der plural zum einheitlichen
Thema gemacht ist, und durch dieses Thema hindurch thematische
Strahlen zu den Einzelheiten gehen. Andererseits aber waltet in der
pluralen Setzung doch eine Einheit, eine thematische Einheit, aber
25 nicht eine solche, die ein Thema, den Inbegriff, setzt (als singulären
Gegenstand).
Nehmen wir nun die Fälle, wo ein thematisches Objekt, ein singu-
läres, gesetzt ist, aber das Thema ist eine Ei nh e i t a u s me h re r en
The me n, auf die also mehrere thematische Strahlen gehen. Das sagt:
30 D ie Ex p li k a t i o n f o r d e r t h i er t h e m a ti s ch se t z e nde A kt e.
Ich bin auf die Allee, und das sagt auch, auf die Bäume der Allee
gerichtet, und diese Themata muss ich erst in eigenen thematischen
Akten erfasst haben und sie dann explizieren.
Die Explikation vollzieht sich also notwendig in Stufen derart, dass
35 die erste Stufe zwar expliziert, aber dabei zugleich schlichte themati-
sche Akte vollzieht. Ich sprach früher wiederholt von Zuhandensein
im Gegensatz zu Ergriffensein. Hier haben wir ein bestimmtes Zuhan-
densein: das Enthematischsein, Mittelbar-thematisches-Objekt-Sein.
138 explikative und prädikative synthesen

Im Thema (thematischen Objekt) sind vielfältige Themata i mp l i -


z iert: Das Thema hat eine thematische K om pl ex ion, aber der
thematisch setzende Akt ist nicht eine k o mp l e x e S pon ta ne i tä t; es
entspricht nicht jedem Enthema eine eigene es setzende Spontaneität,
5 ein eigenes Erfassen. Durch das thematische Objekt hindurch geht
ein mehrfältiges „Gerichtetsein“ (ein mehr oder minder deutlich
abgehobenes), ei ne Meh rh ei t v on e n t he m a ti s che n S tra hl en,
di e k ein e s po n t anen S e tz un ge n si n d, auf die Enthemen, auf
die thematischen Glieder. Der Gegenstand hat Glieder und ist seinen
10 Gliedern nach „gemeint“, aber die Setzung ist eine einfältige.

§ 6. Der Unterschied zwischen den Explikationen,


deren Explikate selbständige Themata sind,
und solchen, deren Explikate nicht als für
sich geltende Gegenstände gesetzt sind

15 Im Allgemeinen wird ein beliebiges thematisches Objekt – ein be-


liebiger abgesehener „Gegenstand“ – in verschiedenen Beziehungen
teilbar sein, z. B. ein Dinggegenstand, er wird verschiedene Gegen-
stände an sich unterscheiden lassen, die ihm eingeordnet sind, eben
als Teile. Aber damit ist nicht gesagt, dass die thematische Intention,
20 die Setzung als Thema, auf diese Teile enthematisch (also in beson-
deren „Strahlen“) gerichtet ist. Das setzt vielmehr einen besonderen
Bau des auf den Gegenstand als Thema gerichteten und durch dieses
Thema hindurch auf Partialgegenstände gerichteten Aktes voraus.
Es kann so sein, dass die Zuwendung zu dem Gegenstand G nur
25 Durchgangszuwendung ist, das heißt, dass G Thema nur ist um eines
„interessierenden“ Teiles, etwa der Form, willen: Sie ist das Motiv
der Zuwendung zu G, und die Explikation führt alsbald zu diesem
Motiv hin als dem „eigentlichen Thema“ (Zielthema). Hierbei kann
es sein, dass dieser processus insofern notwendig ist, als dass da s
30 be t re ff e nde T h em a n u r mi t t e lb a r e s s e i n ka nn, nämlich eine
Zuwendung zunächst zu dem G (oder überhaupt einem dasselbe
„Thema“ Habenden) führt. Doch sind die Fälle hier nicht ganz klar,
und es scheint mitunter, dass ein vorthematisches „Vorhandensein“
des G genügt. Es kann aber auch sein, dass die Zuwendung zu G nicht
35 bloß Durchgangszuwendung ist, dass vielmehr G selbstberechtigtes
text nr. 8 139

Thema ist und nicht bloß Medium für den Teil, der enthematisch
bewusst ist. Zum Beispiel, ich bin auf diesen Aschenbecher gerichtet,
und dabei fällt mir von vornherein sein eigentümlicher Fuß auf oder
zugleich zwei Füße, ein paar eigentümliche Buckel etc.
5 Es kann ferner sein, dass ein Gegenstand Thema ist mit den
oder jenen oder gar keinen herausgehobenen Enthemen, und d as s
im Lau f de r E xpl i k at i o n s ic h Ri c h t ung en a u f E nt he m en
e i n st ell en , d as s s ic h al s o da s t h em ati s ch e In te re ss e, d er
I n h al t der t h em at is c h e n S et z un g, ber e ich e rt u m e ig en e
10 e n t h em a t i sc he St ra hl en. Die Explikation hat dann in Beziehung
auf sie (oder die Erzielung) den Charakter eines schlichten setzenden
Aktes, der ein eigenes Thema setzt.1
Wir werden vielleicht genauer sprechen müssen. „Die schlichten
thematischen“ Akte, von denen wir hier immer sprechen, haben
15 das Eigentümliche, dass sie einen G ege ns t a nd f ür si c h setzen –
einen, der für sich selbst gelten will und nicht um eines anderen
willen –, dass sie etwas Gegenständliches als Thema für sich, a l s
h e r r s c h e nd e s (a u ch f r e i es abs o lu t es ) T he m a setzen. Ihnen
stehen gegenüber Akte, die nicht „Gegenstände“ oder Themen für
20 sich, sondern dienende Themen (Mittel-Thema, abhängiges) setzen.
Worum es sich mir hier vor allem handelt, ist, den Unterschied
zu klären zwischen den Ex p l i ka t i o ne n , in d en en di e E x pl i kat e
G e g e n st ä nd e f ü r s i c h, f re i e T h e ma t a s in d, un d s ol c he n, be i
d e n e n si e e s ni c ht s i n d.
25 Wenn ich ein Gruppenganzes expliziere und die auf die einzelnen
Glieder der Gruppe (Kegelpyramide, Baumreihe, Wald) gerichteten
Intentionen in Form von Einzelerfassungen expliziere, so sind die
Explikate freie absolute Themata und zugleich Partialthemata. Wenn
ich aber dieses Papier betrachte und auf die Farbe, Form etc. achte, so
30 haben diese Momente des Gegenstandes in der Explikation, also als
Explikate, nicht den Charakter von selbständigen Themata, sie sind
nicht als für sich geltende Gegenstände gesetzt.

1 Die thematischen Strahlen sind hier in der Einheit der thematischen Richtung

so charakterisiert, dass das, was sie treffen, wieder als Gegenstand „für sich“, als
herrschender gemeint ist. Das ist nicht bei allen thematischen Akten und thematischen
Strahlen der Fall. Siehe folgende Seite.
140 explikative und prädikative synthesen

Man wird sagen können, wenn ich einen schlichten Gegenstand


expliziere, der kein Enthema enthält, so wird auch im Voraus mancher
Richtungsstrahl auf Einzelheiten gerichtet sein können, und insbe-
sondere, wenn ich zu explizieren anfange, so liegen die Reize für
5 die Schritte der Explikation in voraufgehenden Richtungsstrahlen;
es hebt sich die Form, die Farbe ab, es drängt sich auf. Vielleicht kann
man sagen, dass „innerhalb“ der einheitlichen „Gesamtintention“,
d. i. der „Materie“ der einheitlichen thematischen Setzung, sich, noch
ehe ein eigener Setzungsstrahl ein Explikat herstellt, eine Abhebung
10 vollzieht, die schon eine Absonderung innerhalb der einheitlichen
thematischen Richtung bedeutet. Die thematische Setzung setzt das
Gesamtthema in dem „Sinn“, in dem es bewusst ist, und jede Abhe-
bung im Sinn besage zugleich in der Richtung-auf Besonderungen.
Aber dann ist i n d ies en im p li zi er te n R ic ht u ng e n e be n e i n
15 k a r di na l e r U nt e rsc hie d. Die eine ist Richtung auf ein selbstän-
diges Thema, auf einen Gegenstand für sich, die andere Richtung auf
etwas, in dem sich ein selbständiges Thema entfaltet derart, dass aber
das Explizierte nicht als etwas für sich gelten will. Unter allen Um-
ständen bleibt der Unterschied zwischen schlichtem Thema (und zwar
20 freiem und nicht gerade aus freien zusammengesetztem, überhaupt
keine freien Themata als Teile implizierend) und dem Gegenteil.
Kann man nun sagen: Ein schlichtes und einfaches Thema expliziert
sich in thematischen Akten, die keine neuen selbständigen Themata
setzen?
25 Jedes unselbständige Explikat (unselbständig als Thema) kann
aber in ein selbständiges verwandelt werden; es kann ein „eigenes
Interesse“ daran erwachsen, es wird zum selbständigen Thema und
expliziert sich dann in seiner Weise: So z. B. das Ding in einem unge-
gliederten thematischen Setzen betrachtend, durchlaufe ich die Farbe,
30 die Gestalt usw. Die Gestalt kann nun zum selbständigen Thema
werden, ich zergliedere sie nun als neues Thema usw. Dabei lehrt,
wie mir scheint, die sorgsame phänomenologische Analyse, dass der
betrachtende Blick auch Stücke, Glieder, die ihre Abhebung haben,
so durchlaufen kann, dass das Interesse für das Ganze das ausschließ-
35 liche bleibt und sich in dem Durchlaufen nur auslebt bzw. sich bloß
expliziert. Im Allgemeinen wird bei Stücken, die die Artung von Ge-
genständen haben, die normalerweise ein selbständiges thematisches
Interesse erregen, die Neigung groß sein, in selbständige thematische
text nr. 8 141

Erfassung überzugehen, und diese wird sich eventuell ganz verselb-


ständigen, sofern das Interesse für das Ganze fallengelassen wird,
oder dies ist nicht der Fall, dann ordnet sich die Explikation des Teils
der des Ganzen unter: In ihr vollzieht sich in zweiter Stufe die des
5 Ganzen.

§ 7. Die Explikation als bestimmendes


Übergangsbewusstsein. In ihr ist der Sachverhalt schon
vorhanden, aber noch nicht synthetisch erfasst. Explikation
und beziehende Synthese stehen nicht auf gleicher Stufe.
10 Der Unterschied zwischen Explikation von Eigenschaften
und der beziehenden Synthesis von Ganzem und Teil

Es scheint, dass wir da noch einmal das Wesen der Explikation


studieren müssen. Ich wende mich einem Gegenstand zu und halte
ihn im Einheitsbewusstsein fest, in seinem „Sinn“. Und nun wende
15 ich mich speziell seinen inneren „Eigenschaften“, seinen inneren
Bestimmungen zu und lege mir auseinander, was der Gegenstand
„ist“, ohne dass ich doch prädiziere. Ich lasse zunächst dahingestellt,
ob das Prädizieren nur hereinbringt das „begriffliche Fassen“.
Ist es nun nicht ein wesentlicher Unterschied, statt sich ausein-
20 anderzulegen, was der Gegenstand ist, vielmehr sich anzusehen, was
er an Teilen, Stücken, Momenten „hat“? Doch das ist zweideutig.
Sich auseinanderlegen, was der Gegenstand ist, reicht so weit, dass
es nicht nur die „inneren“ Eigenschaften, sondern auch die relativen
befasst, und so ist es auch ein Auseinanderlegen des Seinsgehalts des
25 Gegenstandes, wenn ich dem nachgehe zu bestimmen, was er hat:
Er ist besitzend diesen oder jenen Teil, ist in Relation zu dem und
jenem. Wir müssen daher vielmehr sagen: Es ist ein wesentlicher Un-
terschied, auseinanderzulegen, was ein Gegenstand ist, an sich oder
relativ, und damit ihn eigenschaftlich zu bestimmen, und andererseits
30 „Analyse“ zu vollziehen und die Teile herauszuanalysieren, die er
hat. Das Haben der Teile gehört in das, was er ist; die Teile selbst
aber sind seine Habe. Also, das Sein und die Habe, Explikation bzw.
Bestimmung und Analyse sind zu trennen.
Und im Besonderen auch stellen wir gegenüber, was ein Gegen-
35 stand an und für sich, also nicht in Bezug auf andere Gegenstände,
142 explikative und prädikative synthesen

betrachtet, ist, und auseinanderzulegen, was er an Teilen hat. Inner-


halb der Bestimmung (dessen, was ein Gegenstand ist) sagen wir: Es
ist ein Unterschied, einen Gegenstand durch irrelative, „absolute“
Prädikate bestimmen und ihn durch relative bestimmen, und es ist
5 nicht zu verwechseln innere Bestimmung durch „absolute Prädi-
kate“ und relative Bestimmung als Haben von Teilen und Momenten,
darunter durch vergegenständlichte Prädikate. Relative Bestimmung
konstituiert sich dabei komplizierter als absolute, wenn es richtig ist,
dass in der beziehenden Synthese dem Beziehungssubstrat ein Inhalt
10 zuwächst, der allererst durch Explikation daraus zu gewinnen ist.1
Aber das kann Bedenken erregen. Überlegen wir näher.
Wir wenden einem Gegenstand ein thematisches Erfassen zu und
explizieren in der bekannten Weise, dabei spontan verfahrend: das
Objekt im Griff behaltend und in Sondererfassungen es verdeutli-
15 chend.2 Das ist also das explikative Einheits- und Übergangs-
Bewusstsein. Wir können schon sagen: Im Explizieren, in diesem
Übergang, „bestimmt sich“ das Objekt, das als Substrat ausgezeich-
net ist, nur dass kein synthetisches Erfassen vollzogen ist, das der
Einheit in der Bestimmung zugewandt ist und den Sachverhalt zur
20 originären Erfassung bringt. Wir sagen also, das explizierende Be-
wusstsein ist ein bestimmendes Bewusstsein, ein bestimmendes Ein-
heitsbewusstsein im Übergang. Es wird die Frage sein können, ob
nicht jedes Einheitsbewusstsein im Übergang bestimmend ist.
Wir sprachen bei dem explikativen Übergang von einer Deckung
25 der nominalen und thematischen Intention auf das Objekt und der
verdeutlichenden Intention (= Erfassung). Sie konstituiert die Ein-
heit, die nachher in Form der prädikativen Synthese substanziale
Erfassung finden kann. Und wesentlich ist bei ihr, dass das thematisch
Gesetzte im Griff bleibt als Festgehaltenes; nur dadurch verdeutlicht
30 sich die thematische Setzung in der Explikat-Setzung.

1 Die aufgegebene Lehre.


2 Versuch, explikative und beziehende Synthese auf gleiche Stufe zu stellen und die
letztere in sich selbst als bestimmend anzusehen, also in gleicher Weise unmittelbar
als bestimmend anzusehen, wie es die explikative ist: so dass die Erfassung von Sach-
verhalten beiderseits in derselben Weise vonstatten ginge. Diese Ansicht wird aber
weiterhin widerlegt, cf. 17a ff. = S. 144,9 ff..
text nr. 8 143

Gibt es nun nicht noch andere Weisen einer Konstitution von


Einheit im Übergang von einer thematischen Setzung, die in Fest-
haltung übergeht, in einen anderen thematischen Akt (der bei der
Explikation kein Thema „für sich“, kein Selbständiges, setzt); und
5 sind diese Übergangssynthesen in demselben Sinne bestimmend, wie
es die explikative Synthese ist, oder werden sie erst in bestimmende
umgewandelt, wodurch eben eine „Bestimmung“ als Explikation
hereinkommt? Am nächsten steht der besprochenen Explikation der
synthetische Übergang von einem Gegenstand zu einem Glied oder
10 Teil.
Müssen wir nicht auch diesen Übergang als bestimmenden be-
zeichnen, nämlich sofern wir sagen dürfen, dass der Sachverhalt
„G hat T“ in eben derselben (und nicht in komplizierterer) Weise
aufgrund des synthetischen Übergangs zur artikulierten Erfassung
15 kommt wie der Sachverhalt „G ist α“ in der Explikation? Dann wäre
α ein Explikat, aber in „hat T“ = „ist T habend“ wäre das „T habend“
kein Explikat. Das Gemeinsame beiderseits wäre Bestimmung. Das
„ist“ würde (und ebenso seine grammatischen Äquivalente) die Syn-
thesis der Bestimmung in ihrer Erfassungsform ausdrücken.1 Ebenso
20 hätten wir die „Umkehrung“ der beziehenden Übergangssynthese
von Ganzem zum Teil als beziehende Übergangssynthese von Teil
zum Ganzen. (Die Explikation hat keine Umkehrung, und zwar ein-
fach aus dem Grund, weil zwar das Explikat wieder zum Explikanden
werden kann, aber niemals die Explikation des Explikats B von A
25 auf ein Explikat führen kann, das identisch ist mit A selbst. Es ist das
ein Sachverhalt, der sich umwenden lässt in den, dass der Teil eines
Teils niemals das Ganze sein kann.)
Auch die Übergangssynthese von Teil zum Ganzen wäre also un-
mittelbar bestimmende Synthese und wieder ebenso die Übergangs-
30 synthesis der Vergleichung, besser der Gleichheit, der Steigerung,
der räumlichen Lage, der zeitlichen Folge usw. Man kann nicht sa-
gen, jedes Übergangsbewusstsein, das mit einer Setzung und Festhal-
tung angeht bzw. fortgeht, sei schon ein bestimmendes Bewusstsein
oder Einheitsbewusstsein im Sinne eines „Einheit der Bestimmung“
35 „Konstituierenden“ (vorhanden Machenden): Denn die Zusammen-
nehmung ist keine Bestimmung.

1 A ist grün, A ist nicht „grüne Farbe“, ist nicht Grüne.


144 explikative und prädikative synthesen

Vielmehr gehört es zum Wesen gewisser Erfassungen, ihrer Mate-


rie nach, dass sie im Übergang synthetische „Einheit“ stiften, und die
Einheit wäre, wenn die versuchte Ansicht richtig ist, immer Einheit
der Bestimmung (von Sich-Bestimmendem und Bestimmtem). Zum
5 Wesen der Materie eines schlicht und für sich thematisch setzenden
Aktes gehört es, dass Explikabilität, und bestimmte, besteht; zum
Wesen der Materie von G und T gehört die Synthese der Bestimmung
des G als T habend und diejenige des T als Teil seiend usw.
Indessen, ist die versuchte Ansicht (wiewohl sie sehr bestechend ist
10 und ich ihr auch zunächst unterlegen bin) nicht unrichtig?1 Das heißt,
es geht nicht an,2 „Explikation“ und Synthesis der Beziehung auf
gleiche Stufe zu stellen und beide in gleichem Sinne als bestimmend
zu bezeichnen. Womit gesagt wäre, dass die Sachverhaltskonstitution
sich bei beiden in gleicher Art und Einfachheit vollzieht.
15 Vielmehr ist zu sagen: Die Explikation entfaltet in sich selbst,
was der zu explizierende Gegenstand ist; es fehlt nur die auf den
Sachverhalt bezogene, ihn originär erzeugende Erfassung. Der Sach-
verhalt liegt schon bereit, ist unmittelbar schon vorhanden in der
explikativen Übergangssynthese, nur ist er nicht erfasst.
20 Anders in der toto-partialen Synthese, zunächst in der (nicht ohne
weiteres mit ihr identischen) Hat-Synthese, und ebenso in jeder an-
deren beziehenden Synthese. Im beziehenden Hinblick von A auf
B findet eine je nach den Wesen der A B (bzw. nach Art der Rela-
tion) verschiedene „Synthese“ statt, eine gewisse Verknüpfung und
25 Überschiebung. Aber eben dadurch erhält das A einen „Charakter“,
das heißt, es erfährt eine Sinnesbereicherung, und nun kommt es
zur Bestimmung, wie es in der nicht so vermittelten Explikation zur
Bestimmung kommt. Das durch den Übergang bereicherte A erfährt
Explikation in Hinsicht auf die Bereicherung (die originär nur durch
30 den Übergang „erwachsen“ kann). Und wie bei jeder Explikation, so
entspringt durch passende Blickrichtung das Erfassen des Sachver-
halts „A ist ρ B“ (A ist Teil von B, ist größer als B etc.). Wir haben
also zweierlei Bestimmungen, zweierlei Explikationen, wie wir auch
sagen können, voneinander zu unterscheiden:

1 Falsch.
2 Nur, wenn ich die falsche Ansicht noch einmal überlegen will.
text nr. 8 145

1) in gewissem Sinn unmittelbare Explikationen, innere Explika-


tionen (Eigenschaftsexplikationen), irrelative, absolute;
2) in gewissem Sinn mittelbare (nicht zu verwechseln mit jener
Mittelbarkeit, von der oben die Rede war, wonach das Explikat
5 wieder Explikand wird), wir sagen besser, äußere, durch Beziehung
vermittelte, relative, bei welchen der Explikand, ehe er noch als sol-
cher schon fungiert, auf ein zweites Thema bezogen und der infolge
dieser Beziehung bereicherte Explikand hinsichtlich der Bereiche-
rung expliziert wird. Gewöhnlich vollzieht sich eins in Verbindung
10 mit dem anderen, zuerst wird innerlich expliziert, dann bezogen und
wieder expliziert.
Alle Bestimmung liegt in Explikation, die ihrem Wesen nach über-
all einerlei ist, nur ihren Wesensvoraussetzungen nach die bezeich-
nete fundamentale Verschiedenheit hat. Die Hat-Synthese gehört
15 zu den beziehenden und steht nur in der eigentümlichen Relation
zu der explikativen Synthese, dass a priori jedes Explikat, wenn es
nicht schon selbständiges Thema ist, zu verselbständigen ist und dann
Explikand und Explikat in Bezug gesetzt und eine neue Explikation
(die teil-relative) etabliert werden kann.
20 Wichtig ist dabei zu sehen, dass nicht das bloße Verselbständi-
gen des Explikats schon eine relationelle Synthese herstellt (wie ich
ursprünglich gemeint habe), wofern man unter Verselbständigung
nichts weiter versteht als dasjenige Objektivieren, das jeder mögliche
Explikand haben muss. Vielmehr gibt es eine andere Verselbständi-
25 gung, die in der „Gegenüberstellung“ liegt, als Gegensatz der expli-
kativen Entfaltung. Im Beziehen gehen wir über A hinaus (nicht in
A hinein) zu B als einem zunächst fremd und für sich Genommenen.
Im Explizieren gehen wir in A hinein und bleiben im Leben des A.
Die explikative Synthese ist Synthese, sofern sich die beiden
30 „Glieder“ „decken“. Dabei ist A „mit sich selbst identisch“. To-
tal verschieden ist die Deckung in der relationellen Synthese. In
gewissem Sinn, aber in ganz anderem und eigentlicherem, ist auch
da Deckung und bei allen Relationen. Im Übergang legt sich das
Ausgangsglied der Synthese auf das Endglied, es bezieht sich darauf:
35 Es genügt nicht, beliebig die beiden Glieder zusammenzubringen
(unter Festhaltung des ersten etc.), sondern in gewisser Weise muss
im Übergang eines mit dem anderen zur „Einheit“ gebracht wer-
den.
146 explikative und prädikative synthesen

Doch haben wir hier große Unterschiede, und gegenüber dem All-
gemeinen dieses Sich-Aufeinanderlegens „im Beziehen-auf“ besagt
auch Deckung eine allgemeine Eigentümlichkeit gewisser Synthesen,
wonach ein „Gemeinsames“ das Band der Vermittlung und Korrelat
5 der Deckung ist. Und die relationellen Synthesen zerfallen danach in
Deckungssynthesen im eigentlichen Sinn und Verknüpfungssynthe-
sen (bzw. die Relationen, wie schon Le i bn iz gesehen hat, in Relatio-
nen der Verbindung und Relationen der innerlichen Beziehung, Re-
lationen der Vergleichung: Vergleichen wir A mit B, so ist A Ganzes
10 und B Teil oder umgekehrt, oder es besteht ein anderes mittelbares
Teilverhältnis. Ferner, im Vergleich mit A ist B größer, intensiver; die
Vergleichung ergibt natürlich Gleichheit und Verschiedenheit, auf
der anderen Seite stehen Abstand, Ordnung etc.).
Formal haben alle relationalen Synthesen eben dies gemeinsam,
15 dass sie „Gegenstände“ selbständiger Themata für sich zur beziehen-
den Einheit bringen. Und darin stehen alle der explikativen Synthese
gegenüber. Während jede Relation ihre umgekehrte hat, entbehrt die
Explikation der Umkehrung. Jede Relation hat mit ihrer Umkehrung
das „Fundament“ gemein, nämlich sie entquellen aus demselben
20 gattungsmäßigen Wesen der Beziehungspunkte (bzw. phansisch der
Materie der beziehenden Akte und ihrer thematischen Unterlagen)
und sind selbst gattungsmäßig verwandt.
So ist ferner die Explikation, die Eigenschaften des Gegenstan-
des im engsten Sinne expliziert (innere Beschaffenheiten, die dem
25 ganzen Gegenstand zukommen, in denen er als ganzer und nur in
seiner Ganzheit für die Synthese in Aktion tritt), von Explikatio-
nen, die Teile hervorheben, wohlunterschieden. Die „metaphysischen
Teile“ B r en ta n os als sich ganz und gar durchdringende Momente
des Gegenstandes sind solche Eigenschaften: Hier ist die explikative
30 „Deckung“ die allerinnigste, es ist gewissermaßen das allerintimste
„Ist“, was da herauskommt. Indem ein „metaphysisches“ Moment
expliziert wird, eint sich damit jedes andere „metaphysische“ Mo-
ment ganz und gar und so der Gegenstand selbst in seiner voll um-
fassenden Ganzheit. Wenn wir solche Momente herausheben als
35 metaphysische Teile und sie als Teile dem Gegenstand als ganzem
zusprechen, so vollziehen wir eine Relation, die aber wie jede Teil-
relation voraussetzt die ursprüngliche Explikation. So ist sie, phäno-
menologisch gesprochen, konstitutiv für die metaphysischen Teile.
text nr. 8 147

Wie steht es aber mit G a t t u n g s m o m e n t e n? Sie sind wesentlich


mittelbare, in mittelbarer Explikation aufgrund metaphysischer Teile
sich konstituierende. Also, das ist wieder eine Charaktereigenart.
Dann weiter S t ü c k e. Es will mir immer wieder scheinen, dass die
5 Rede mit „hat“ bald relativ, bald bloß explikativ orientiert ist. Bei
der eigentümlichen Wesenslage ist es begreiflich, dass die Ausdrucks-
formen nicht gesondert sind. Wenn ich sage „Im Sack ist ein Apfel“,
„Er enthält einen“, „Er hat einen“, so ist das eine Relation.
Was macht also das „Eigenschaft“-Sein?1 Man sagt, „Eigenschaf-
10 ten durchdringen sich im Gegenstand“; das kann uns leiten. Wenn der
Gegenstand sich expliziert, indem er in der Explikation seine inneren
Eigenschaften entfaltet, so ist an dieser Deckung der Gegenstand
ganz und gar, d. h. nach seinem gesamten Sinn, mit dem er thematisch
gesetzt ist, beteiligt. Er deckt sich ganz, nach allem, was er ist und hat,
15 mit dem Besonderen, was da als ein Ist hervorgehoben ist; so beim
Dinggegenstand: Farbe (Gesamtfärbung), Gestalt und dgl.
Wenn die Betrachtung aber auf einen „bloßen Teil“ stößt, wenn
der Blick auf diese Glanzstelle für sich geht oder auf diesen Fuß
oder auf diese Seitenfläche (als Form) für sich, so findet eine Parti-
20 aldeckung statt. Da ist die Synthese eine andere. Ein Teil des Sinnes
bleibt außer Aktion oder bleibt ungedeckt. Im Ganzen, im Gesamt-
sinn lebend, durchlaufe ich seine Sinnesschichten sozusagen, die sich
durchdringen: so, wenn ich Eigenschaften expliziere. Wenn ich aber
auf Teile gehe, so ziehe ich Schranken, ich verenge den Sinn, und
25 in umgekehrter Richtung erweitere ich ihn. Und das bekundet sich
auch ohne „Beziehen“. Von Eigenschaft zu Eigenschaft übergehen
ist nicht das Ganze fahrenlassen und bloß „festhalten“.
Durchlaufe2 ich bloß explizierend, bloß die Sinnesschichten lüf-
tend, das Ganze, so vollziehe ich eine kontinuierliche Modifikation
30 an der Erfassung des Ganzen, eben die der Verdeutlichung, der Her-
vorhebung, Betonung, Erleuchtung der Komponenten. Es ist klar,
dass der Fall radikal anders liegt als bei der beziehenden Synthese,

1 Eigenschaft als unselbständiges Explikat, und zwar ursprünglich unselbständig;

andererseits charakterisiert durch die Eigentümlichkeit der explikativen Deckung.


2 An den Rand des folgenden Textes bis ungefähr S. 148,5 hat Husserl ein „Nota

bene“ geschrieben, darunter steht eine Null. – Anm. der Hrsg.


148 explikative und prädikative synthesen

speziell bei der Synthesis von Ganzem und Teil, die oft durch das Hat
ausgesprochen wird. Wenn ich, im Sinn des Ganzen lebend, ihn aus-
einanderlege, bloß „durchlaufe“, verdeutliche, so fasse ich keine Teile
heraus und stelle sie nicht dem Gegenstand als Ganzen beziehend
5 gegenüber. Ich könnte die Einheit der Körperlichkeit durchlaufen
und dabei den Fuß treffen und durchlaufen, ohne doch den Fuß
abzugrenzen und für sich zu vergegenständlichen. Ich lebe im Ganzen,
in der ganzen Körperlichkeit, in der ganzen Färbung, Formung usw.
und tue das, indem ich die Linien, Flächen etc. durchlaufe, wobei aber
10 immer die Intention durch das Explizierte auf das Ganze geht, und das
Ganze, wie ich es ja auch immer beschrieben, sich im Sondererfassen,
Betontsein, Klären verdeutlicht.
Aber vollziehe ich nicht „Sondererfassungen“ als neue Akte?
Gewiß, aber keine Beziehungen. Man wird sagen: Ja freilich, es fällt
15 bald die Umrandung mir auf, bald die Färbung, ich lebe bald in dieser,
bald in jener. Aber ich lebe gleichwohl im Ganzen.1 Wenn das auch
Sondererfassungen sind, so huschen sie sich gleich ins Ganze ein,
verschwinden darin und bilden nicht etwa eine Synthesis der Deckung
zweier sich aufeinander beziehender, einander gegenübergesetzter
20 Gegenstände. Es ist nicht so wie bei der beziehenden Hat-Synthese,
dass ich Ganzes und Teil gegenüber habe, dass ich zwei Akte der
Erfassung habe, jeder „extra“ etabliert, der eben vollzogene, seinem
Sinn nach festgehaltene und mit dem zweiten für sich vergegenständ-
lichenden Akt zur Synthese gebracht, verbunden zu einem syntheti-
25 schen Bewusstsein eben der Beziehung.

Beilage IX
Schlichte explikative Betrachtung
gegenüber prädikativer Synthesis. Die
Übergangssynthese als Grundlage der Prädikation2

30 Wenn ich mich in irgendwelche Explikationen ganz vertiefe und über sie
reflektiere, so finde ich, dass man unterscheiden muss:

1 Das hat mich immer bestochen. Eben damit habe ich auch noch kein Ist, also

keinen Sachverhalt. – Ja, aber das liegt daran, dass eben keine spontane Synthese,
keine prädikative, statthat, und das gilt für das Ist so wie für das Hat.
2 Wohl September 1911. – Anm. der Hrsg.
beilage ix 149

1) d a s s c h l ic ht e B et ra cht e n ( die r ei n e R ez ep t iv it ät, natürlich


s p on t a n, ist dann das E rf a s se n des Sich-Darbietenden, aber weiter nichts).
Das G ist erfasst und bleibt festgehalten, auf seinem Grund bewegt sich
fortgesetzt das neue Erfassen, das immer neue „Explikate“ erfasst. Dieses
5 kontinuierliche Ineinander ist keine „Synthese“, kein Sich-Decken, Sich-
Aufeinanderlegen, Sich-zur-Einheit-Bringen, sondern kontinuierlich einheit-
liches Sein.
In der Sphäre dieser schlichten Betrachtung bestehen zwischen den Expli-
katen der Weise nach, wie sie dem G einverleibt sind, wie sie eben Explikate
10 sind, allerlei formale Unterschiede, die Unterschiede der Explikation ver-
schiedener Stufe: also Unterschiede der Explikation, die direkt aus G etwas
verdeutlicht oder die in zweiter Stufe aus dem Herausgehobenen wieder
etwas heraushebt. Dabei aber ist zu beachten, dass in der Sphäre der schlich-
ten Betrachtung weder von einem prädikativen Subjekt der Bestimmung
15 noch von einer prädikativen Bestimmung die Rede sein kann. Das G ist das
h er r s ch e nd e S u b st ra t der Betrachtung (das entspricht dem Subjekt), und
das in der Betrachtung Herausgehobene ist, in zweiter Stufe wie in erster
Stufe, eben als herausgehobenes Explikat (das entspricht dem Prädikat)
in eigentümlicher Weise im Bewusstsein einig mit dem festgehaltenen G.
20 Das Explikat, das selbst wieder „Analyse“ erfährt, erhält in dieser neuen
Explikation allerdings den Charakter eines Explikanden, eines Substrats,
aber eines untergeordneten, seine Explikate den von mittelbaren Explikaten
von G. Also, diese Formunterschiede bestehen, aber innerhalb der Expli-
kate einer, etwa erster Stufe finden wir keine Formunterschiede mehr: doch
25 „herrschendes Substrat“ usw. Zum Beispiel das Rot wird an diesem Papier
in erster Stufe explizit erfasst, ebenso aber der schwarze Strich, der Klecks
auf ihm. (Aber in der Weise, wie das eine und andere für die Explikation des
„Substrats“ fungiert, ist doch ein großer Unterschied.)
2) V o n d e r E x pl ik a t io n a ls s ch li ch t er e xp liz ier e n de r B et r ac h-
30 t ung ha ben wi r s ch a rf zu u n te rs c he id e n die pr ä d ik ati ve S yn t h es e
al s e in e Sp o nt an e it ä t h ö he r e r St u fe. Das G wird zum Subjekt der
Bestimmung (der Prädikation), und das Explikat verwandelt sich in der
oder jener Weise in Bestimmung, in prädikativ gesetzte Bestimmung, in
„Me r k ma l e“, in das im Sachverhalt prädikativ gesetzte Merkmal. Aus dem
35 Substrat der Betrachtung wird i n b e zie h en d er S etz u n g das als Subjekt
Untergesetzte, worauf sich die Erfassung des in Hinblick auf das Explikat
sich konstituierenden Merkmals als des Daraufhin-Gesetzten, Übergesetz-
ten, gründet (daher das Wort „Gründung“).1

1 Beziehen: 1) der Übergang in die Explikation; 2) Untersetzung und Daraufsetzung,

Setzung des im Einheitsbewusstsein mit sich selbst einheitlichen, neu erfassten G in


150 explikative und prädikative synthesen

Hier haben wir nicht mehr das bloß kontinuierliche Einheitsbewusst-


sein, sondern den beziehenden Übergang von G-Setzung oder, sagen wir
einfacher, G-Erfassung zur Explikat-Erfassung, und hier erwächst erst die
synthetische Einheit zwischen Subjekt und „Merkmal“, Bestimmung. Dabei
5 hat in dieser Synthese G nicht nur passive Erfassung erfahren, sondern es
ist als selbständiges thetisches Objekt, nominales, und zwar Subjekt gesetzt;1
und was die Explikate anlangt, so scheiden sie sich: Die einen fordern ihrem
Wesen, ihrer Materie nach ebenfalls formale Fassung als selbständiges Thema
(nominal), die anderen adjektivische Fassung.2 Die letzteren einigen sich mit
10 dem Subjektthema als innere Bestimmung, als „G ist weiß“, die anderen als
Gehabtes mit dem Habenden, „G hat T“. Und sofern jedes adjektivisch zu
Fassende auch nominal-substantivische Fassung erfahren kann, ist jedes „G
ist α“ in „G hat A“ zu verwandeln.
Vielleicht ist nun noch folgender Unterschied zu machen: Setze ich G als
15 nominales Objekt, und wende ich den beziehenden Blick auf das Explikat
weiß, so erhält es die Setzungsform des „Merkmals“ (das adjektivische) am
G, und man kann vielleicht sagen, dass es ein Unterschied ist, den Blick auf
das Merkmal am G zu richten und im beziehenden Durchlaufen den Blick
zu richten auf „G ist α“.
20 Ich werde geneigt, immer mehr in die Explikation, und überhaupt in
die betrachtende Kenntnisnahme hineinzulegen gegenüber der eigentlichen
Prädikation. Schon dort: die nominale (substantivische) Form und das Ad-
jektivische, das an dem Träger, der dadurch als „Subjekt“ charakterisiert
ist, ist; ebenso hier schon der Unterschied zwischen Prädikation und At-
25 tribution – vor der Prädikation?! Wa s b r in gt als o d ie P r äd ik a tio n ,
un d zw a r a u ße r d e m Be gr e if e n, N e ue s he ra n? Betrachte ich einen
Gegenstand, so ist der ausgezeichnet bewusst als Explikand, der immer rei-
chere „Bestimmung der Explikation“ erfährt. Dabei erfährt er das, indem
er in der Erfassungsweise in gewisser Art zurücktritt. Das starke Licht der
30 „Aufmerksamkeit“ fällt auf das jeweils neue Erfasste. In der eigentlichen
Konstitution des prädikativen Sachverhalts fordert die Erfassung des Sub-
jekts des Sachverhalts als solches die „Aufmerksamkeit“, die Setzung im
vollen Licht. Und wenn das S vorher erfasst war und nun bloß festgehalten
ist, dann muss der Blick dahin zurückkehren.

der Form des hauptsächlichen Gegenstandes und Darauf-Setzung des „an ihm“, der
Bestimmung im synthetischen Bewussten des „ist“.
1 Das alles aber schon im Explizieren.
2 Die Materie der Explikate, das sind wohl die ursprünglichen Kerne.
beilage ix 151

W as g eh ö rt w es e n t li ch a ls V orb e d in gu n g z ur eig en tli ch en


K on s t it u t i on e i ne s S a c hv erh a lt s? Wir können sagen: Es muss ein Ge-
genstand (eventuell ein Inbegriff) als Träger logischer Akzidentien bewusst
sein oder vielmehr, im einfachen Fall, eines Akzidens. Dieses Bewusstsein
5 ist Voraussetzung der prädikativen Synthese, aber nicht sie selbst. Die lo-
gische Substanz trägt das Akzidens, ist in der Bestimmung durch dasselbe
bewusst, aber es ist nicht bewusst „S ist P!“. Es ist nicht der Träger als
Subjekt des Sachverhalts gesetzt und daraufhin gesetzt, dass es das P ist,
dass es in dem Akzidens ist. Wie kommt aber ein Gegenstand dazu, als
10 Träger eines Akzidens bewusst zu sein? Das ist ein Gegenstand nicht ohne
weiteres. Er kommt dazu im Übergangsbewusstsein, im beziehenden Be-
wusstsein, in dem eine bestimmende synthetische Einheit sich vollzieht,
aber noch keine prädikative. Dabei ist die Frage, ob ein bestimmter Ver-
lauf des Übergangsbewusstseins vorgezeichnet ist, und wie gestaltet es sein
15 muss.
Zum Beispiel, es fällt mir während des Spaziergangs eine prächtige
Herbstfärbung auf. Es fragt sich, ob ich vorher das Konkretum erfasst haben
muss; aber wenn schon das, ob ich es festhalten muss. Mein „Interesse“
ist vielleicht dem Baum zunächst gar nicht zugewandt, und so findet kein
20 Festhalten im Interesse statt (kein thematisches Festhalten), die schöne Farbe
allein erfasse ich. Wenn ich nun aber zum Baum zurückkehre oder nun
ihm ein thematisches Interesse zuwende, so steht er als Träger der schönen
Färbung da. Es scheint klar, dass ich hier nicht den Übergang habe von
einem interessierten Erfassen des S zu dem P (ich brauche nicht interes-
25 sierte Betrachtung des S von vornherein zu üben), sondern es genügt,
dass ich überhaupt von S (das ich flüchtig, uninteressiert betrachte) zu P
übergehe und vielleicht, dass ich nur P wirklich erfasse und dann zu S
übergehe. Es genügt der Übergang also von P zu S, um an dem S das P
in der Form des Akzidens zu finden oder um Sp zu haben. P sei dabei ein
30 Moment.
Handelt es sich um Relationen, so mag ich zuerst B erfassen und dann
übergehen zu A, B festhaltend. Nun mache ich aber A zum Subjekt: Es steht
schon als Träger da, zum Beispiel, ich erfasse erst das Dünne und gehe über
zu einem Dicken, und nun wende ich diesem das Interesse zu, und es steht als
35 dicker da. Oder es fällt mir ein Objekt auf, und dann erblicke ich ein anderes
Objekt (über ihm) und dieses mache ich zum Subjekt und erfasse an ihm das
Höher. Zum Wesen eines solchen „Übergangs“, einer solchen beziehenden
Synthese gehört, dass das Ende, das Ergebnis der Synthese, das ist, dass
jedes der synthetisch verbundenen Objekte Träger ist eines akzidentellen
40 Charakters; und es kommt nun darauf an, welche „Stellung“ ich einnehme,
ob ich das Objekt, bei dem ich übergehend terminiere, als Subjekt fasse oder
152 explikative und prädikative synthesen

das Ausgangsobjekt, zu dem ich aber nun zurückkehren muss, um es zum


Subjekt machen zu können: wodurch es aber selbst wieder terminus ad quem
wird.
Das ist also das eine, das zu studieren ist, di e A rt , w ie d ie Ü b er g an gs-
5 s y n th e se d er P r ä di ka ti on z u g ru n d e l ie gt, wie ihr Erzeugnis das Sub-
strat (der Träger) mit dem Getragenen ist und wie au s d e m T r äger d a s
S u b je k t d e r U r t e ils s e t z u n g w i rd. Wenn wir öfters sagen, durch die
Übergangssynthese hat das Ausgangsglied etwas erfahren, so müssen wir
ebenso sagen, durch sie erfährt das andere Glied etwas: nämlich die Erfassung
10 des Endes ist eine andere als die „desselben Inhalts“, der nicht Ende ist; auch
er wird zu einem Substrat mit Akzidens.
Je nach der Weise der Übergangssynthesen sieht nun das Akzidens anders
aus, und ein Hauptunterschied ist der, dass unselbständige Momente, wenn
sie nicht Nominalisierung erfahren, selbst durch die Übergangssynthese zu
15 Akzidentien werden (diese Form annehmen), während sich anderenfalls,
oder wenn selbständige Gegenstände erfasst und dann, wie nicht anders
möglich, substantivisch erfasst werden, sich im Übergang neue Akzidentien
konstituieren, die Relationsakzidentien, an die sich das „in Bezug auf die
betreffenden selbständigen Gegenstände“ anschließt (ähnlich – in Bezug auf
20 A, größer – als B etc.). Überall haben wir ein Recht, von „beziehendem
Denken“ zu sprechen, sofern überall die Übergangssynthese es ist, welche
konstitutiv ist für das Akzidens an der logischen Substanz (am Substrat).
Aber einmal hat der im Prädizieren sich konstituierende Sachverhalt die
Form des Irrelativen, es ist „ausgesagt“, was der Gegenstand schlechthin
25 und an sich ist; das andere Mal ist ausgesagt, was er in Bezug auf ein anderes
ist. Das heißt, einmal kommt dem A ein absolutes Akzidens zu, das kein „in
Bezug auf“ und damit keine Setzung eines zweiten Substantivs erfordert, das
andere Mal ist das eben der Fall.
Im Relationsurteil ist ein Relationsverhalt konstituiert, in welchem ein
30 Gegenstand auf einen anderen bezogen ist. Im Sachverhalt kommt das „in
Bezug auf“ vor. Im eigenschaftlichen Urteil ist nicht ein Gegenstand auf einen
anderen bezogen, es kommt das „in Bezug auf“ nicht vor. Das „in Bezug
auf“ ist eine sachliche Form, die sich nur in gewissen Übergangssynthesen
konstituiert; und heißt Beziehen eben dieses Konstituieren, dann ist nicht
35 jedes Urteilen ein Beziehen.
Andererseits verstehen wir unter Beziehen ein Erfassen, das nicht bei
einem schlicht Erfassten verbleibt, sondern übergeht zu einem zweiten Er-
fassen, das also nicht ein einfacher Blick ist, sondern ein Über-das-erst-
Erblickte-hinüber-auf-ein-Neues-Blicken. Dann ist jede Übergangssynthese
40 ein Beziehen, und in diesem Sinn ist jedes Denken beziehendes Denken.
beilage x 153

Beilage X
Die Übergangssynthesen: Das Subjekt braucht nicht der
Ausgangspunkt zu sein. Die Übergangssynthesen
sind noch keine prädikative Bestimmung1

5 Wenn wir einer Phänomenologie der prädikativen Bestimmung nach-


gehen, so geraten wir auf die „Übergangssynthesen“. Ich beginne mit der
„Explikation“.
Nun möchte man aber ernstlich schon bei den „Merkmalen“ fragen, ob
denn nicht eine grelle Farbe auffallen kann, ohne dass der sie tragende Gegen-
10 stand zunächst für sich erfasst wäre. Dann hätten wir zunächst Erfassung des
„Rot“, dann Übergang zum Gegenstand, und der steht nun doch als rot da,
das Rot an ihm. Sicher, aber bei Stücken, bei selbständigen Teilen? Der Blick
fällt auf den Knopf dieses Tintenfasses, ich erfasse ihn und gehe zum Ganzen
über, ich nehme aber den „Standpunkt des Ganzen“. Das ist Träger, es hat
15 den Teil. Kann ich nicht in einem Blick einen Gegenstand mit Teilen erfassen
derart, dass in der Auffassung sich Teilauffassung und Gesamtauffassung
decken, und nun nehme ich das Ganze als Subjekt und finde sogleich an ihm
das in besonderem Erfassen herausgehobene Prädikat? Etwa sogleich an ihm
das Haben dieser Glieder etc.
20 Mein Blick fällt auf einen Fleck (dieses Kleidungsstücks). Ich gehe zum
Gegenstand über, und dieser steht als fleckig da. Indem am Ende dieses
Übergangs der Gegenstand erfasst ist, ist er zugleich in der Synthese mit dem
Teil erfasst, und an ihm ist nun der Fleck („an“ als Relation). Der Gegenstand
steht als ein Fleck habender da. Nun setze ich G und setze das Haben des T.
25 Also, wenn S das Subjekt sein soll, so braucht nicht etwa das S im Über-
gang an erster Stelle zu stehen. Tut es das, muss ich „zurückkehren“. Ich habe
zunächst vor der Prädikation S→P, dann P→S oder vielmehr in eins S→P→S
oder S ←→ P und dann Subjektfassung und Setzung des S. S ist P, ist ρ P. Wenn
ich aber zuerst P erfasste, so habe ich P→S, S ist P, ist ρ P etc., also einfacher.
30 Es ist weiter schwierig, sich klar darüber zu werden, welche Arten schlich-
ter Betrachtung es gibt. Der einfachste Fall ist der, dass man irgendetwas
erfasst, wobei ein umfassendes Ganzes oder eine Umgebung mitaufgefasst,
aber nicht speziell erfasst ist; dass man dann, den allgemeinen Abhebungen
nachgehend, immer neue Erfassungen übt, was einem gerade auffällt. Das
35 früher Erfasste bleibt noch eine Weile erfasst in der Weise der Festhal-
tung, dabei mancherlei „Übergangssynthesen“, aber keine „Subjekte“ und
„Prädikate“.

1 Wohl September 1911. – Anm. der Hrsg.


154 explikative und prädikative synthesen

Ein anderes ist es, wenn mich ein Gegenstand als Hauptsache interes-
siert und ich ihn schon bestimmend betrachte. Wenn alles sich in Bezug auf
ihn gruppiert, die Übergangssynthesen auf ihn als Zentrum bezogen sind, da
habe ich eigentlich schon alles beisammen, Substantiv und Adjektiv, Subjekt
5 und Bestimmung und bezügliches Objekt. Es fehlt nur die Konstitution der
gegliederten Setzungsweise, das „S ist p!“. Da ist es schwierig, die Grenzen
zu ziehen.

Beilage XI
Bloße Übergänge und ihre phänomenologischen
10 Charaktere gegenüber den Übergangssynthesen1

Ich spreche immer von Ü b er g an g ss y n th es e n, aber findet nicht schon


„Synthese“ statt o h n e z usa m m e n ha lt en d e Sp o n ta n ei tä t? So, wenn ich
von einem Gegenstand, ohne ihn festzuhalten, zu einem Teil, zu einem Glied
übergehe. Ebenso beim Übergang von Gleichem zu Gleichem (wenigstens
15 wo sich Gleichheit „aufdrängt“). Kommt es nicht vor, dass wir durch die sich
im Übergang aufdrängende „Deckung“ allererst dazu kommen, zusammen-
haltend und beziehend Gleichheit zu konstituieren? Und eventuell bewirkt
dieser Deckungscharakter, dass wir Gleichheit aussagen, ohne V ergleichung
vorgenommen zu haben.
20 Aber freilich, ist das wirklich Deckung? Bei der Gleichheit könnte man
fragen, ob es nicht eine „Gestaltqualität“ ist, ein Moment, das zur Sukzession
gehört von Gleichem zu Gleichem, während die „Deckung“ im beziehenden
Bewusstsein ganz offenbar etwas total anderes ist; obwohl wesentlich damit
zusammenhängend, insofern mit Ersterem das Letztere möglich ist. Im Ver-
25 gleichen lege ich die Sachen geistig sozusagen aufeinander. Ebenso scheint es
ein phänomenologischer Unterschied zu sein, ein Steigerungs-Nacheinander
zu erleben, einen bloß zeitlichen Übergang von Leiserem zu Lauterem oder
umgekehrt, und andererseits ein beziehendes Steigerungsbewusstsein. Man
könnte hier auch sagen: Wenn ich zeitlich den Übergang habe von leise
30 zu laut, so kann ich nachher vergleichend und beziehend „geistig“ den
umgekehrten Weg gehen und das Laut zum Substrat machen. Nun ist das
vergleichende Übergehen oder vielmehr das beziehende auch etwas phäno-
menologisch Zeitliches, aber offenbar ist das Zurückblicken vom Lauten zum
Leisen nicht das Phänomen der Sukzession lauter Ton – leiser Ton. Man darf
35 die Phänomene hier nicht verwechseln.

1 Wohl September 1911. – Anm. der Hrsg.


beilage xii 155

Also, die b lo ß en Üb e rg ä n ge schaffen vermöge des Wesens der über-


gehenden Phänomene E i n he it s ch a r ak t er der S u k ze s si o n, und mi t d i e-
s e n la uf e n M ög l ic h k ei t en d e r Sy n t he si s pa ral l el. A b e r m an d ar f
n ic h t v o n „ D ec k ung “ , „ S yn t he se “ vo r der B e zi eh u n g u n d E xp li-
5 k a ti on s p r e c h e n. Im Allgemeinen ist nicht das Explikat eines Explikats
wieder unmittelbares Explikat des Explikanden. Es gibt wesentliche Un-
terschiede zwischen unmittelbaren und mittelbaren Teilen. Für Stücke gilt
allerdings, dass Stücke von Stücken wieder Stücke des Gegenstandes sind.1

Beilage XII
10 Die unterschiedliche Weise der Deckung von
Eigenschaften mit dem Gegenstand und von Teilen
mit dem Ganzen. Der Unterschied zwischen
explizierender und beziehender Einstellung2

G enthält T, G ist weiß. Das Gemeinsame: 1) G ist Subjekt einer Be-


15 stimmung, 2) G wird als etwas bestimmt.
Nun habe ich schon einmal und öfters gesagt, es sei ein Unterschied: im
Ganzen leben und seinen „Sinn“, seinen „Inhalt“ entfalten, im einzelnen
Moment das Ganze sehen „nach“ diesem Moment, von ihm Kenntnis gewin-
nen etc., und dem Ganzen das Moment gegenüberstellen als ein „anderes“,
20 als etwas für sich, und dann eines auf das andere b ez ie h en.3 Nehme ich Weiß
für sich (etwa innerhalb der Farbenmannigfaltigkeit), so kann ich dann sagen,
dieses Weiß tritt hier bei diesem Ding auf, kommt bei ihm vor, ist „Moment“
seiner Oberfläche. Ebenso, diese Gestalt ist die dieses Körpers, er hat diese
Gestalt, sie ist ein das „Wesen“ des Körpers aufbauendes Bestandstück.

1 Sollen wir sagen, Explikation, explikative Synthese ist eine synthetische Über-

gangsform, und es besondert sich nun „Eigenschaft“ und „Teil“ je nach der Artung
in der Form dieser Synthese? Sicher ist: Es handelt sich bei Eigenschaft und Teil um
einen formalen Typus, der sich durch die „Weise des Vorgehens“ bestimmt.
Treten nicht bei der Konstitution eines jeden bestimmenden Sachverhalts die
korrelativen Übergangssynthesen auf? Ich gehe doch von A zu B und von B zu A.
Aber den Standpunkt nehme ich in einem, in dem A. Den Standpunkt nehmen, eine
Relation oder Komplexion von einem Standpunkt aus auffassen, das ist nichts anderes,
als das A im Charakter der Subjektsetzung erfassen oder vorher das A in der Weise
des sich Explizierenden, des sich Bestimmenden fassen.
2 Wohl September 1911. – Anm. der Hrsg.
3 Natürlich braucht es nicht bloß Entfaltung des schon konstituierten Inhalts sein.

Vielmehr, im Allgemeinen „bereichert“ sich der Inhalt in der Bestimmung.


156 explikative und prädikative synthesen

Umgekehrt: Dieser Körper besitzt diese Weiße, besitzt diese Gestalt. Lebe
ich aber einfach im Anschauen des Körpers, dieses Papiers, und entfalte ich
sein „Sein“, so ist er „weiß“. Weiß, das enthält also die kategoriale Form
des Explikats.
5 E x pl izi e r en i st n ich t In - B e z ie h u ng -Se tz en. Explikat ist nicht Teil
(es fehlt die kategoriale Form von Ganzem und Teil). Auch wenn ich beim
Durchlaufen des Dinges auf Teile scheinbar stoße, wie den Schnabel dieser
Kanne etc., so ist die explizierende Einstellung eine total verschiedene
als die beziehende Hat-Einstellung: Im Explizieren bestimmt sich mir die
10 Kanne, ihr Wesen lebt in dem Schnabel. Erst wenn ich ihn zum Gegenstand
für sich mache und die Gegenstände Kanne und diesen für sich gedachten
Schnabel aufeinander beziehe, habe ich eben eine Beziehung und beziehende
Bestimmungen. Und nun is t das G Ganzes von T, und dieses „Ganze von T“
hat jetzt dieselbe Form wie „weiß“.

15 Beilage XIII
Kenntniserweiternde gegenüber kenntniserläuternder
Explikation (innerer Explikation)1

Explikation sagt Entfaltung. Was entfaltet sich? Der zu explizierende


„Gegenstand“, nämlich sein „Inhalt“, was in ihm „liegt“, wird herausgeholt.
20 Was in ihm liegt, das sind seine Gehabtheiten bzw. seine „Bestimmtheiten“,
die dem Gegenstand „zukommen auch unabhängig von und vor der be-
stimmenden Tätigkeit“.
Indem sich nun der „Inhalt“ auseinanderlegt und der Gegenstand doch
als dieser Gegenstand, als Gegenstand seines Inhalts erfasst, gesetzt war,
25 möchte es scheinen, dass Explikation als Explikation des gegenständlichen
Inhalts oder Bestimmungsgehalts phänomenologisch auch besage Entfaltung
des den Gegenstand „Vorstellens“, Entfaltung des Erlebnisses, in dem der
Gegenstand „aufgefasst“ ist, „erscheint“ und mit dieser „Materie“ gesetzt
ist. Das Gegenstandsphänomen habe sozusagen Falten; der Einheit des Den-
30 Gegenstand-A-Vorstellens-und-Meinens wohnen Teilmeinungen in gewisser
Weise ein, die in der Explikation zur Artikulation kommen (wenn sie auch
nicht etwa gegenständlich würden).
Indessen ist zu unterscheiden, einerseits die bloße Analysis (in dem
Sinn, in dem man von analytischen Urteilen spricht), die analytische Ver-
35 deutlichung des Sinnes, mit dem der Gegenstand wirklich gemeint ist, und

1 Wohl September 1911. – Anm. der Hrsg.


beilage xiv 157

Auseinanderlegung der Sinneskomponenten, des Inhaltsbestandes, der in


der „Gegenstandsmeinung“ wirklich schon lag, und andererseits die syn-
thetische Bestimmung des Gegenstandes, das Näherbestimmen, wobei die
Näherbestimmung noch nicht im Bewusstsein des Gegenstandes „enthalten“
5 ist, oder die Neubestimmungen, die den Gegenstand überhaupt allererst
näher kennenlernen und dabei neu und Neues von ihm kennenlernen.
Das bloße Verdeutlichen (die Kenntnis, die man schon hat, sich verdeut-
lichen)1 und das Kenntnisnehmen (d. i. Erfassen und in steter Erfassung
„desselben“ Gegenstandes), immer reichere Kenntnis von ihm gewinnen,
10 einen immer reicheren gegenständlichen Inhalt in die Erfassung hineinbrin-
gen: durch fortgesetztes Erfassen „neuer“ Einzelheiten, die fortgesetzt in den
Sinn des erfassten Gesamtgegenstandes (des explizierenden) aufgenommen
werden, ihn fortgesetzt bereichern, unter Vereinheitlichung der Bewusst-
seinseinheit des Gegenstandes.
15 Phänomenologisch ist natürlich das bloße Erläutern, das bloße Verdeut-
lichen unterschieden von derjenigen Explikation, in welcher das Bestimmen
die Kenntnis „erweitert“. Jede Relation erweitert die Kenntnis. (Jede äußere
Explikation erläutert nur die Kenntnis, die durch Explikation schon gegeben
ist?)

20 Beilage XIV
Prädikative und vorprädikative Übergangssynthesen.
Schlicht Abgesehenes und Abgesehenes im Übergang.
Die Übergangsformen. Die Form des Bestimmbaren
überhaupt gegenüber der Form des Substrats2

25 Man muss unterscheiden: I) die Erfassung bzw. Setzung eines Gegen-


standes al s f ü r s i ch s e l bs t a b g e se h e n im Gegensatz zu der Erfassung
eines Gegenstandes, der nicht „um seiner selbst willen“ erfasster, abgese-
hener ist. Ein Gegenstand ist „eigentlich“ betrachteter (oder schlechthin
betrachteter), andere Gegenstände sind in der Betrachtung nur im Dienst
30 von Bestimmungen herangezogen: Sie sind erfasst, aber das Absehen geht auf

1 Kenntnisnehmendes Erfassen, Kenntnis-Inhalt. 1) K en n tn is-„ E rläu teru n g “,

Verdeutlichung des Inhalts der Kenntnisnahme. 2) K e n n t n i s - E r w e i t e r u n g = Er-


weiterung des Inhalts der Kenntnisnahme in fortgesetzter Neubestimmung. Phänome-
nologischer Unterschied zwischen „analytischer“ Explikation, kenntniserläuternder,
und „synthetischer“ Explikation, kenntniserweiternder.
2 Wohl September 1911. – Anm. der Hrsg.
158 explikative und prädikative synthesen

den Gegenstand, der Bestimmungssubjekt ist; in und mit ihrer Betrachtung


bestimmt sich dieses Subjekt. Das p ri mä r e t h em at is ch e O b j ek t - d i e
s e ku n d är e n t h e m a t i sc h en O bj e k t e.
Ein Gegenstand wird erfasst: Seine Erfassung ist aber nur Durchgangs-
5 punkt für eine andere Erfassung, deren Objekt das eigentliche Absehen ist.
Das Durchgangspunktsein kann besagen: 1) Der Gegenstand ist überhaupt
nicht thematisches Objekt. Es kann aber auch 2) besagen: sekundäres thema-
tisches Objekt sein, d. h. adjektivisches Thema oder bezügliches Objekt sein.
Es fällt in den Rahmen des Absehens, aber das Absehen hat zwei Sphären,
10 das primär Abgesehene, das Subjekt, und das sekundär Abgesehene, das im
Dienst der Bestimmung Stehende. Wir haben hier also zwei Unterschiede:
1) das Thematische im weiteren Sinn: thematisches Objekt sein und nicht
thematisches Objekt sein, obschon erfasst sein; 2) innerhalb des thematischen
Objektseins den Unterschied zwischen thematischem Substrat und dem, was
15 dazu dient, das Substrat zu bestimmen.
Dabei ist weiter zu unterscheiden ein thematischer Singular und ein the-
matischer Plural, das Abgesehene ist ein Einzelnes oder eine Mehrheit als
Plural. Es ist aber die Frage, ob nicht noch weiter zu scheiden ist, z. B. neben
den Plural sei zu stellen das Disjunktivum. Ferner: Das Absehen geht auf
20 Einheit, konjunktive und disjunktive Mannigfaltigkeit; es geht auf nominale
Einzelheiten, Mehrheiten, Disjunktiva, oder es geht auf Sachverhalte (pro-
positionale Gegenständlichkeiten) und dann wohl wieder auf propositionale
Einzelheiten (einen einzelnen Sachverhalt), Mehrheiten und Disjunktiva.
Dabei ist nicht zu verwechseln das Absehen auf einen Sachverhalt als Pro-
25 positionales und das Absehen auf den nominalisierten Sachverhalt etc.
Ob etwas thematisch ist als Subjekt (singuläres, mehrheitliches) oder als
Bestimmung oder innerhalb der Bestimmung als bezügliches Objekt, das sind
Unterschiede, die in die Sphäre der (propositional-singulären) Sachverhalte
fallen. Und daneben gibt es vielerlei andere Unterschiede: Die Unterschiede
30 thematischer Form, wie z. B. hypothetischer und disjunktiver Vordersatz und
Nachsatz zu sein und dgl.
Nun kann man Unterschiede betrachten innerhalb der Sphäre der Prä-
dikation, also wirklich der konstituierten Sachverhalte, und Unterschiede
des gegenständlichen Bewusstseins vor der prädikativen Konstitution der
35 Sachverhalte: also Unterschiede der Weise gegenständlichen Bewusstseins in
den Übergangssynthesen, in der Weise, in der ein Absehen auf ein Betrach-
tungsobjekt geht und in der es auf bezügliche Objekte geht in dem bloßen
Übergangsbewusstsein, durch das sich das zu betrachtende Objekt bestimmt,
aber vorprädikativ. In der vorprädikativen (in gewissem Sinn unteren) Sphäre
40 haben wir dann nur den Unterschied des Singulären und Pluralen (Konjunk-
tiven und Disjunktiven), das Abgesehenes ist, und zwar schlicht Abgesehenes
beilage xiv 159

oder als Bestimmungssubjekt Abgesehenes, im Gegensatz zu dem, was der


Bestimmung dient.
In dieser vorprädikativen Sphäre haben wir aber wohl zu unterscheiden
II) das Abgesehene, und zwar primär Abgesehene (als Subjekt) und das
5 Nominale (Substantivische). Das bezügliche Objekt ist nominal bewusst,
aber nicht als Träger. Das Adjektivische ist nicht nominal bewusst.1 (Das
Bezügliche kann übrigens ebenso wohl ein singuläres wie ein plurales sein.)
Es ist aber nun die Frage, ob man sagen kann: Findet kein Übergang
statt, haben wir ein schlichtes Erfassen und Absehen, so handle es sich u m
10 b l oß n o m i n al e , su b s t a n t i vis c h e F o r m. Wir haben hier natürlich keinen
Unterschied zwischen primär und sekundär, zwischen Subjekt und Bestim-
mung, zwischen Herrschendem und Dienendem. Erst im „Übergang“ wird
das Abgesehene zum Substrat, zum Träger (eines Adjektivischen, eventuell
eines In-Bezug-auf). Also da erwächst die Form des Substrats. Vorher haben
15 wir schlicht Abgesehenes. Aber ist schlicht Abgesehenes eo ipso „nominal“?2
Wir können da, wenn wir das behaupten wollten, nur sagen: Vergleichen
wir das schlicht Abgesehene mit einem als Träger Abgesehenen und wieder
einem als bezügliches Objekt Abgesehenen, so finden wir ein Gemeinsames;
das nennen wir eben das Substantivische. Innerhalb des Sachverhalts finden
20 wir aber auch ein Adjektivisches bzw. innerhalb des Übergangs. Und darum
sagen wir also, das Nominale sei schon vor der Übergangsform da. Ganz un-
zweifelhaft ist das aber nicht. Im Gegenteil, ich halte es für falsch. Überlegen
wir, was wohl innerhalb der Übergangssynthese zu unterscheiden sei, und
versuchen wir folgenden Ansatz:
25 1) das schlichte Erfassen des A (angeblich schon nominal),
2) das Übergehen zu B, das zunächst auch schlicht erfasst ist, auch wo
es ein Unselbständiges ist, z. B. weiß. (Ist das etwa zunächst nominal =
substantivisch?)
3) Die Einigung: Das Papier, das noch erfasst ist, erfährt Bestimmung
30 durch das Weiß selbst, bestimmt sich als weiß; das Papier erfährt die Subjekt-
formung, das Weiß die adjektivische Formung.
4) Dann ist aber die Schwierigkeit die, dass wir doch das Weiß, die Farbe
(freilich auch das Prädikat weiß und das Weiß-Sein), nominalisieren können
und die Bestimmung in der Form „A hat Weiß-Farbe“ vollziehen können.
35 Wir sehen, wir müssen besser unterscheiden: Es ist zu unterscheiden zwi-
schen schlichtem Erfassen und Erfassen als Abgesehenes in der Weise eines
zu Bestimmenden oder Bestimmbaren. Das Weiß wird so nicht gefasst, es

1 Gemeint ist unter nominal hier substantivisch!


2 Nein.
160 explikative und prädikative synthesen

kann aber so gefasst werden: Das ist die nominale (substantivische) Fassung.
Also muss man doch eine eigene Fassung annehmen, die schon der Eingang
in die Übergangssynthese, in die bestimmende, voraussetzt. Diese Form des
Bestimmbaren ist aber nicht die Form des Substrats. Die erstere Form ist vor-
5 ausgesetzt, damit etwas Subjekt werden kann, aber nicht selbst Subjektform.
Das Weiß als Explikat kann, ohne dass es aufhört, Explikat zu sein, also
im Dienst der Bestimmung des A zu stehen, die Form des Bestimmbaren
annehmen, und eventuell sogar auch Bestimmungen annehmen. Es kann
also zugleich Subjekt sein, aber freilich Explikat und Subjekt kann es nur
10 sein in der Weise, dass das Subjekt eine Form angenommen hat, die das herr-
schende Subjekt, das Hauptsubjekt, natürlich nicht hat. Jedenfalls haben wir
also die Form, die wir die substantivische nennen, die des B e st im m b ar e n
üb e r ha upt, zu trennen von der Form des S u b jek ts (besser Tr äg er s), und
die beiden Möglichkeiten, dass etwas innerhalb der Sphäre des Thematischen
15 auftritt, das zwar Abgesehenes ist (wie alles darin), aber nicht die Form
des Bestimmbaren hat, und andererseits diese Form annimmt (und alles
Abgesehene kann sie prinzipiell annehmen).
Demnach haben wir alles in allem zu scheiden:
1) Abgesehenes (wohlunterschieden gegenüber Nicht-Abgesehenem; in-
20 nerhalb der Sphäre des Abgesehenen mancherlei Unterschiede);
2) schlicht Abgesehenes im Gegensatz zu Absehen im Übergang, wodurch
verschiedene Formen auftreten.
3) Sehr wichtig ist es, zu beachten den Unterschied zwischen bestimmen-
den Übergängen und Übergängen schlechthin. Ich erfasse einen Gegenstand,
25 dann lenkt sich die Aufmerksamkeit auf einen Teil, dann wieder auf ein Mo-
ment etc., all das ohne Bestimmendes und Bestimmtes. In diesem Übergang
ist alles schlicht und in gleicher Weise erfasst, und es fehlen die Formen, auf
die es uns jetzt ankommt, die Formen des Bestimmbaren und des Subjekts
(bzw. allgemeinen Trägers). Soll der Übergang zu einer b es t im m en d e n
30 Ü b er g an gs s yn t h e se werden, so muss das Übergangsglied Abgesehenes
sein in der Form des Bestimmbaren, in der substantivischen Form. Indem die
Synthese vollzogen ist, erhält es zugleich die Subjektform. Das im Übergang
Erfasste hat im Allgemeinen nicht die Form des Bestimmbaren. Ist es ein
unselbständiges Moment, so hat es einerseits die Form der schlichten Erfas-
35 sung (wenigstens kann man vielleicht sagen, zunächst), andererseits (indem
die Synthese einschnappt) die Form der adjektivischen Bestimmung.
Es kann dann aber die adjektivische Bestimmung eine Umwandlung
erfahren: Indem nämlich das zunächst schlicht Erfasste die Form des Be-
stimmbaren (des Gegenstandes im nominalen, substantivischen Sinn) erhält,
40 und wenn es dann selbst Bestimmung erfährt, untergeordnete, attributive
Bestimmung, so erhält es die Form des Substrats, des Themas.
beilage xv 161

Die Form des Subjekts: So bezeichnen wir am besten das in der gesamten
Synthese zu Bestimmende, das H au p t su b j ek t. Form des Trägers:1 jedes
Bestimmung (sei es auch mittelbare, dienende) erfahrende Objekt.
Wir können vielleicht auch sagen, Gegenstand im prägnanten Sinn, das
5 ist die Form des „G eg en st a nd e s, w e lc he r“; „ d er G egen s tan d , w el-
c he r “ is t e nt w e de r „ G e g e n st a nd wo r üb e r “ ( nä ml ic h w or ü b er d ie
A us s a ge g em a c h t w ir d e t c .) o d e r „ G e g e n st an d in B ez u g a u f d en “.

Beilage XV
Schlichte und beziehende thematische Betrachtung.
10 Wie das beziehende Betrachten sich zum Bestimmen
in der prädikativen Synthesis wandelt2 3

Aber diese Explikation, diese betrachtende Kenntnisnahme vom Objekt,


ist nicht Erfassung von Sachverhalten, ist nicht synthetisches Bewusstsein
von Relationen und sonstigen Sachverhalten (Ist-Verhalten). Es soll jetzt das
15 synthetische Bewusstsein vollzogen werden: G ist  und relationell G hat T.
Es ist artikuliert und synthetisch bewusst die Relation zwischen Ganzem und
Teil bzw. das Subjekt als das die Bestimmung tragende. Sie setzt doch wohl
jenes nicht-synthetische Bewusstsein voraus.
Ich frage nun, setzt nicht jedes synthetische Erfassen einer Relation,
20 jedes „beziehende Erfassen“ schon eine irgendwie bewusste Einheit der
Beziehungspunkte voraus? Die Frage ist zweideutig. Auf diese Schale hinbli-
ckend, habe ich schon im schlichten Erfassen einige Einzelheiten, z. B. diesen
Buckel in Bevorzugung bewusst, nämlich schon abgehoben, obschon kein
Sondererfassen, kein Explizieren noch statthatte. Man kann sagen, schon da
25 liegt eine Art verborgene Einheit vor. Der in der Gesamterfassung erfasste
Gegenstand und das an ihm Abgehobene.
Eine andere Einheit ist aber die, welche bei einer Explikation durch kon-
tinuierliche Einigung der Gesamterfassung und Sondererfassung sich stiftet,
im Übergang vom einen zum anderen. Also entspricht, hätten wir doppelt

1 Träger = Substantivität.
2 Wohl September 1911. – Anm. der Hrsg.
3 Gegensatz: 1) das Sich-näher-Bestimmen in der „Verdeutlichung“ und 2) das

Sich-Bestimmen in der Prädikation, in der synthetischen Beilegung von Bestimmun-


gen als Prädikaten. Das explizierende Betrachten gegenüber dem Prädizieren; ei-
nerseits das analysierende Herausheben von gegenständlichen Inhaltsmomenten und
Sondererfassen in Richtung auf den Gegenstand, andererseits das Konstituieren von
Prädikaten an Subjekten.
162 explikative und prädikative synthesen

zu fragen, dem bei jeder beziehenden Erfassung, in der eine Relation eben
beziehend, in artikulierter Synthesis, zur Erfassung kommt, etwas: Bedarf
diese Synthese als Voraussetzung die Erfassung einer schlichten Einheit und
dann eines Übergangs von Relationsglied zu Relationsglied?
5 Doch das ist ungenau. Im Fall des Verhältnisses zwischen Ganzem und
Teil erfasse ich zunächst das Ganze und bin darauf gerichtet: Aber der Teil ist
abgehoben und hat schon verborgene Einheit mit dem Ganzen. Diese Einheit
ist aber nicht das Ganze, worauf ich objektivierend-erfassend gerichtet bin. So
bin ich bei einer sonstigen Relation zunächst etwa schlicht auf das eine Glied
10 erfassend gerichtet, aber die Einheit mit dem anderen, noch nicht erfassten
ist schon zuhanden, drängt sich hervor und ist sozusagen ein verborgenes
Motiv für die beziehende Bewegung.
Lassen wir die Frage nach den verborgenen „Motiven“, nach den die
Bewegung „anregenden Tendenzen“ beiseite, und b e tr ac h t en wi r d ie
15 Ü be r gä n ge u nd di e A r t, w i e es z u r ar t ik u lier t en s yn t h et is c he n
Er fa s s un g d e r R e l at io n ko m m t.
Nehmen wir an, wir betrachten einen Gegenstand: diese Tinten-Pipette.
Sie ist das Objekt. Nun drängt sich die schwarze Tischplatte auf, auf der die
Pipette liegt, der Blick wendet sich ihr zu, aber die Pipette bleibt das Objekt
20 der Betrachtung. Habe ich jetzt zwei betrachtete Objekte?
Stellen wir eine allgemeinere Betrachtung an. Ich kann betrachtend von
Objekt zu Objekt gehen und im Übergang Festhaltung üben, und zwar als
„aneinanderreihende“ Hinzunehmung; in ihr ist jedes Neue, das ich erfasse,
Objekt, und jedes ist Objekt in gleichem Sinne. Aber nicht immer ist im Über-
25 gang von einem Objekt zu einem anderen Erfassten das letztere „Objekt“.
Das zeigt sich ja auch daran, dass ich das erste Objekt und ein zweites
oder auch noch ein drittes und so weiter „zusammennehmen“ und hierbei
einen Abschluss machen kann derart, dass ein Hinausblicken über die in
der abschließenden Einheit des Zusammennehmens zusammengenommenen
30 Objekte zwar neue Sachen erfasst sein lässt, aber nicht als Objekte, die in
„Betracht“ stehen, in Betracht gezogen werden und betrachtete Objekte
sind.1 Ebenso kann es nun sein, dass ich ein Objekt betrachte, zu einem
zweiten übergehe, aber dabei bliebe, das erste Objekt allein zu betrachten,
es ist allein und bleibt allein das Objekt, das ich betrachte im eigentlichen
35 Sinne.
Aber nun ist noch ein Unterschied zu machen. Wenn ich zu Zwecken
eines Beziehens den Blick von der Pipette auf den Tisch, auf dem sie liegt,

1 Kontinuität der thematischen Setzung, Erblicken eines Objekts, das „nicht hinein-

gehört“, nicht in die thematische Betrachtung „gezogen wird“.


beilage xv 163

hinübergehen lasse, so hat diese Tischerfassung einen Vorzug gegenüber


anderen gelegentlichen Erfassungen, wie wenn ich auch den Blick hinüber-
schweifen lasse zu dem Aschenbecher. Im Hinblick auf den Tisch ziehe
ich den Tisch in die Betrachtung hinein; aber in die Betrachtung der Pi-
5 pette.
Das „Inbetrachtziehen“ ist also zweideutig. Denn wenn ich betrachtend
in koordinierter Weise von Objekt zu Objekt gehe in fortschreitender An-
einanderreihung von Objekten der Betrachtung in der Einheit einer Zu-
sammennehmung und Hinzunehmung, so ziehe ich, sprachlich kann man ja
10 das auch sagen, eines nach dem anderen in Betracht, und so spricht man
noch in anderen Bedeutungen von einem Inbetrachtziehen, zum Beispiel,
ziehen wir in Betracht, dass A ist, so ist zu sagen, es muss B sein, also bei
der Begründung. Indessen hier liegt offenbar ein Gemeinsames vor. Das In-
„Anbetracht“ bei der Begründung braucht nicht schon besagen, dass das
15 In-Betracht-Gezogene vergegenwärtigt sei und besagt es an sich auch noch
nicht.
Was übrig bleibt, ist dann wieder dies, dass etwas im eigentlichen Sinne
betrachtet ist, primär, und dass anderes in dienender Weise in Betracht
gezogen ist. Freilich ist da schon von prädikativen Bestimmungen die Rede,
20 und es ist das auch schon wohl ein plus. Jedenfalls wollen wir versuchsweise
von t he m a ti s ch er Be t ra ch t un g sprechen, dabei zwischen schlichter und
beziehender thematischer Betrachtung unterscheiden. Bei der letzteren spre-
chen wir von einem S u bs t r at d e r B et r ac h t un g und dem, was in Betracht
gezogen worden ist, als a n ih m oder i n B e zu g d a r au f; ein zweiter, in
25 Bezug auf das Substrat in Betracht gezogener Gegenstand: der korrelative
Gegenstand, der G e g e np u n k t d er Bet ra ch tu n g.
Es scheint, dass wir sagen müssen: Ein Gegenstand kann thematisch
betrachtet sein schlechthin (das ist, ohne Beziehung, aber ganz analog wie ein
Substrat der Betrachtung), auch wenn an ihm nichts Besonderes betrachtet
30 wird. Als schlichtes Thema fungieren und überhaupt als Thema, das ist eine
besondere Weise der Zuwendung zum Gegenstand bzw. seiner Erfassung. Er
hat dabei eine auszeichnende Geltung. Wenn ich einen Gegenstand als Thema
erfasse, so ist das eine Auszeichnung gegenüber einem nebenbei erblickten
Gegenstand. Ich erinnere auch an die Fälle, wo ein „einheitliches Interesse“
35 mehr Gegenstände als Themata zusammennimmt und auszeichnet.
Unter „I n te re s s e“ ist dabei aber nicht an Gefallen, Lust und dgl., über-
haupt an Gefühle, zu denken, die unter Umständen oder in der Regel die
thematische Zuwendung, und zwar die auszeichnende Zuwendung, motivie-
ren, anregen mögen und dgl. (Wir sollten auch von theoretischer Zuwendung
40 sprechen, obwohl das seine Bedenken hätte, bzw. von theoretischer Erfas-
sung. Doch ist das bloß der Anfang des „Theoretischen“.)
164 explikative und prädikative synthesen

Untersuchen wir nun das b ez ieh e n de B e tr ac h te n und die Art, wie es


sich zum Bestimmen in der prädikativen Synthesis und zum synthetischen
Erfassen von Relationsinhalten wandelt. Wir beginnen also noch einmal:
Wir betrachten die Pipette, wir wenden den Blick der schwarzen Tischplatte
5 zu. Die Pipette sei unser Thema, und zwar unser Substrat und bleibe es.
Die Tischplatte ziehen wir in der Betrachtung heran, sie ist nicht unser
Substrat, aber sie tritt in den Kreis des „Interesses“, in das des Themas.
Ebenso, sie „liegt (das erregt unser Interesse) neben“ der Zigarrenspitze:
Ein zweiter Blick und ein zweites beziehendes Betrachten geht auf die Zigar-
10 renspitze. Statt ein „neben“ kann aber das Verhältnis der Dicke zur Erfassung
kommen: Die Spitze ist dicker als die Pipette. Ich bin einmal auf Lage,
das andere Mal auf die Form „eingestellt“. Ich habe bei der Betrachtung
gerade auf die schlanke Form geachtet, und nun drängt sich im „Kontrast“
dazu die dickliche Form der nebenbei liegenden Spitze auf: Ich blicke hin-
15 über. Im Übergang erlebe ich in dieser Einstellung die Steigerung. Von der
als schlank ausgezeichneten Pipette zur Spitze, die die Sonderauffassung
als dickgeformt erhält, übergehend, erhält die letztere den Charakter der
Steigerung, des „Mehr“, aber ich bin auf die Pipette als Substrat gerichtet:
Der Blick wendet sich zurück zu der noch festgehaltenen Pipette, und sie
20 steht nun als „dünn“ da, und dieses „dünn“ ist es, das ich bestimmend
erfasse; sie ist nicht dünn schlechthin, sondern dünn mit Beziehung auf die
Spitze.
Ebenso, wenn sich bilden soll das Relationsurteil: „Die Pipette ist auf der
schwarzen Tischplatte“, so wendet sich ein beziehender thematischer Blick
25 auf die schwarze Platte, und nun hat oder vielmehr ist jeder der beiden Gegen-
stände etwas, das zur Erfassung kommt, wenn ich vom Substratgegenstand
(dem ersten Betrachtungsthema, das Substrat, also Herrschendes, ist und
bleibt) übergehe zum Gegenpunkt und rückkehrend in einem neuen Erfassen
zum Substrat. Es ist etwas, und zwar in Hinblick auf den Gegenpunkt, durch
30 dessen Erfassung ich hindurchgegangen sein muss.1
Es will mir scheinen, dass, wenn wir vom ursprünglichen Thema a ausge-
hen und ihm d en We rt d es B e t r a ch t un g ss u b s tr ats geben, wir zunächst
also geführt werden zu b (dem Dickeren). Nun hat schon vermöge dieses

1 Man sagt, zu jeder Relation gehört (im alten Sinn) ein fundamentum relationis, eine

Einheit, eine Tatsache, an der beide Beziehungsglieder beteiligt sind. Das kann man
bei den Relationen der Verbindung sagen, wo man ein „Ganzes“, eine „verbundene
Einheit“, erfassen kann und in ihr die Beziehungsglieder als Teile erfassen; das geht
aber nicht bei Relationen von Ganzem und Teil. Hier sind nicht Ganzes und Teil an
einem „beteiligt“, aber hier haben wir das Ganze als die eine Tatsache, in der wir auch
das andere finden, den anderen Beziehungspunkt. Und bei Gleichheit und Steigerung?
beilage xv 165

ersten Übergangs das b den Charakter des Dickeren, aber doch eigentlich
nicht des Dickeren als relatives Merkmal, sondern ein Charakter tritt daran
hervor, die Dicke, und zwar die Dicke charakterisiert durch diesen Übergang.
Wir erfassen das „b in diesem Charakter“, aber wir vollziehen da keine Syn-
5 these, wir sind einfach der Spitze in ihrer Dickheits-Charakteristik zugewandt
und kehren alsbald zu unserem Thema zurück als dem zu bestimmenden. Und
wir bestimmen es nun, wir erfassen: a ist dünner als b.
Warum, möchte man fragen, dieser doppelte Weg? Man wird versuchen
zu antworten: Solange ich a allein betrachte, finde ich an ihm kein relatives
10 Merkmal (es sei denn, ein sinnliches Kontrastmerkmal). Ich muss also zu b
übergehen. An b mag schon ein „Charakter“ hängen durch den Übergang
von a, aber das ist nicht ein relatives Merkmal, das voraussetzt, dass b Sub-
stratstellung hat und die Richtung der Beziehung auf a geht. Das relative
Merkmal am Substrat a ist erst voll konstituiert, wenn ich zu a wieder
15 zurückgekehrt bin, was eine Wiederholung der erfassenden Aktualität ist,
und nun bestimmend zu diesem Merkmal mich gewendet habe.1
Dasselbe gilt für jede Relation, auch für die Relation von Ganzem und
Teil. Ich gehe vom Ganzen als Substrat zur Erfassung des Teils als Hinblick
darauf, aber zum Ganzen zurückkehrend erhält dieses das durch diese hin-
20 und hergehende Bewegung konstituierte relative Merkmal: Ganzes von Tei-
len. Soll aber die umgekehrte Relation erfasst werden, so muss ich „mich auf
den Standpunkt des Teils stellen“, d. h. den Teil zum Substrat machen und
im Übergang zum Ganzen dieses in die Gegenstellung, die des „in Hinblick
auf“, bringen, und rückkehrend hat nun der Teil das relative Prädikat.

1 Das b in dem Charakter des „lauter“, des „dicker“, der Steigerung, das ist ein

eigener Modus des Gegebenseins des b, auf den ich reflektieren kann. Aber man
darf diese Reflexion nicht verwechseln mit der Hinwendung auf b, die eben aus dem
Charakter ein Beziehungsmerkmal zu a „macht“ oder entnimmt.
Nr. 9

A na l ysen z u r Ex pl ika t io n1

§ 1. Hauptexplikanden und dienende Explikanden.


Die mögliche Eigengeltung der Explikate. Die
5 Beziehung zwischen Ganzem und Teil als explikative
Synthese von zwei substantivischen Objekten

In der Explikation unterscheiden wir den Ha up te x pl i k and en,


den herrschenden, und die di e ne nd en E x pli kan de n (die selbst
wieder Explikate sind). Dasselbe gilt von der Explikation im weiteren
10 Sinne, der beziehenden, von einem Thema zu anderen, dienenden,
hinübersehenden Betrachtung.2 In den Sac hv e rh al te n, die sich auf-
grund der Explikation durch „Denken“ spontan konstituieren, unter-
scheiden wir Ha u pt s ub jek t e – jeder einfache Sachverhalt bzw. jede
einfache Prädikation hat ein singuläres oder plurales Hauptsubjekt –
15 und N e b e n s ub j e kt e, nämlich bezügliche Objekte, die selbst wieder
Subjekte sind. Ebenso Hauptprädikate und Nebenprädikate, Haupt-
bestimmungen und Nebenbestimmungen, z. B. „S, welches p ist, ist
q, welches r ist.“ Hier ist p das Nebenprädikat, q das Hauptprädikat;
q ist verflochten mit seiner Nominalisierung, die wieder ein Subjekt
20 ergibt, und zwar ein Nebensubjekt, für welches r das Nebenprädikat
ist.
In einer Explikation hat der Explikand eine Bevorzugung gewisser
Art: Wir sagen, er sei als Gegenstand für sich aufgefasst. Das ist aber
hier eine relative Rede. Nämlich das Explikat „gilt nicht für sich“,
25 es hat statt der Eigengeltung die der Explikation des Substrats, als
etwas, worin wir das Substrat sehen, verdeutlichen, kennenlernen,
etwas, worin sich das Sein des Substrats (des Explikanden) offenbart,
zeigt.
D i es e „Unselbständigkeit“, dieser Mangel an Eigengeltung, ge-
30 hört zum We se n d e s Ex p li k a ts, und wenn das Explikat wieder

1 Wohl September 1911. – Anm. der Hrsg.


2 Cf. X0 p. 10 ff. = S. 132,24 ff..
text nr. 9 167

Explikand ist in der Einheit derselben Explikation, so hat es zwar


keine Eigengeltung, aber doch wieder hat es seine relative zu sei-
nem Explikat. Wir müssen sagen, es hat zwar keine Eigengeltung,
aber erhält eine modifizierte, sozusagen bittweise angenommene, eine
5 Eigengeltung unter dem Hut der Explikation: Mit Beziehung auf
sie haben wir dann eine Unselbständigkeit zweiter Stufe, eben ein
Explikat zweiter Stufe. Wieviele Stufen eine Explikation auch haben
mag, wie oft Explikat wieder zum Explikanden werden mag, so ist
doch zu betonen, da s s i n ne r h alb d e r E in he i t d er E x pl i kat i o n
10 e i n do mi n ie ren der E xp l ik an d, der eine und einzige Explikand
der ganzen Explikation vorhanden ist, der a bs ol ut e E xp l i kan d,
unter den alle anderen Explikanden untergeordnet, dienende sind.
Die Rede vom Herrschen und Dienen ist eine relative und so die
Rede von Explikand und Explikat und auch die vom Explikand der
15 ganzen Explikation.
Nun finden wir aber beim Hauptexplikanden eine Eigengeltung,
die er schon hat in der Zuwendung zu ihm, auch ohne dass wir
zur Explikation übergehen. Der Gegenstand ist im prägnanten
Sinne G e g e ns t a n d d e s „ t he o ret i sc hen I nt er e ss e s “, und zwar
20 schlechthin, absolut. Diese Eigengeltung behält er in der Explikation,
und sie fehlt nicht allen Explikaten. Dies ist also ein zw e i te r S inn
v o n E i g e ng e l t un g. Diese Eigengeltung kann nun ein Explikat ent-
weder schon haben oder sie hinterher annehmen. Hierbei zerfallen
die Explikate in zwei Klassen, oder vielmehr die „Gegenstände“, die
25 in möglicher Funktion als Explikate stehen können.
1) Die einen können diese Eigengeltung nur dadurch haben, dass
sie vorher Explikate waren (also ohne jene andere Eigengeltung
waren). Ein „unselbständiges Moment“, ein „unselbständiger In-
halt“ ist dadurch charakterisiert, dass er herausgehoben sein muss,
30 aus einem Konkretum entnommen. Dieses kann dann fallengelassen
werden und das Entnommene zum „Gegenstand für sich“ gemacht
werden: als eigengeltender Gegenstand, z. B. weiß – Weiße. (Das
habe ich in den Logischen Untersuchungen schon so angenommen,
aber seitdem freilich öfters bezweifelt.)
35 2) Andere Gegenstände mögen als Explikate fungieren, aber sie
können als eigengeltend erfasst sein, ohne vorher so fungiert zu ha-
ben, ohne entnommen zu sein – die „selbständigen Inhalte“, die kon-
kreten. (Es wäre nun wohl auch relative Selbständigkeit zu erörtern?)
168 explikative und prädikative synthesen

Und nicht nur das, sie können, unbeschadet der Explikatstellung


(also selbst in der Explikation), den Charakter der Eigengeltung
haben. Das gilt wieder von den Konkreta. Ferner, ein Gruppenge-
genstand expliziert sich notwendig in „Gegenständen für sich“, das
5 Explizierte hat von vornherein und notwendig den Charakter der
Für-sich-Geltung.1
Also haben wir F ür- s ic h - G elt u n g i n ei nem D op p el si nn. Im
Explikat betrachte ich, verdeutliche ich den Gegenstand, der expli-
ziert wird. Insofern gilt er nicht für sich, wie der Hauptgegenstand
10 es tut. Andererseits, ein Ding, mag es auch in der Explikation etwa
einer Baumreihe auftreten, ist ein für sich geltendes: Ich brauche ihm
keine neue Form zu geben, um es zum Objekt von Explikationen
zu machen. Vielleicht könnten wir sagen: „Weiß“ ist seinem Wesen
nach etwas Gehabtes, etwas, was auf der Prädikatseite steht. Ein
15 Ding aber ist seinem Wesen nach etwas, was einen Seinsgehalt hat,
es fordert seinem Wesen nach, so gesetzt zu werden wie ein Subjekt
einer Explikation. Es fordert sozusagen Explikation; es lässt sie nicht
bloß zu. So ist die Weise des Gegebenseins beiderseits eine wesentlich
verschiedene. Diese zweite Selbständigkeit nennen wir das Objekt-
20 sein, die ursprüngliche Substantivität.
Endlich ist noch ein Drittes zu erörtern:2 Innerhalb einer Expli-
kation kann ein Gegenstand ursprüngliche Substantivität haben, und
zwar zugleich Explikat sein. Dann haben wir innerhalb der explikati-
ven Synthese (wenn sie unmittelbar ist) zwei ursprünglich substanti-
25 vische Objekte. Diese Objekte stehen in einer inneren Einheitsbezie-
hung, im einen expliziert sich das andere (natürlich in der aktuellen
Explikation). Der Sinn des einen und der des anderen sind innerlich
eins, sich, wenn auch nicht „total“, deckend. Und diese Deckung ist
im Grunde keine Deckung. Denn Deckung ist ein Vorgang, in dem
30 eines sich auf ein anderes, zunächst Getrenntes auflegt und so mit ihm
eins wird. Hier aber haben wir das Gegenteil: Entfaltung; ein Objekt
sondert sich im anderen und aus dem anderen.
Nun ist es offenbar etwas wesentlich Neues, dass das, was sich aus
einem Gegenstand herausgesondert hat, sich seinem Mutterboden

1 Cf. Πλ p. 6 f. = S. 182,26–184,15 f..


2 Cf. die Blätter vor 10a = vor S. 132,24.
text nr. 9 169

entfremdet, zu einem Gegenstand für sich gemacht und seinem Mut-


tergegenstand als ein „Anderes“ gegenübergestellt wird. Und nun
kann es sein, dass diese Gegenübergestellten in Bezug aufeinan-
der ein Bewusstsein der Deckung begründen und Beziehung zwi-
5 schen Ganzem und Teil sich konstituiert; und natürlich braucht auch
nicht eine Explikation vorhergegangen zu sein.1 Ich gehe von G
zu T oder T zu G über und setze sie beziehend in ein Verhält-
nis, in eine äußere Einheit gegenüber der inneren, der explikati-
ven. Was in Bezug zueinander tritt, das ist sich „äußerlich“, fremd,
10 jedes ein Fürsich, nicht nur jedes ein Objekt, sondern jedes abge-
schlossen: ohne innere Einheit oder die innere Einheit ausgeschal-
tet.

§ 2. Die Frage nach dem Fundament des


Relationsbewusstseins. Die sinnlichen Einheitsformen
15 sind keine Relationen. Der Unterschied
zwischen Kontrast- und Relationsprädikaten

Beirrend wirkte bei meinen Analysen die Unklarheit über das


fundamentum relationis im alten Sinne. Es ist dabei mehreres ausein-
anderzuhalten:
20 1) Anstatt eine Relation wirklich im beziehenden Bewusstsein
erfasst zu haben, in artikulierter, „eigentlicher“ Beziehungserfas-
sung, kann ich auch, und ohne unmittelbare Anknüpfung an solch ein
eigentliches Beziehen, in einem „uneigentlichen“ Beziehen, in einem
verworrenen Bewusstsein ohne synthetische Produktivität, die Bezie-
25 hung erfassen, auf sie gerichtet sein. Es ist nicht ein originäres, son-
dern s e k u nd ä r e s Be w us s t s e i n de r Re l a t i on; ebenso bei jedem
synthetischen Gegenstand (Gegenstand höherer Stufe). Dabei ist
aber wohl zu beachten, dass dies verworrene, sekundäre Bewusstsein-
von, obschon im weitesten Sinne ein Erfassen, Setzen, keineswegs ein
30 vergegenständlichendes im besonderen Sinne (ein nominales) sein
muss. Ich kann in einem Blick eine Gruppe erfassen, und zwar auf die

1 Das hat nur Sinn, wenn wir darunter eben die beziehende Synthese verstehen, die

den Sachverhalt „G hat T“ konstituiert.


170 explikative und prädikative synthesen

Gruppenglieder gerichtet sein in einem Zusammennehmen, ohne erst


synthetisch aufgebaut zu haben und ohne Interesse für die Gruppe
als Gruppeneinheit zu haben, und ebenso überall. Dabei kann im
Voraus auch die begriffliche Fassung da sein; beim Aussprechen und
5 Lesen freilich habe ich ein Nacheinander. Aber selbst da kann und ist
sehr oft der Sachverhalt ohne Artikulation konstituiert. Die Setzung
ist einfach, andererseits enthält sie oft mehrfache Setzungsstrahlen,
mehr oder minder deutliche, die nicht den Charakter von wirklichen
Setzungen haben, also in verworrener Weise. Es sind Modifikationen
10 von Setzungen.
2) Was soll demgegenüber die Rede von „s i nn li c he n E i nh e i-
t e n“ und s in nl i c h en E in hei t s fo rm e n (Gestaltqualitäten)? Wenn
ich ohne artikulierte und wirklich vollzogene Synthese in einem Blick
einen „Flecken auf dem Papier“ erfasse, so ist, was hier erfasst ist,
15 keine sinnliche Einheit und keine Gestaltqualität, sondern eine ein-
fache Setzung und Richtung auf die synthetische Gegenständlichkeit,
ebenso wenn ich eine Menschengruppe in „einem Blick“ erfasse und
auf die Menschen darin gerichtet bin.
Andererseits finde ich in einer sinnlich erscheinenden Mehrheit,
20 einer Menschenmenge, einer Allee „erscheinungsmäßig“ einen Ge-
samtcharakter und eine Einheit, die zu unterscheiden ist von der syn-
thetischen und „uneigentlich vorstelligen“ Einheit. Fällt der Blick auf
die Allee, so habe ich zweifellos nicht so viele intentionale Strahlen
als Baumerscheinungen.
25 Die Allee in ihrer gesamten Darstellung, als „Phänomen“, hat eine
Einheit, in der sich die einzelnen Baumdarstellungen unterscheiden
lassen (mehr oder minder deutlich). Von diesem Einheitscharakter,
der der sinnlichen Einheit eben ihren Charakter gibt, meinte ich, dass
er Anhalt der Assoziation sei bzw. die Ermöglichung der Auffassung
30 als synthetischer (nicht bloß der Wortassoziation: eine Menge etc.).
Für die Erforschung des Wesens der Erfassung von synthetischen
Gegenständlichkeiten kommt das alles natürlich in Frage. Wo es
sich aber darum handelt, das Wesen der originären Erfassung, der
„eigentlich erfassenden“, aufzuklären, da spielt beides keine Rolle.
35 Da können wir nur sagen: So geartet ist der Zusammenhang der
betreffenden Erlebnisse und so geartet ist ihre Materie, dass im Über-
gang sich notwendig Relationsprädikate herausstellen und zunächst
gewisse Formen der Synthesis. Sagt man, es muss eine Einheit da
text nr. 9 171

sein, so stellt der Übergang vermöge des Wesens der übergehenden


Erlebnisse Einheit her, und auf die kommt es an.
Was Schwierigkeiten macht: Wi e sic h das Rel at io n sb ew us st-
sein in Hi nsi c h t a uf sei n f u n da me nt um- Be wu ss t se in a u f -
5 k lärt. Es ist doch nicht in beliebiger Weise da, „vorhanden“. Genügt
es zu sagen: Es ist eine Einheit von α und β bewusst, und eine inhaltlich
eigenartige für jede Relationsart; sie kann komplex sein und mehrere
Einheiten von α und β enthalten, und dann kann der erfassende
Blick im Übergang beim zweiten Durchlaufungspunkt (dem α) ent-
10 weder das komplexe Beziehungsmerkmal erfassen oder nur eins der
komponierenden?1 Zum Beispiel, zwei qualitativ gleiche Töne, aber
einer intensiver als der andere. Ich kann beim Ton α das „intensiver“
erfassen oder das „qualitativ gleich“.
Wie ist es aber mit dem Fundamentbewusstsein, wenn sich die
15 Relation synthetisch erzeugt? Ob ich darauf achte oder nicht, die Ein-
heit ist vorhanden, und die Beziehungsprädikate sind „vorhanden“:
in demselben Sinn? Sie sind verborgen, aber „da“. Was gehört aber
dazu, damit das voll explizite Bewusstsein „α ρ β“, „α intensiver als β“
etc. zustande kommt? Muss erst ein Blick die Einheit treffen, die sich
20 zunächst als Einheit aufgedrängt hat, als einheitlicher Komplex der
Beziehungspunkte? Muss innerhalb dieser Einheit schon mindestens
Abhebung, wenn nicht Sondererfassung statthaben? Bei sukzessiven
Einheiten hieße das: Ein Blick muss die Sukzession als einheitliche
abgrenzen und erfassen; habe ich auf die verschiedenen Töne und
25 Geräusche nicht geachtet gehabt, so achte ich nachträglich auf sie
und hebe eine Gruppe, hebe das Paar heraus in einem erfassenden
Blick; habe ich geachtet, aber nicht festgehalten, dann muss die Um-
grenzung und Zusammenfassung nachträglich noch erfolgen.
Und dann das „Du r c h l a uf e n“. I s t da s w i r kl i c h n ö ti g? Ge-
30 nügt es nicht, den Blick auf das eine Glied der Einheit zu lenken,
und es steht schon als „laut“ da. Im ersten Moment möchte man
Ja sagen. Aber bald sieht man, dass es nicht geht, dass Durchlaufen
nötig ist. Ich werfe ebenso bei simultanen Ganzen den Blick auf
eine Häusergruppe, worunter eins besonders groß ist, und es steht im

1 Problem der komplexen Beziehungen und der Gegebenheit bloß einzelner Bezie-

hungen aus diesem Komplex.


172 explikative und prädikative synthesen

besonderen Erfassen des letzteren Hauses dieses als groß, „sehr


groß“ da. Nun, das ist sicher richtig. Andererseits aber haben wir
damit noch kein Bewusstsein einer Relation (kein artikuliertes, deut-
liches und gar gebendes), kein primäres „Sachverhalts“-Bewusstsein
5 „a ist größer als b“.
Man muss K o nt ra st prä d ik a te unterscheiden von Relationsprä-
dikaten. Es mag sein, dass Kontrastprädikate nur in Relationen ob-
jektive Gültigkeit haben können (wie alle sinnlichen Prädikate), aber
sie sind nicht selbst Relationsprädikate (nicht kategoriale Prädikate).
10 Ein großer Mensch ist groß (steht für mich als das da), auch wenn
ich keinen kleinen daneben sehe. Sagt man nun, gegenüber den um-
gebenden Dingen tritt seine ungewöhnliche Größe, die eine andere
ist als die der normalen Menschen, hervor, so mag das allenfalls sein,
aber wir vergleichen nicht, „setzen nicht wirklich in Beziehung“; wir
15 „vollziehen“ kein Relationsbewusstsein. Und so ist Gold „schwer“;
wir haben den „a b so lu te n E i nd ruc k“ von Schwere, ebenso bei
einer Gänsefeder das absolut erfasste Merkmal „leicht“, und so auch
bei dem großen Baum innerhalb der Baumgruppe, dessen Größe
im Kontrast sich aufdrängen mag, aber nicht im „in Bezug zu“ zu
20 erfassen ist.
Die sinnlichen Einheitsformen, die durch die sinnlichen „Gegen-
stände“ fundiert sind, sind keine Relationen. Und die sinnlichen
Charaktere, die die Gegenstände „vermöge“ der Einheiten, vermöge
ihrer Umgebung erhalten (was ein phänomenologisch Aufweisbares
25 ist), sind keine relativen Bestimmungen. Zum Erfassen und Ge-
gebenhaben von Relationen und Relationsprädikaten gehört es, in
Hinblick auf eine vorhandene Einheit, das a zu erfassen, beziehend
hinübersehen, beziehend übergehen zum b-Erfassen usw. Aber nun
gilt es, tiefer dringend zu beschreiben.
30 Wir sagen mitunter: A ist groß neben B, auch „im Vergleich mit
B“. A ist klein gegenüber C. A ist laut „im Vergleich mit B“; leise im
Vergleich mit C. Aber andererseits sagen wir: A ist größer als B, A
ist kleiner als C. Wir sagen auch nicht: A ist gleich im Vergleich mit
B, neben B. A ist ähnlich im Vergleich mit B. A ist Teil im Vergleich
35 mit B. Wie klären sich diese Unterschiede auf? „Groß und klein“
können K on t r a st p rä d ik a t e sein. Wo A und B, das Große und
Kleine in einem Bewusstsein gegeben sind, schon in einem schlichten
Zusammenhaltungsbewusstsein, zeigt A das Merkmal „groß“, das ein
text nr. 9 173

inneres Merkmal fasst, und das B das Merkmal „klein“. Es bedarf


nicht der eigentlichen „Vergleichung“, nicht der „Beziehung“ des A
auf B oder des B auf A und der damit eintretenden „Überschiebung“,
„Deckung“. Ja, es bedarf nicht einmal des Zusammenerfassens in
5 Form der Zusammenhaltung. Kommt B auch nur im Hintergrund zur
Abhebung, ohne dass es gegenständlich wird, so zeigt das A das Kon-
trastprädikat; es erscheint als groß. Ein „großer“ Mensch inmitten
von kleinen Leuten, auf die ich gar nicht achte, und schließlich ein
großer Mensch steht als groß da, ohne dass überhaupt in meinem
10 Gesichtskreis kleine Leute sind; er kontrastiert mit dem normalen
Menschen, von dem Exemplare dunkel „erregt“ sein mögen.
Es ist weiter zu bemerken, dass zwei oder mehrere Objekte von
gleicher oder verschiedener Größe durch die Größe eine „Gestalt-
qualität“ fundieren, dass Größe ein Einheit bildendes Moment ist,
15 auf das geachtet werden kann. Das gilt auch von „sinnfälliger Gleich-
heit“, von Abständen, von verschiedenen Einheitsformen. Diese Ein-
heitsformen sind noch keine Relationen. Eine Relation ist gegeben in
einem „beziehenden“ Bewusstsein, einem A-Erfassen und beziehend
Hinübersehen, beziehend Übergehen zu einem B-Erfassen. Bei den
20 Ve r g l e i c hun g s re l a t io ne n bekommen die beiden vergegenständ-
lichenden Akte Einheit durch eine „ü ber sch i ebe nd e D e ck u ng“,
und in dieser Einheit, in der Erzeugung dieser Synthesis wächst dem
A ein Merkmal zu: A ist in B, A ist gleich B, ähnlich B. Hier ist das
Merkmal so geartet, dass es in der Tat das B einschließt, wofern es zu
25 wirklich expliziter Gegebenheit kommt.
Ebenso bei den A b s t a n ds r e l a t io n en un d Or dn un gsr ela -
t i o n en, wo das Einheitsmoment des Abstandes A und B „v er -
k nüp f t“, aber nicht ein Ganzes zur objektivierenden Setzung
kommt, sondern das „A und B hat Verbindung“. Die Verbindung
30 erscheint also als etwas, als eine Art Merkmal an der Gruppe (nicht,
wie es zunächst scheinen möchte, an dem „A und B“, das hier gar
kein Gegenstand ist). „An der Gruppe“ ist ein Ganzes, das diese
Form einschließt. Und während die Gruppe erscheint, wird A zum
Objekt für sich gemacht, und im Hinblick auf das zweite Objekt
35 hat nun A das Merkmal: abstehend von B. Sowie ich das Verknüp-
fungsganze vom „Standpunkt des einen Gliedes“ auffasse, d. i. von
der Totalerfassung zur „vergegenständlichenden“ Erfassung (Partial-
erfassung) des einen „Fundaments“ (Träger der Form) übergehe,
174 explikative und prädikative synthesen

zeigt es ein Merkmal, das sich wirklich konstituiert, wenn ich auf B
vergegenständlichend hinsehe. Ich erfasse es wie ein Merkmal, als ein
von A gehabtes, gehabt von A „in Bezug auf B“. Ebenso A rechts
von B, über B etc.
Nr. 10

D ie We is en d er E rf as sun g und ih r er S yn th es i s1

§ 1. Die Konstitution einer gegenständlichen Einheit


vor ihrer Erfassung. Das Verhältnis zwischen
5 der Gesamterfassung eines Gegenstandes und der
Sondererfassung seiner Teile und Momente. Die
Hinwendung zum Gegenstand mit und ohne Explikation

Damit etwas, ein Gegenständliches „erfasst“, Gegenstand der


Aufmerksamkeit sein kann oder des bloßen Bemerkens, muss es
10 schon „konstituiert“ sein. Das Merken wendet sich ihm zu: Seiner-
seits „fällt es auf“.2 Ein starker Ton fällt auf und wird bemerkt. Ich
wende mich ihm zu. Er steht als Einheit da, dauernd etc. Aber was
heißt da „konstituiert vor dem Bemerken“? Wie trägt der Ton vorher
seine Einheit in sich, bzw. wie konstituiert sich bewusstseinsmäßig
15 Einheit des Tones vor dem Bemerken? Nun, in gewisser Weise trägt
die Tonempfindung ihre Einheit in sich, in der Art, wie sich an das
Moment des „Jetzt“ die Retentionen anschließen etc. Wir konsta-
tieren das in Hinblick auf die Weise, wie sich das Bemerken und
gar Aufmerken aus dem Tonbewusstsein „herauszieht“ und umge-
20 kehrt, wie es als ein Blickstrahl hineingeht und den „Gegenstand“
heranbringt und dabei zum aufgemerkten macht. Freilich sind das
schwierige Sachen.
Wie steht es mit transeunten Einheiten, z. B. die okkulomotori-
sche Einheit eines Farbenflecks? Ist sie Einheit dank eines einheit-
25 gebenden, umgrenzenden Blicks? Aber wie soll der Blick einigen,
wenn er nicht schon auf das Eine gerichtet ist? Die unter gleichen
„Umständen“ immer wieder auftretenden Empfindungsinhalte or-
ganisieren sich nicht zu bloßen Folgen von Empfindungsinhalten,

1 19. 9. 1911.
2 Über die Unterschiede der Aufdringlichkeit zwei Blätter in PPP zu Anfang =
Husserliana XLIII/2, Beilage VII: Das Sich-Aufdrängen eines Objekts als Reiz zur
Zuwendung (S. 188).
176 explikative und prädikative synthesen

sondern es konstituiert sich eine Einheit, und ihr wendet sich der Blick
zu. In diesen Beziehungen bedarf es ausführlicher Erörterungen.
Wic ht ig e Un t ersch ie de sind folgende:
1) E s kan n ei n E i nh ei t lic he s e rf as st w e rd e n, e i n Ge g e n-
5 st an d , so d as s k ei ne Te il e ode r Mo m e nt e a n i hm d u rch
S on d er erf as sen a usg ez ei c h ne t si nd. Das Letztere wird zwar
häufig der Fall sein, muss aber nicht der Fall sein. Zum Beispiel,
ich erfasse im indirekten Sehen einen visuellen Gegenstand, der so
„verworren“, so undeutlich erscheint, dass ich bei bestem Willen
10 in ihm kaum etwas Besonderes unterscheiden könnte. Ich bin ihm
dauernd zugewandt, ich verändere die Blickrichtung stetig, und stetig
erscheint er mir als einer. Halten wir uns jetzt aber in der Sphäre
des „deutlichen“ Sehens, in der Sphäre, wo das Erscheinende im
Allgemeinen Möglichkeiten gibt, um vielerlei „Einzelheiten“ abzu-
15 scheiden und sonderzubeachten. Zum Beispiel dieser Aschenbecher
hier: Ich bewege mich hin und her, nähere mich oder entferne mich
und kann dabei o hn e S on d erb eac ht u n g v on E i nz el he i t en a uf
d i e Ei n he i t de s Ga n ze n ger ic ht et s ein. Im Allgemeinen werden
dabei Ei n z e l h e i t e n g e g e be n s ei n, sich schon entgegendrängen,
20 aber doch nicht durch eigenes Für-sich-Erfassen herausgenommen.
Ich kann also den Gegenstand überblicken und als Einheit in einer
Kontinuität von Erscheinungen erfassen, aber ohne jede Verdeutli-
chung, mindestens zunächst, ein „Weilchen“.
2) Demgegenüber haben wir das a n a l ys i er e nd e B e t r ach te n
25 d e s G eg ens t a nd e s, das Du r c h l a uf en seines Inhalts in immer
neuen Heraushebungen und Für-sich-Erfassungen, aber auf dem
Grund der Einheit der Gesamterscheinung und Gesamterfassung.
Dabei haben aber sowohl die G es a m t e r fa s s un g wie die So nde r-
er fas s u ng ihre Eigentümlichkeiten. Man möchte hier fragen: Was
30 ist denn dabei wirklich „gegenständlich“ erfasst, etwa zweierlei, der
ganze Gegenstand und daneben der Teil, das Moment etc.? Ich be-
trachte den Gegenstand, diese Kupferschale. Mein Blick „durchläuft
sie“; ich bleibe mit ihm jetzt einen Moment an der Umrandung hän-
gen und an ihr wieder bei einer glänzenden Stelle, einer Abweichung
35 von der gleichmäßigen Richtung. Dann springt der Blick über auf eine
breite Glanzstelle und geht dann ein Stück weiter, dem wechselnden
Glanz, der Glätte nach. Dann fallen die Buckel auf, und die Gruppe
der Buckel ist gehoben; ich durchlaufe sie usw.
text nr. 10 177

Es scheint mir nun, dass man sagen muss, dass dabei immer-
fort nur ein ab gez i elt e r „Geg ens t an d“ ist, korrelativ: eine Ein-
heit der Apprehension, eine Einheit der Erscheinung liegt zugrunde,
in der eben Eines, ein Gegenstand, erscheint, und dieses Eine ist
5 das Zielobjekt der Zuwendung1. Innerhalb dieses einen Gemeinten,
nicht nur Gesehenen, sondern Abgesehenen, kommt nun bald dieses,
bald jenes zu besonderer Heraushebung, zu besonderer Klarheit und
Deutlichkeit. Aus dem Gesamtinhalt hebt sich etwas heraus. Manch-
mal hebt es sich bloß heraus; manchmal wird aus dem Inhalt des
10 Erscheinenden und als Ziel Fungierenden, des eigentlichen Objekts
der Aufmerksamkeit, ein Moment nicht nur herausgehoben, sondern
auch „näher“ gebracht, wobei sich der Inhalt in dieser Hinsicht näher
bestimmt und klärt, eventuell bereichert (ohne Bereicherung: wenn
ich abwechselnd bei ruhendem Blick bald auf Umrandung, bald auf
15 den Glanz „achte“, aber dem Gegenstand und nicht diesen Einzel-
heiten zugewandt bin).
Wenn ich mich in diese Sachen so recht vertiefe, scheint es mir,
dass nicht zweierlei und mehrerlei „Gegenstände“ zu unterscheiden
sind, sondern, solange nichts weiter vorliegt wie dieses durchlaufende
20 Betrachten der Kupferschale, nur ein „G eg en s ta nd“2. Aber was
heißt hier Gegenstand? „Eigentlicher“ Gegenstand der Betrachtung,
des Aufmerkens in einem ausgezeichneten Sinn, sollen wir etwa sagen
S u bs t r a t? „Gegenstand“ ist die Schale, und sie ist es in den man-
nigfaltigen Erscheinungen, und sie kommt zur Gegebenheit nur in
25 solchem „Durchlaufen“ und solchen in einheitlicher „Betrachtung“
geeinigten Erscheinungen. Dieser Gegenstand hat Gruppen von Ei-
genschaften, und er kommt nur zur Gegebenheit, wenn die betref-
fenden Eigenschaften in dieser Weise zur „Einzelerfassung“ kommen
innerhalb der kontinuierlichen Einheit des Die-Schale-Betrachtens.
30 Das „Gegebenheitsbewusstsein“ ist ein gewisses Erfassen des Ge-
gebenen, und zwar sein Erfassen in kontinuierlicher Einzelbetrach-
tung, Näherbestimmung. Andererseits, die Erscheinungen könnten
ebenso ablaufen, ohne dass der „Gegenstand“ wirklich „unser Ge-
genstand“ wäre und ohne dass er als Objekt der Betrachtung, der
35 Erfassung, des Mit-ihm-sich-Befassens-und-ihn-Erfassens, zur Ge-

1 Zielobjekt = Substrat.
2 = Zielgegenstand, Substrat.
178 explikative und prädikative synthesen

gebenheit gebracht wäre. Ich blicke etwa genau ebenso über die
Schale hin, bin aber mit meinen Gedanken ganz woanders: Ic h
b in a uf den G e gen st an d „ n ic ht a uf m er k sa m “. Es fehlt den
Erscheinungen oft Zusammenhang und Einheit. Aber sie enthalten,
5 aber uns „verborgen“, den Gegenstand. Er wird uns offenbar, es
wird ein aktueller Gegenstand erst gegeben in der Hinwendung der
Aufmerksamkeit und im Spiel dieser Aufmerksamkeitsmodi. Und
diese Hinwendung gibt sich als Ich-Hinwendung, und das Ich wendet
sich im eigentlichen Sinne „dem Substrat“ zu. Im Durchlaufen bin
10 ich immer dem Gegenstand, dem Substrat, und nur ihm zugewandt.
Und doch kommt von ihm das und jenes zu besonderer Beachtung?
A l s o bi n i c h n i c h t d o c h de n E ig ens cha f ten , de n T e il e n
z ug e w a n d t u nd si nd  s ie e ben fa ll s m e ine G eg en st änd e?1
Aber da ist die Sachlage eigenartig und schwer zu beschreiben.
15 Die Teile sind nicht der „eigentliche Zielgegenstand“, nicht um ih-
retwillen, um ihrer selbst willen gegenständlich, die Farbe, der Glanz
kein letztlich abgesehener Gegenstand. Wenn ich im durchlaufenden
Blick am Glanz haften bleibe, ihn fixiere (eventuell im doppelten
Sinn), so ist nicht der Glanz in letztem Grund mein Gegenstand,
20 sondern die Schale, aber nach ihrem Glanz.2 Ist der Glanz wirklich
mein „letztlich abgesehener“ Gegenstand, so ist es ganz irrelevant,
ob er der Schale zugehört oder dem Samt. Dem Glanz als letztlich
abgesehenem Gegenstand zugewandt zu sein, ist darin nicht der
Schale zugewandt zu sein, sondern eben einzig und allein dem
25 Glanz. Demgegenüber bin ich aber jetzt in der Hinwendung zum
Glanz dem glänzenden Gegenstand, nämlich ihm, sofern er in diesem
Glanz sozusagen sein Leben hat, zugewandt. Und so durchlaufend,
durchlaufe ich eben ohne „eigene“ Vergegenständlichung der Teile
und Momente immer den Gegenstand. Ich sehe ihn, indem ich mir
30 ihn nach dem und jenem ansehe.
Eine besondere Beachtung erfordert die Sonderung dieses Ver-
hältnisses gegenüber der Synthesis, die das Relationsurteil voraus-
setzt. Und zwar handelt es sich um Synthesis hier von Ganzen und
Teilen.

1 Gegenstände in gewissem Sinn ja, aber nicht Gegenstände der Betrachtung, nicht
Substrate im prägnanten Sinn.
2 Ist das nicht eine Analogie mit dem Um-willen in der Gemütssphäre?
text nr. 10 179

Der Unterschied zwischen Explikand, Subjekt, Hauptsubjekt etc.


fällt weg, wenn wir bloße schlichte Zuwendung haben. Aber von
vornherein kann schon der Gegenstand als „Objekt des Interesses“,
als thematischer, als nominales „Objekt“, gefasst sein, und das ist
5 es bei Beginn jeder Explikation. Sollen wir sagen, ein Gegenstand
sei Substrat auch da, wo sein Erfassen, die Hinwendung zu ihm,
si c h n ic ht exp li z ier t, in keinem „Einzelbetrachten“ sich bietet?
Gewiss, es ist ein Gemeinsames da: das dem Totalgegenstand Zuge-
wandtsein, etwa während er sich nähert und entfernt, aber einmal
10 ohne Explikation und das andere Mal mit Explikation. Im letzte-
ren Fall haben wir aber das Eigentümliche der „Totalperzeption“
und, auf ihrem Grund, von ihr gleichsam umspannt und sich mit ihr
deckend, die Partialperzeption. Herrschend-dienende Hinwendung
waltet aber in beiden; andererseits eine Funktion der „Synthesis“ in
15 einem gewissen Sinne. Dabei hat der stetig einheitliche Gegenstand
der Totalzuwendung eine Auszeichnung: Er allein kann als Substrat
bezeichnet werden (was hier beschrieben ist, ist die Nominalform, die
des „Bestimmbares überhaupt“ gegenüber dem Subjekt).
Doch die Terminologie macht Schwierigkeit. Wir sagen doch alle:
20 Wir seien Gegenständen, sinnlichen Gegenständen, Zahlen, Sachver-
halten aufmerksam zugewandt. Und mit mehr oder minder konzen-
trierter Aufmerksamkeit seien wir diesen Gegenständen zugewandt.
Und was da Konzentration besagt, ist wohl im Allgemeinen etwas
ganz anderes, als wir oben im Auge hatten, nämlich jenes bevorzugte,
25 besondere, in der Regel näherbringende und bestimmende Betrach-
ten von Einzelheiten, durch welches hindurch sich das aufmerksame
Betrachten eines Substratgegenstandes vollzieht.

§ 2. Thematisches Meinen und Interesse. Das


Sich-Näherbringen einer Gruppe von selbständigen
30 Objekten durch Einzelerfassung ihrer Glieder

Es ist auch zu überlegen, wie jenes Objektivieren, Zum-Objekt-


Machen und -Haben, M i t -e t w a s -a l s- Su bs t r a t g e g e ns ta n d-
B es ch ä f ti g t s ei n zu dem steht, was ich wiederholt als th em ati -
sc he s Me i n e n beschrieben habe. Wenn ich im Theater bin, sind die
35 Vorgänge des Schauspiels, alles, was sich auf der Bühne „abspielt“,
180 explikative und prädikative synthesen

mein Thema. Die „störenden“ Vorgänge im Zuschauerraum, die


meine Aufmerksamkeit gelegentlich „vom Thema ablenken“, sind
eben nicht zum Thema gehörig. Jetzt, im wissenschaftlichen Nach-
denken über gewisse schwierige phänomenologische Themata, sind
5 diese, wie schon der Ausdruck besagt, das Thema, nicht aber die Stim-
men, die von der Straße her meine Aufmerksamkeit vorübergehend
erzwingen. Da s Th ema t i sc he i st aus g eze i ch net. Wir sprechen
auch von Z uw en d un g m i t I n t e re s s e. Was das auch immer mit
Recht besagen mag, eine phänomenologische Auszeichnung hat die
10 thematische Objektivation gegenüber der Objektivation schlechthin.
Objektivation nämlich, wenn auch nicht im besonderen Sinne des
Themas, so doch im Sinne des Zum-Gegenstand-Habens, Auf-ihn-
speziell-Gerichtet-und-mit-ihm-Beschäftigtseins, ihn betrachtend,
eventuell einzelerfassend, ist beides.
15 Im Fall eines „herrschenden theoretischen und praktischen Inter-
esses“ sind es im Allgemeinen viele Objektivationen, die ihre Aus-
zeichnung und Zusammengehörigkeit haben. Es kann hier vorkom-
men, dass eine einzelne Objektivation sich einmal so einordnet und
unterordnet der Gesamtobjektivation, dass mit ihr das thematische
20 Interesse im Ganzen sich auswirkt und in der Einzelbetrachtung die
Intention auf das Ganze lebt und sich befriedigt (das Ganze dadurch
nähergebracht wird etc.), und ein andermal kann sich die Einzelbe-
trachtung verselbständigen, den Faden zur Gesamtbetrachtung ver-
lieren, ihr Objekt wird nun zum Objekt für sich, das nachträglich erst
25 der Einordnung in das Ganze, der Erweiterung der betrachtenden
Umspannung bedarf.
Ich betrachte mit Interesse die Einheit eines vielgestaltigen Vor-
gangs, etwa einen Menschenauflauf. Einzelne Objekte sind da Ob-
jekte der Zuwendung und Betrachtung, und doch betrachte ich mit
30 Interesse den ganzen Vorgang, den Menschenauflauf. Im einzelnen
Betrachten übe ich zugleich Gesamtbetrachtung; auf das Gesamte
bin ich gerichtet und durchlaufe seine gegenständlichen und für sich
gegenständlich werdenden Einzelheiten. Aber doch sind sie nicht
getrennte Gegenstände für sich, die etwa in Relation zur Gesamtheit
35 gesetzt sind, sondern sie sind in der einheitlichen Gesamtbetrachtung
einzeln betrachtete Glieder.
Wir haben hier eine thematische Einheit, aber auch die Einheit
einer Objektivation, eines Gegenstandhabens, Gegenstandbetrach-
text nr. 10 181

tens. In anderen Fällen thematischer Beschäftigung, wie in denen


eines wissenschaftlichen Gedankengangs, ist es anders. Wir gehen
etwa von Satz zu Satz über, und die Gedankenbewegung hat ein
Ziel; wir zielen auf eine Schlussfolgerung. Wir durchlaufen hier nicht
5 eine einheitliche Gegenständlichkeit, sie uns näher bringend und ihr
beständig als Ganzem zugewendet als unserem Objekt. Im Beweisen
bietet jeder Schritt ein Objekt, aber die vorangegangenen Schritte
sind nicht von der Einheit einer umfassenden Objektivierung befasst,
und jeder neue Schritt bringt nicht bloß das beständig bewusste Ge-
10 samtobjekt näher.
Freilich, der gesamte Beweis ist eine Einheit. Das soeben Objekt
Gewesene wird nicht außer Augen verloren, ich behalte es in gewisser
Weise im Bewusstsein, es übt noch weiter seine gründenden Funk-
tionen, ich muss eventuell darauf zurückgreifen, muss es daher noch
15 behalten usw. Man könnte sagen: Ich habe da ein thematisches Ziel,
das ich erreichen will und nur durch einen mehr oder minder unbe-
stimmt aufgefassten Weg erreiche. Es ist wie bei einer Wanderung zu
einem physischen Ziel; ich habe immer neue Wegstücke vor mir im
reellen Blick. Alles gehört zu meinem Wanderungsthema. Im Voraus
20 habe ich eine unbestimmte Vorstellung von einem gewissen Weg zum
Ziel hin, die sich Schritt für Schritt bestimmt und in realisierender
Anschauung in Aktualität und Realisierung verwandelt. Es kann sein,
dass mich das Ziel gar nicht interessiert, dass ich den Weg nur gehe,
um die Landschaft kennenzulernen (oder „ihn“ kennenzulernen).
25 Nun, dann ist in der Tat der Weg selbst Thema und immerfort Objekt.
Ebenso wenn ich einen theoretischen Weg als Thema habe: Ich will
ein Buch studieren, und nun ist, was ich lese, immerfort mein Thema;
jeder neue Gedanke ist zwar etwas für sich und doch aufgenommen
als Glied des Gesamtthemas.
30 Da spielen also überall W i ll e ns t e n d e nz e n ihre Rolle und Inter-
essen wirklich als Gemütsphänomene. Thema ist alles, dem ich in Ob-
jektivation zugewandt sein soll bzw. was in den Kreis meiner Objek-
tivation, meiner Gegenstandsbetrachtung und eventuell in den Kreis
meines Urteilens, aber auch in den Kreis meines Fühlens und Wollens
35 „hineingehört“. Das zu untersuchen (theoretische und praktische
Themata, Objekte und Einheitszusammenhänge theoretischer, ästhe-
tischer, praktischer etc. Interessen), ist eine Sache für sich (ein Thema
für sich, ein Zusammenhang, der „ein eigenes Interesse fordert“).
182 explikative und prädikative synthesen

Schließen wir das aus, diese Fragen nach den durch eine Einheit des
Interesses geeinigten und phänomenologisch ausgezeichneten Ge-
genständlichkeiten. Gehen wir nun auf das obige Beispiel zurück. Wir
dachten uns ein einheitliches Interesse, gerichtet auf einen Menschen-
5 auflauf. Lassen wir das Interesse beiseite, und halten wir uns an die
bloße „Objektivation“, d. h. an die bloße kontinuierliche Einheit der
Gegenstandsbetrachtung, in welcher immerfort der Menschenauflauf
gegenständlich ist und die Einzelbetrachtung nun selbständige Ob-
jekte, Menschen, betrifft. Hier ist es doch völlig klar, wird man sagen,
10 dass es sich um Einzelerfassungen handelt, die selbst den Charakter
von Objektivationen haben. Ich bin freilich nicht bloß den einzelnen
Menschen zugewandt, sondern auch dem ganzen Auflauf; aber ich bin
ihnen doch zugewandt, sie sind meine Objekte. Oder ich betrachte
im Park eine B a u mg ru p pe. Ich betrachte sie, indem ich einzeln die
15 einzelnen Bäume mir ansehe und sie wiederum betrachte.
Ist unsere obige Beschreibung also richtig? Ich sagte dort doch,
dass, wenn das Ganze und dann die Teile zu Gegenständen für sich
gemacht würden, dass dann eine Synthese erforderlich sei, um sie
zur Einheit zu bringen, wodurch sich in partialer Identifizierung ein
20 Sachverhalt, ein Ineinander oder Aneinander konstituiere.1 Nun ist
es doch klar, dass hier eine solche Synthese sich nicht vollzieht.
Der uns interessierende Unterschied besteht offenbar auch hier. Die
Baumgruppe in ihren Gliedern betrachten, den Menschenauflauf in
Einzeldurchlaufung seiner Glieder betrachten, das ist nicht, ein Akt-
25 bewusstsein des Inhalts „eins im anderen“ vollziehen.
Ich sehe aber doch, dass ich in meiner Darstellung ursprünglich
nicht völlig korrekt gewesen bin (schon verbessert im Text). Man darf
nicht sagen, dass die Einzelobjektivationen keine Objektivationen
seien, sondern darauf muss man sich beschränken, einen bestimmten
30 phänomenologischen Unterschied klarzustellen, der die Weise der
Objektivation, die Weise des Zum-Gegenstand-Habens und des Den-
Gegenstand-Erfassens-und-Betrachtens betrifft. In dem ursprüngli-
chen Beispiel handelt es sich um ein einzelnes selbständiges Objekt,
und seine Einzelbetrachtung führte auf dessen Glieder, dessen For-
35 men, Farben und sonstigen „Eigenschaften“ oder Beschaffenheiten.

1 Cf. 5a = S. 124,33–126,21, es gehört mehr dazu.


text nr. 10 183

Im letzten Beispiel handelte es sich um eine Gruppe selbständiger


Objekte, die aber als Gruppe ein Objekt der Erfassung und Betrach-
tung war.1
Selbs t änd igk ei t d es O b jek t s b es ag t ni c ht „ Se lb st ä nd ig -
5 k eit “ d er A u f f as su ng un d O b j ek ti va ti on. Ein selbständiges
Objekt braucht überhaupt nicht eigenes abgesehenes Objekt einer
Betrachtung zu sein, einer Zuwendung zu ihm und Beschäftigung mit
ihm, einer Sondererfassung und Sonderbetrachtung. Es kann darum
doch aufgefasst sein und kann z. B. aufgefasst sein als Einzelnes inner-
10 halb einer Gesamtgruppe, die als Gruppe aufgefasst und erfasst, be-
trachtet ist. Es kann sich nun die Gruppe aufdrängen und eine Zuwen-
dung zu ihr und ein Erfassen von ihr (als schlichtes Totalobjekt) statt-
haben, ein Erfassen, das die Gruppe in einem Schlage fasst, wobei das
Einzelaufgefasste, nämlich das innerhalb der Gruppe als Glied fun-
15 gierende Selbständige, in keiner auszeichnenden Erfassung erfasst ist.
Nun gehört es aber zum Wesen eines solchen Objekts (bzw. korrelativ
zum Wesen einer Gruppenerfassung), dass es „Näherbetrachtung“
zulässt, ein Näherbringen, ein Verdeutlichen und Klären, ein Erfüllen
der „verworren-einheitlichen“ Auffassungsstrahlen und der durch
20 diese Einheit hindurchgehenden Gegenstandserfassungen, und zwar
ein solches Näherbringen, das sich durch die Einzelerfassung und
-betrachtung der Glieder vollzieht.
Die neuen Objektivationen, in denen sich dies vollzieht, d i e E i n-
z e le r fa s s u n g en u nd B e t r a c h t u ng e n de r G li e de r, s i nd i n
25 g e w i ssem S i n n e un s e l bs t än d i g , s i e „ g e l te n n ic ht f ü r s ic h “.
Sie machen zwar die Einzelgegenstände zu Gegenständen, aber nicht
zu Gegenständen „an und für sich“ (um ihrer selbst willen); vielmehr
in ihrer Einzelbetrachtung expliziert sich, verdeutlicht sich, bringt sich
uns näher die ganze Gruppe, die beständig der Gegenstand an und
30 für sich ist (eigentlich abgesehener). Eventuell kann das schlichte und
verworren-einheitliche Gruppen-Auffassen und -Erfassen (wobei die
Gesamtgruppe das Totalobjekt, das Substrat, ist) eine Gruppe betref-
fen, die selbst wieder in Gruppen sich gliedert, und dann fordert es das
Wesen dieses Gegenstandes (bzw. das Wesen einer so gearteten Ob-
35 jektivation und Auffassung), dass zuerst die Untergruppen Erfassung

1 Cf. Z3 = S. 168,14–169,12.
184 explikative und prädikative synthesen

und Betrachtung erfahren und dann die Glieder dieser Gruppen.1


Dann sind die Erfassungen der letzten Glieder in höherem Grad,
in höherer Stufe „unselbständig“; sie gelten nicht für sich, sondern
zunächst als dienende Glieder der Objektivation der nächsthöheren
5 Stufe, und diese selbst wieder sind dienend mit Beziehung auf das
einheitliche Gesamtobjekt.
Immer haben wir zu unterscheiden s c hl ich t e u n d ex p liz ier en -
d e O bje k t i v at i o nen und innerhalb der explizierenden, die ihrem
Wesen nach kompliziert sind, herrschende und dienende, wobei aber
10 die herrschenden in den dienenden herrschen und diese den herr-
schenden einverleibt sind. Eine dienende, einverleibte Objektivation
objektiviert nicht als Objekt an und für sich, primär als Abgesehe-
nes, sondern nur als Explikation eines selbständigen, herrschenden
Objektivierens. Explikationen vollziehen, das ist nicht, „synthetische
15 Einheit“ vollziehen.

§ 3. Verdeutlichungsstellen als Residuen


von vorherigen Partialerfassungen. Die
Frage, ob sich Auffassungsartikulationen
von Residuen unterscheiden lassen

20 Wir können unterscheiden und haben oben schon unterschieden


(p. 1 = S. 176):
1) Ein einheitliches Objekt, schlicht aufgefasst und zum eigenen
Objekt gemacht, nichts von Gliederungen oder Hebungen in der
Auffassung.
25 2) Tritt dann Einzelbetrachtung ein, wird das Objekt zum To-
talobjekt, auf dessen Grund Partialerfassungen statthaben, so än-
dert sich im Fortschreiten der Einzelerfassungen die Totalauffas-
sung. Die Partialerfassungen sinken ab und neue werden aktuell:
Ihre Objekte stehen „im Konzentrationspunkt der Aufmerksam-
30 keit“ (sind geistig fixiert). Aber das Totalobjekt steht nach den nicht

1 Wir könnten sagen: primäres, herrschendes Totalobjekt, sekundäres Objekt, erster


oder zweiter etc. Stufe; Totalerfassung (Totalbetrachtung, Totalzuwendung), Partial-
betrachtung in erster, zweiter Stufe.
text nr. 10 185

im Konzentrationspunkt stehenden Partien in anderer Weise da.


Die „früheren Konzentrationen“ bzw. ihre Residuen haben noch
ihre bevorzugten Objektpartien, und diese sind sozusagen auf das
Totalobjekt aufgetragen, die Bevorzugungen in dasselbe eingetra-
5 gen. Es hat nun „Bereicherungen“ und dabei Hebungen, Betonun-
gen, und das Betonende sind die Ko n ze nt ra t io ns nac hl eb se l, d. i.
die Überlebsel der Partialerfassungen auf dem Grund der dama-
ligen Totalerfassung. Das Objekt ist verdeutlichtes Objekt, es hat
Verd eut l ic hu ngs st el len, und eventuell immer neue. So wenn ich
10 diesen Aschenbecher näher betrachte, jeden Buckel der Verzierun-
gen, die Farbe, jede Glanzstelle etc. Im Einheitsbewusstsein „decken
sich stetig“ die immer neuen Explikationsgestaltungen, sie decken
sich, sofern immerfort die Totalerfassung Totalerfassung „desselben“
ist, desselben, das jetzt so und dann so expliziert, partial geklärt und
15 verdeutlicht war und in eigenartiger modifizierter Weise es mit jedem
Schritt ist, sofern das Vergangene eben seine Nachlebungen hat, die
sich als Betonungen jetzt bekunden. (Das „Infolge“, das das Bekun-
den andeutet, ist etwas Phänomenologisches!) Vielleicht ist das noch
feiner zu beschreiben.
20 3) Ist der ganze Prozess abgelaufen, und w en de i ch m i c h e i ne m
a n d e r e n Ob j e kt zu, kehre nun aber wieder zu meiner Kupfer-
schale zurück, s o t r ä g t di e j et z i g e A u f f as s un g n oc h di e Z üg e
d e s w i e de r a uf l e be n de n P r oz es s e s: nämlich die Auffassung ist
nicht einfach verworren-einheitliche Auffassung, sondern ich finde
25 in der erscheinenden und zum Gegenstand der eigenen Zuwendung
gemachten Einheit die verdeutlichten Stellen, Abhebungen einzel-
ner Buckel, Abhebungen der vorhin in Partialerfassung bevorzugten
Glanzstellen etc. Ob klar bewusste Erinnerung an das frühere Partial-
auffassen und Durchlaufen vorhanden ist oder nicht, sicher ist, da ss
30 in ne r h al b d e s v e r w o rr en - ei n h e i t l i ch e r fa s s t e n O bj e k t s,
da s k e i ne P a rt i a l e rf a s s u n g e n a k t ue l l t r ä g t, St e l l en de r
G e h obe n h e it s i n d, un d z w a r g a n z ä hnl i c h w i e w äh r e nd
e i ne s E x p l ik a t io n sp r o z e ss e s: abgesehen von der in aktueller
Explikation hervorgehobenen Stelle.
35 4) Und so werden wir überhaupt im Allgemeinen, wenn auch
nicht immer, bei der schlichten (nicht explikativen) Objekterfassung
eine Anzahl Verdeutlichungsstellen haben, sozusagen kataleptische,
die innerhalb der Gesamtauffassung Sonderauffassungen besagen,
186 explikative und prädikative synthesen

und nicht bloß Sonderauffassungen, sondern eigentümliche Modifi-


kationen von Sondererfassungen, die nicht den Charakter von bloßen
Erinnerungsvergegenwärtigungen haben: Sie gehören zu dem leben-
digen Bestand derjenigen Objektauffassung, die der Totalerfassung
5 zugrunde liegt. Das Objekt steht nicht nur überhaupt da, sondern als
das dieses und jenes habende: obschon in verworrener Weise, nicht
in explizierter, was besagen würde, in einer Explikationskette neu
erzeugt. Das Objekt hat natürlich noch manches andere, was erst
die Explikation herausstellt. Aber als dieses Habende ist es noch
10 nicht besonders bewusst, während trotz der Ungeschiedenheit der
Zuwendung (sie ist Totalerfassung ohne Explikation) in Bezug auf
seine Buckel, Lichter etc. schon Sonderung statthat.
Wir haben also D eut li c hk e it als: a) Abhebung, bessere oder
minder gute Abhebung innerhalb der Auffassung, in modifizierten
15 Aktcharakteren (Erfassungscharakteren) bestehend.1 b) Demgegen-
über eine andere Deutlichkeit, eine originäre, die darin besteht, dass
Partialerfassen Schritt für Schritt statthat, dass in jedem Schritt etwas
partial erfasst ist, aber alles Übrige in lebendiger Nachwirkung als
Deutlich-Gewordenes und in das Totalobjekt Eingetragenes. Das
20 besagt aber nicht das Eigens-im-Griff-Behalten. In Wiederholung des
Prozesses wird die Verdeutlichung immer vollkommener, die Abhe-
bung immer lebendiger und schärfer, die Verfügung darüber in der
vergegenwärtigenden Rückwendung immer freier. Der „schlichte“
Blick auf das Objekt, in verteilter Aufmerksamkeit, nicht am Einzel-
25 nen haftend und sich darin konzentrierend, enthält eine Reihe scharf
markierter Hebungen im Objekt, schärfer als vordem.
5) Wir werden sagen dürfen: W a nn i m m e r e in s c hl i cht er f as s -
te s T ot a l o bj e k t i n de r s ch l i ch t e n E r f a s s ung g e gl i ed er t
da s te h t o de r g a r a l s e i ne Gr u p pe , Me n g e d a st e ht , da i s t
30 d ie G l i ed er u n g ko n s t it ui e r t d u r c h e in e g e g l i e de r t e Au ff a s-
s un g , d i e ih r e rs e i t s i n Mo ti v a t i on e n v on P a r ti a l e r f a s s un-
gen i h re Q u e l l e h a t. Es liegt gewissermaßen da s a bg ek ür z t e
E r geb n is e in e s P r oz e ss e s v o n E i n z e l a uf fa s s un g e n i n Tot a-
l e rf as s u ng e n, in beständiger Einheitsdeckung des totum und der

1 Der erscheinende und schlicht erfasste Gegenstand (als solcher) hat kataleptische

Momente.
text nr. 10 187

Teile in den sich modifizierenden Einzelauffassungen vor. Es liegt eine


„Au f f a ssu ng sin t en t ion“ vor, die sich erfüllt in der Reaktivierung
eines solchen Prozesses. Zum Beispiel, ich erfasse eine Allee in einem
Blick als Allee. Jeder Baum hat seine Auffassung darin, das totum ist
5 in der Auffassung artikuliert, obschon nur eine Totalzuwendung da
ist.
Freilich ist die Frage, wie weit man darin gehen darf. Wenn ich den
Teil der Allee nehme, der ins deutliche Sehen fällt, und die Bäume, die
scharf dabei auseinandertreten, so mag das gehen. Aber der Teil der
10 Allee, der indirekt gesehen wird und deutliche Unterscheidung der
einzelnen Bäume nicht gestattet? Nun, ich hätte da einzelne Hebungs-
punkte, in der Totalobjekterfassung einzelne Sonderauffassung; für
das Übrige aber nur die vage Meinung gerichtet auf einen Prozess von
Sonderauffassungen: so, wie ich bei dem wirklichen Durchlaufen der
15 Baumreihe eine Reihe artikulierter Erfassungsresiduen habe, aber
darunter liegend eine unbestimmte Intention, die ihrem Wesen nach
wieder Aktualisierung findet durch eine Reihenexplikation.
Ich meine aber, es ist ein Unterschied, ob ich ein vages Totalobjekt
habe mit einer völlig unbestimmten Intention auf irgendwelche Ein-
20 zelerfassungen, auf mögliche Partialbetrachtungen oder ob ich ein
gegliedertes Totalobjekt habe, wo schon bestimmte Intentionen auf
bestimmte Einzelerfassungen vorgezeichnet sind.
Dabei ist es allerdings noch öfters zu überlegen, ob man wirklich
sagen darf, dass sich die Nachlebungen, die „Residuen“ der Einzeler-
25 fassungen, in das Totalbild eintragen und es gliedern, ob also, wenn
wir jetzt aufblicken und die Allee ansehen, die Auffassungsartikula-
tionen mit solchen Residuen phänomenologisch zu charakterisieren
sind, oder ob nicht vielmehr zu sagen ist: Im Explikationsprozess
verbleiben natürlich von jeder Sonderzuwendung Residuen, aber
30 das Ergebnis des fortschreitenden Explizierens bestehe in einer mit
jedem Schritt geänderten Totalvorstellung, die in ihrer Materie Ar-
tikulationen hat, und schon diese seien zu unterscheiden von den
Residuen der Partialerfassungen; und erst recht, wenn wir einen ers-
ten Blick auf eine Gruppe werfen oder auf ein gegliedertes Ganzes,
35 so haben wir in der Materie der Zuwendung eine Artikulation, aber
keine Residuen. Wenigstens spielten die nicht die wesentliche Rolle,
wenn sie überhaupt da seien. Zum Wesen einer solchen Vorstellung
gehört es natürlich, dass sie Explikation zulässt und dass die sich
188 explikative und prädikative synthesen

in Ketten von Einzelerfassungen selbständiger Objekte vollzieht etc.


Das alles ist also zu überlegen.

§ 4. Die Einheit der Zusammennehmung


gegenüber der Einheit des Bewusstseins von
5 kontinuierlicher Totalerfassung und schrittweisen
Partialerfassungen bei der Explikation

Es kann sein, dass ich eine Gruppe in einer ungegliederten Zuwen-


dung (aufgrund gegliederter Auffassung) erfasse. Es ist aber etwas
anderes, dies zu tun (und eventuell auch die Gruppe zu durchlaufen
10 und so die ursprüngliche Gruppenvorstellung zu explizieren), dem-
gegenüber aber ein Kolligieren zu üben, eine Zusammennehmung
zu vollziehen. Willkürlich fasse ich dieses Buch und jenes andere
Buch zusammen, greife sie aus dem Bücherhaufen heraus und nehme
sie zusammen, oder dieses Buch und diesen Aschenbecher usw.
15 Ich vollziehe da eine Zuwendung (Eigenerfassung) des einen und
die eines anderen, aber nicht bloß das. In einer Zusammenfassung
tue ich beides und betrachte ich jedes dieser Dinge. Das eine jetzt
„vorwiegend“ in Betracht ziehend, halte ich das andere fest, dann
das andere betrachtend, halte ich jenes fest. Ich halte fest, das
20 ist, ich halte sie erfasst: Die erfassende Zuwendung als Einsatz, als
Aktivum ist eins, das Im-Fassen-Halten ist das Dauernde, und dieses
geht dann eventuell über in spontane Akte der Explikation. Das
in die zweite Linie Gedrängte verbleibt aber in der Erfassung,
und das ist das Festhalten. So ist in einem Akt beides erfasst, der
25 eine Akt hat zwei Gegenstände, beide eigens erfasst und beide als
Totalobjekte in Partialerfassungen Explikation erfahrend, wenn auch
nacheinander.
Kann ich sagen, diese Einheit der Zusammennehmung, der Kol-
lektion, hat einen Gegenstand, das Paar, die Kollekte der beiden
30 Gegenstände? Ich denke, eigentlich kann ich das nicht sagen. In
einem abgegrenzten Bewusstsein bin ich eigens dem einen und eigens
dem anderen Objekt zugewandt und nichts weiter. Ich kann dann,
während ich die Erfassung festhalte, abermals, und zwar eine neue
Zusammennehmung üben, jetzt die des Tintenfasses und eines Ge-
35 räusches, das ich gerade höre; oder ich halte die beiden ersten Objekte
text nr. 10 189

in der Erfassung und blicke auf ein drittes Objekt hin als Objekt für
sich. Die Verbindung der beiden ist damit nicht gelöst. Es ist etwas
anderes, das dritte Objekt in die Verbindung aufzunehmen oder
neben den sonderverbundenen beiden Objekten ein neues Objekt in
5 Betracht zu ziehen. Und nun habe ich eine Einheit der Erfassung
in der Form ((A, B), C), ebenso ((A, B), (C, D)) usw. Wieder ist da
zu sagen: Jede solche komplex gestaltete Erfassung hat zu Objekten
A, B, C, … und nicht etwa (A, B) als ein Objekt und dgl.
Andererseits kann ich doch auch den Blick der Zuwendung und
10 Erfassung richten auf das Paar, auf das eine und das andere Paar, wo
dies die Objekte sind. Und tue ich das, dann fungiert die wiederholte
einzelkonzentrierte Zuwendung, das konzentrierte Partialerfassen
jetzt des A und dann des B, als Explikation, als Partialerfassen eben
(Durchlaufen) des Totalobjekts A+B. Sehen wir näher zu, so hat
15 das Vorstellen (A, B) den Vorrang vor dem kollektiven (A+B),
in dem der Inbegriff Gegenstand ist. Nämlich, um den Inbegriff
„gegeben“ zu haben, um ihn betrachtend in Selbstgegebenheit zu
erfassen, muss ich das A und das B erfassen, und in der Einheit
dieser Erfassung zweier Gegenstände konstituiert sich sozusagen als
20 ihr Ergebnis der neue Gegenstand als etwas, was ich nun erfassen
kann, und was ich nun in der Einzelerfassung der A, B explizieren
kann. Man könnte einwenden: Das sei nicht so, Gegenbeispiel sei jede
sinnlich erfasste Menge. Man würde antworten: Das seien komplexe
Gegenstände, die zu kollektiven Zusammennehmungen Anlass ge-
25 ben und zur Bildung von rein kollektiven, aber das seien nicht selbst
solche.
Das reine Zusammen, der reine Inbegriff, die reine 2 setzten voraus
ein Zusammennehmen, und erst als Ergebnis lässt sich herausfinden
und in einem neuen Blick erfassen eben die „kategorial“ neuartige
30 Gegenständlichkeit, die reine Inbegriffsgegenständlichkeit.1 Ich kann
ferner A betrachten und in eins damit B betrachten, aber nicht bloß
das: A erfassend und den Blick nun auf B richtend sind beide nicht nur
zusammengenommen, sondern sie haben auch öfter eine „Relation“

1 „Kategorial“ darf man hier aber nicht sagen. Ein Beispiel bieten: Ich vollziehe
drei Zusammennehmungen (A, B), (A’, B’) etc. und richte den Blick nun auf jedes
Paar, vor allem Denken.
190 explikative und prädikative synthesen

zueinander. Die Zusammennehmung gerade des A und des B (die


notwendig entweder als aufmerksame Erfassung die Form hat des
Übergangs von A zu B oder umgekehrt) fundiert die gebende Erfas-
sung eines „A in Relation zu B“ bzw. des B in Relation zu A, wenn
5 die Einheitsform der Verbindung beider in Betracht gezogen wird.
(Die Einheitsform ist nicht Gegenstand, aber sie tritt in den „Kreis
der Beachtung“, und Gegenstand ist A und B, nicht jedes für sich,
sondern A in Bezug auf B: das Gegenständliche des Übergangs von
A zu B in der Einheit.) In welcher Weise aber?
10 Nun, ein Ganzes, das ist ein Gegenstand, der Teile zu unterschei-
den, der Partialerfassungen zulässt. Das soll jetzt keine Definition
sein. Jedenfalls, damit Ganzes und Teil gegeben sein sollen, müs-
sen Total- und Partialerfassungen vollzogen sein. In der Explikation
fortschreitend, wird eine Partialerfassung nach der anderen vollzo-
15 gen, aber auf dem stetigen Grund „derselben“ Totalerfassung, die
durchgehend ein Einheitsbewusstsein ausmacht. So ist die kontinu-
ierliche Totalerfassung und sind die schrittweisen Partialerfassungen
alle miteinander einig. Und wir können korrelativ auch sagen, das
Ganze selbst, der Totalgegenstand, sei einer und umschließe in seiner
20 Einheit die Partialgegenstände, er erfahre in seiner stetigen Einheit
immer neue Artikulationen. Di e s e E in h ei t de s B ew us s ts ei ns,
die hier waltet, is t ni c ht z u v e r we c h s el n m i t d e r E i nh ei t e in er
Z u s a mm e nn e h mu ng , Z us a m m en f a s s u ng. Denn im Für-sich-
Erfassen und Explizieren eines Gegenstandes G habe ich eben nur
25 einen „Gegenstand für sich“, nicht mehrere. Das Zusammengenom-
mene ist jedes Gegenstand für sich. Nun kann aber a priori eine
Zusammennehmung zwischen G und irgendeinem auf seinem Grund
einzeln erfassten T etabliert werden. Nun ist das T auch Gegenstand
für sich.
30 Es bestehen für die Zusammennehmung natürlich verschiedene
Möglichkeiten. Ich kann die Eigenvorstellung T zuerst haben und
dann die Eigenvorstellung G bilden oder die Eigenvorstellung G
zuerst und dann die Eigenvorstellung T. Der Übergang von der einen
zur anderen ist noch kein Zusammennehmen. Der Übergang von
35 G zu T und ebenso ihre Zusammennehmung werden, eben weil es
sich um Ganzes und Teil handelt, einen phänomenologischen Cha-
rakter haben: Es decken sich in gewisser Weise die Gegenstände;
die Gegenstandsauffassungen haben eine gewisse Gemeinsamkeit.
text nr. 10 191

Offenbar ist aber das Erlebnis darum doch ein anderes, wenn ich auf
G explizierend gerichtet bin und die Partialerfassung des T, aber nicht
Eigenvorstellung des T vollziehe. Durch die Partialerfassung erfasse
ich hier das G eben nach diesem Bestandstück T. Damit verdeutliche
5 ich das G.1
Habe ich aber die beiden Gegenstände G und T für sich in eins ge-
nommen und weiter nichts, so haben sie zunächst miteinander nichts
zu tun in der Erfassung, obschon die Auffassungen von G und T im
Verborgenen sozusagen sich decken. Es ist, wenn es mir noch gar
10 nicht einfällt, G und T in Bezug zu setzen, auch nur zusammenzuneh-
men, und ich nur von einem zum anderen übergehe, auch schon ein
inhaltliches Verhältnis da: Der Substratgegenstand verengt sich bzw.
erweitert sich, und das gibt natürlich dem Übergangsphänomenen
seinen Charakter. Bei der Betrachtung des G und der Explikation
15 verengt sich, wenn ich von der Gesamtauffassung zur Partialerfassung
übergehe, nicht der „Gegenstand“, vielmehr das Licht der Partialbe-
trachtung fällt auf den Teil und sondert ihn, während das Substrat
verbleibt, aus diesem in dem Sonderakt aus. In anderem Sinne kann
man aber auch sagen, dass eine Gegenstandsverengerung statthat:
20 Denn hier decken sich zwei Akte, deren einer einen engeren Gegen-
stand hat als der andere (nur ist es nicht beiderseits Gegenstand für
sich).
Dagegen beim bloßen Übergang von der Betrachtung des A zu
der des B sind sich die erfassenden Akte fremd, obschon sie den
25 Objekten ihrer Auffassungen nach sich überschieben. Bei der Ver-
engerung lasse ich das Weitere in seiner umgrenzten Einheit fallen,
bei der Erweiterung die Grenzen des Engeren. Explizierend, von der
schlichten Auffassung des G übergehend zu Partialauffassungen und
eventuell dann wieder von den Einzelerfassungen rückkehrend zu
30 einer schlichten Gesamtauffassung, treten die Akte als Erfassungen
(und ihre Fortlebnisse) in eine innere Erfassungseinheit, das heißt,
die Erfassungen als solche durchdringen sich: In der Partialerfassung
expliziere ich ja die G-Erfassung; und immerfort in der Kette der

1Bloßer Übergang von G und T (jeder Gegenstand für sich) und Zusammenneh-
mung, verglichen mit Fällen der Synthese, der inneren Erfassungseinheit, zunächst mit
dem Fall der Explikation.
192 explikative und prädikative synthesen

Partialerfassungen bewege ich mich „innerhalb“ der G-Erfassung,


habe ihren neuen artikulierten Inhalt usw. Demgegenüber bleiben
die Erfassungen trotz der im Übergang sich bekundenden gegen-
ständlichen Gemeinschaft in der „Zusammennehmung“ einander
5 äußerlich.
Dasselbe gilt erst recht, wenn ich Teil und Teil in Eigenerfassun-
gen erfasse und zusammennehme. Das Ganze mag erscheinen, mag
auffassungsmäßig bewusst sein, aber es ist gar nicht erfasst und so
auch nicht dies, dass das eine und andere Teil ist, und dass sie ko-
10 ordinierte, sozusagen verbündete Teile sind: obschon der Umstand,
dass sie es sind, den Charakter der Selbst- und Eigenerfassungen
der Teile und den Charakter der Übergänge bestimmt. Der Akt
der Zusammennehmung hat davon nichts in sich aufgenommen: als
Zusammennehmung.
15 Was ist nun zu leisten, dass die Relation „G hat T“, und zwar
in dieser, mit dem Satz angedeuteten Form und vor allem Begrei-
fen, zum Bewusstsein kommt? Ich muss G zum Gegenstand für
sich machen und T zum Gegenstand für sich: Das ist gewiß. Muss
ich Zusammennehmung üben? Das ist zunächst zweifelhaft. Sicher
20 ist aber vorerst, dass ich T in G erfassen muss. Ist es nun so: Ich
vollziehe die Für-sich-Erfassung des G und die Partialauffassung
(wie bei der Explikation) des T, erfasse dann T für sich, halte aber
die Für-sich-Erfassung des G aufrecht? Das würde aber eine bloße
Zusammennehmung werden, wenn die Innerlichkeit der Partialer-
25 fassung innerhalb der G-Erfassung verlorenginge. Auch sie halte ich
also aufrecht? Das kann nur so verstanden werden: I ch h a lt e da s
R es ul tat d e r Ex p l i k a t i o n f e s t; das G als das nach T Explizierte
tritt zusammen (und wird eins in einer Synthese der Deckung der
Für-sich-Erfassungen) mit der Für-sich-Erfassung des T. Das letztere
30 Für-sich-Erfassen grenzt ab als ein Für-Sich, was in G partial Erfasstes
und es Explizierendes war und in dieser Hinsicht noch im Griff ist,
und deckt sich inhaltlich in dieser Beziehung mit dem G hinsichtlich
seines ausgezeichnet erfassten Teils.
Allerdings scheint es mir, dass zuerst G sich hinsichtlich des T
35 expliziert, T selbst erfasst wird und dass dann noch einmal Selbster-
fassung des G statthat und nun Übergang zur Selbsterfassung des T,
aber nicht als bloße Zusammennehmung, sondern als Sy n t he s i s de r
pa r ti al e n De c k un g: die dadurch statthat, dass das selbsterfasste
text nr. 10 193

T als Partialerfasstes1 in seinem Selbst zugleich als etwas vom G


Erfassendes bewusst ist.
Fragt man nun, ob man wirklich sagen kann, dass hier eine Zu-
sammennehmung eine wesentliche Rolle spielt. Man kann ja schließ-
5 lich jedes synthetische Bewusstsein, in dem Für-sich-Erfassungen zur
Einheit kommen, als Zusammennehmungen bezeichnen. Aber es
sind eben nicht bloße Zusammennehmungen. Überall, wo Synthe-
sis statthat, kann auch erst bloße Zusammennehmung statthaben:
wie auch in unserem Fall des Verhältnisses von Ganzem und Teil.
10 Ich kann erst bloße Zusammennehmung üben. Aber das ist doch
nicht nötig. Man kann wohl nur sagen, dass in jeder Synthesis eine
Zusammennehmung „liegt“, es ist darin beides schon für sich vor-
stellig, aber doch noch nicht in eigentlicher Zusammennehmung, die
eben bloß darin besteht, leer „zusammenzuhalten“, ohne Synthesis.
15 Synthesis scheiden wir also von Zusammenfassung, das Eigene der
Synthesis ist das „Innerlich-sich-Einigen“ der Für-sich-Erfassungen
gegenüber dem bloß einheitlichen Für-sich-Erfassen von mehrerem
in einem Bewusstsein, und zwar ein Innerlich-sich-Einigen, das zu-
gleich auseinanderhält und verbindet und dabei einen verbundenen
20 Gegenstand konstituiert: T in G etc.
Gehen wir vom Teil zum Ganzen über, so haben wir das Rela-
tionsbewusstsein T in G (statt G hat T). T ist Teil von G. Hier ist
es klar, dass ich, T festhaltend als für sich, den Blick erweitern und
zum Erfassen und Selbsterfassen des G erweitern muss. Das für sich
25 gesetzte T deckt sich mit dem in G verdeutlicht-abgehobenen T.
Man darf nicht verwechseln: explizierender Übergang von G zum
(T) und dann eventuell Verselbständigung des T mit der synthetischen

1 „Zugleich als Partialerfasstes“? Die Partialerfassung ist vorüber, aber sie hat ein

„Ergebnis“: das hinsichtlich T verdeutlichte G, und fortdauernd bleibt das Ineinander


der entsprechenden Akte im Griff. Indem aber erneut Für-sich-Erfassung des G, das
nun verdeutlichtes G ist, und dazu Für-sich-Erfassung des T vollzogen wird, analysiert
sich die Ursynthese, und dabei werden G und T nicht zusammengenommen, sondern
der Blick richtet sich auf „G hat T“ oder „T in G“. Das neu, aktuell erfasste, ver-
deutlichte G mit dem ihm aufliegenden verdeutlichten Teil und das neu objektivierte
T haben eine neue, originär sich konstituierende Einheit, und der Blick geht in dieser
synthetischen Setzung von G aus auf das darin verdeutlichte T und geht auf das „habe“,
das ein Erfassen desselben und darin ein neues Setzen des T erfordert. Vgl. 5a = S.
124,33–126,21.
194 explikative und prädikative synthesen

Erfassung des „G hat T“. Dies setzt das Resultat der Explikation
voraus, und genau dasselbe Resultat setzt die synthetische Relati-
onserfassung „T in G“ voraus. Das Ergebnis der Explikation ist
oder liefert das fundamentum relationis im alten Sinne? Jedenfalls,
5 es liegt zugrunde, und was sich darauf konstituiert, ist beiderseits im
Verhältnis der Umkehrung.
Also, die Relation T  G ist eine „Umkehrung“ der ursprüngliche-
ren Sachlage „G hat T“. Ob ich G als T habend oder T als von G ge-
habt erfasse: Immer muss zunächst eine Einheit des Totalbewusstseins
10 vorliegen, in dem sich Partialbewusstsein etabliert (das Explikations-
bewusstsein). Weiter bedarf es, wie wir sehen, neuer Selbsterfassung,
nämlich der des T. Es bedarf einer erneuten Originär-Erfassung des
G und einer neuen, aber geänderten Originär-Erfassung des T. Aber
einmal geht der originär selbsterfassende und mit der Selbsterfassung
15 Synthesis übende Blick von G zu T, das andere Mal von T zu G: eine
Synthese, die ihre Richtung hat von T zu G, während im anderen Fall
die Richtung geht von G zu T.

§ 5. Die schöpferische Konstitution des


Inbegriffs im Zusammennehmen und seine ihn
20 zum Gegenstand machende Objektivation

In der Zusammennehmung A und B haben wir zwei Gegenstände


im prägnanten Sinn. Aber wir können eine eigene Objektivation bil-
den: das Zusammenkommen, der Inbegriff von A und B. In der Bezie-
hung (dem Beziehen) haben wir mindestens zwei Gegenstände (die
25 Beziehungspunkte), aber es ist nicht etwa das Korrelat des Beziehens,
die Beziehung, gegenständlich. Es ist „bewusst“, ist „konstituiert“
und doch nicht „vorgestellt“ in einem besonderen Sinn, nicht zum
Objekt gemacht, „objektiviert“.
Das Zusammennehmen und das Beziehen objektivieren inso-
30 fern, als sie schöpferisch Gegenstände konstituieren. Wir sagen daher
lieber, sie sind gegenstandskonstituierend, und sie heißen so, weil ih-
rem Wesen nach aus ihnen d u rc h O bj e k t i v a t i o n Ge g e ns tä nde
z u en t n eh m e n, Gegenstände als ihnen eigentümliche, durch sie
geschaffene, zu Gegenständen für sich zu machen sind. Das Objekti-
35 vieren ist ein „den ‚Blick‘ auf das richten, was in ihnen ‚vorhanden‘ “
beilage xvi 195

ist. Es ist vor-handen; es ist aber nicht in Händen, ist nicht ergriffen,
und das Ergreifen ist das Objektivieren.
Demnach ist Wah rn ehm u n g ein gegenstandserfassender, ein ob-
jektivierender Akt, wofern wir unter Wahrnehmung nicht das bloße
5 Bewusstsein eines leibhaftig und wirklich erscheinenden Dinges ver-
stehen (oder sonst einer Sache, die wir lieben, als wahrgenommen zu
bezeichnen), sondern ein das so Erscheinende für sich Zum-Objekt-
Machen. Die Erscheinung konstituiert den Gegenstand, die Objek-
tivation macht ihn zum Gegenstand, das heißt, in der Erscheinung,
10 durch die nicht der fassende Griff der Objektivation geht, ist ein Ge-
genstand „vorhanden“, aber Gegenstand-Sein im prägnanten Sinn ist
nicht Vor h a nde n-, sondern Zuhanden- oder vielmehr I n- Hä nd en -
S e i n. Das weist auf meinen Begriff der nominalen Vorstellung hin. In
jeder nominalen Setzung ist ein Gegenstand objektiviert, mag sie auch
15 mehr sein als Objektivierung. Und jeder objektivierte Gegenstand ist
nominaler, sofern er zugleich begriffen und dann nominal begriffen
werden kann in einer nominalen Setzung.

Beilage XVI
Unterschiede der Aufmerksamkeit.
20 Die Artikulationen der Erfassung1

Auf m e r ks a m ke i t: 1) D as s c h lich t e E rf as s en u nd jed e r lei Er f as -


s e n (eventuell vorher schon das Abgehobene, aber noch nicht Erfasste);
2) d as Er f a ss e n e in e s Z i el ob j e k ts, des thematischen Objekts, Sub-
strats (alles dasselbe);
25 3) vorher da s t h e ma t is c h e E rf as s e n ü b er ha u p t: Zielobjekt, aber
auch „in Betracht gezogenes“ Objekt usw. Jedes theoretisch Objektive: Auf-
gemerktes; danach auch v e r s ch i ed e n e r S in n vo n U n ter s c h ie d en d er
A u f me r ks am k e it.
Wir haben zu unterscheiden:
30 1) A r t ik ul a tio n en i nn e rh alb d e r Au ff as su n g, die nicht Artikula-
tionen der Zuwendung, der Erfassung sind oder sein müssen. Die Artikula-
tion besteht eventuell darin, dass in der Einheit eines Aufgefassten mehrere
Objekte „mehr oder minder stark“ abgehoben sind.

1 Wohl September 1911. – Anm. der Hrsg.


196 explikative und prädikative synthesen

2) A rt ik ula t io n en de r Z uw en d u ng, der Erfassung.


a) Ist die Zuwendung eine thematische, so haben wir in der Einheit des
thematischen Aktes verschiedene Glieder, und zwar fürs Erste ein oder meh-
rere Hauptsubstrate. Noch allgemeiner könnten wir, wenn wir schon hinein-
5 ziehen die thematischen Zuwendungen höherer Stufen, nämlich die Zuwen-
dungen zu den konstituierten Sachverhalten, die thematischen Sachverhal-
te Hauptglieder nennen, während die Rede von Substraten auf schlichte Ex-
plikationen oder auf konstituierte Sachverhalte schlichter Art zurückweist.
(Ich habe da im Auge den Bau von zusammengesetzten Sachverhalten aus
10 Sachverhalten; im einfachen Sachverhalt singuläre und plurale Subjekte.)
Gliederung ist aber nicht bloß Abgliederung von Substraten, sondern b)
es gibt auch Glieder, die nicht Hauptsubstrate sind oder eigentliche Substrate:
das „in Bezug auf“.
c) Darin wieder Unterschiede zwischen dem, was nominal aufgefasst ist in
15 der Form eines möglichen Bestimmungssubjekts, aber nicht gerade wirklich
als Subjekt etc.; Form des Bestimmbaren und was nicht so aufgefasst ist.

Beilage XVII
Rezeptive Zuwendung und Zuwendung zu einer
synthetischen Einheit in und mit ihrer Erzeugung1

20 Nach diesen Ausführungen gibt es Erfassungen in sehr verschiedenen


Modi. Die Erfassung der schlichten Zuwendung überhaupt, und zwar der Zu-
wendung auf ein passiv Vorgegebenes; die thematische Erfassung in schlich-
ter Zuwendung auf ein passiv Vorgegebenes, und die Passivität immer vor-
ausgesetzt, die thematische Erfassung des Explikanden innerhalb einer Ex-
25 plikation, die Erfassung des Explikats in der Explikation. Die synthetisch
artikulierte Erfassung eines Sachverhalts, die produktive Erfassung. Die re-
flektive Erfassung des Sachverhalts, der zugleich originär konstituiert ist: Der
Sachverhalt ist dabei in ähnlichem Sinn „Objekt“ möglicher Explikation wie
ein passiv aufgenommener Gegenstand.
30 Ein Sachverhalt kann aber auch in verworrener Weise aus dem Dunkel
auftauchen. Ich wende mich ihm zu; es kann sich um eine Erinnerung handeln:
„Ich komme zurück“ auf eine Prämisse, die ich vorhin festgestellt habe,
und sage etwa, mit Rücksicht darauf ist diese Möglichkeit ausgeschlossen
etc.; dabei bin ich dem Sachverhalt von neuem zugewandt, aber um ihn zu

1 Wohl September 1911. – Anm. der Hrsg.


beilage xvii 197

explizieren, muss ich ihn mir zu „artikuliertem Bewusstsein“ bringen, zu


originärer Erfassung, die zunächst keine „objektivierende“ ist.
Es kann aber auch sein, dass auch sonst in Wiedererinnerung und außer
Zusammenhang eines kontinuierlichen theoretischen Gedankenzusammen-
5 hangs (thematische Einheit) ein Sachverhalt „auftaucht“, ein dunkles Sach-
verhaltsbewusstsein, und dass ich mich dem Sachverhalt zuwenden kann.1
Welche Terminologie soll ich wählen? Wir wollen vielleicht unterscheiden:
rezeptive Zuwendung, Zuwendung zu einem Vorgegebenen (Rezipierten),
produktive Zuwendung, Zuwendung zu einem Produzierten in und mit der
10 Produktion.
Ich erfasse, was jemand aussagt (auch, wenn ich keine Anschauung habe).
Ich erfasse einen dunkel auftauchenden Sachverhalt einer dunklen Sachver-
haltsvorgegebenheit (dunkles Vorhandensein): Ich wende ihm meine Auf-
merksamkeit zu, ich erfasse in diesem Sinne. Erfassung als theoretischer Akt
15 niederer und höherer Stufe, als objektivierender Akt im bestimmten Sinn.
Gibt es noch andere Akte? Und das Nicht? Das Vermutlich, Fraglich. Ab-
lehnung, Vermutung, Frage, Wunsch. Neue Spontaneitäten, Zuwendungen
in einem neuen Sinn: Nicht-Erfassungen.
Die Rezeption kann eine gebende (oder quasi-gebende) und eine nicht
20 gebende, eine aus Synthesis herstammende oder nicht herstammende sein. Ist
die Rezeption eine gebende (oder quasi-gebende), so lässt sie Explikation zu.
Ist die Rezeption aus Synthesis herstammend, so kann sie Reflexion auf eine
artikulierte Synthesis oder auf eine unartikuliert bewusste, „unlebendige“
Synthesis sein. Reflexion auf artikulierte Synthesis verschafft eine Zuwen-
25 dung, die explikabel ist. Doch fragt es sich, inwiefern artikulierte Synthese
und anschauliche sich unterscheide. Und das Gebiet der Begrifflichkeit haben
wir noch nicht betreten.
Erfassen, sagte ich immer. Es wird auch gesagt, Zuwendung, Gerich-
tetsein auf ein „Gegenständliches“. Es ist nicht zu verwechseln mit Wahrneh-
30 mung, es handelt sich um Modi der Aufmerksamkeit. „Erfassende“ Aufmerk-
samkeit ist nicht Erfassen im Sinne des Wahrnehmens, aber ein „Setzen“,
theoretische Setzung. Zuwendung ist ein allgemeines Den-Blick-auf-etwas-
gerichtet-Haben. Hauptsächliche Besonderungen sind Zuwenden zu einem
Gegenstand im besonderen Sinne des Gegenständlich-Habens, d. i. Zuwen-
35 dung zu einem einheitlich Vorgegebenen (rezeptive Zuwendung; Erfassen

1 Dabei Sich-Hinwenden als Sich-Hinwenden zu einer „Nebensache“, Sich-Hin-

wenden als Sich-Hinwenden zu einer Hauptsache, zu einem Thema, und Hinwen-
den im Thema ist nicht immer Hinwenden schlechthin, Hinwenden als zu einem
Substrat, Explikat etc.
198 explikative und prädikative synthesen

als spontane Tätigkeit und noch bleibendes Im-Griff-Behalten). Diese Spon-


taneität kann aber Glied weiterer Spontaneitäten werden, die immerfort
Zuwendungen sind, und mit denen sich eventuell Zuwendungen auf synthe-
tische Einheiten herstellen in ihrem synthetisch-sukzessiven Aufbau, zu der
5 sich Reflexion gesellt: Das synthetisch Erzeugte gibt etwas vor, was sich in
„neuer“ Zuwendung erfassen lässt, in der Weise rezeptiver Zuwendung.
Nr. 11

D ie K on st i t u t io n von S a ch ve rh al t e n
u nd i h r en F orm en i n Ex pl i ka t io n en
u nd dar au f grü n den de n p rä d ik ati ve n
5 D en k sy n t h es en un d D en kf or mu n ge n1

§ 1. Die bestimmende Prädikation als eigenschaftliche


und als relative. Das absolut Adjektivische
gegenüber dem relativ Adjektivischen

Man spricht von beziehendem Denken, man nennt alles bestim-


10 mende Prädizieren auch ein „Beziehen“. Inwiefern findet also in aller
bestimmenden Prädikation in der Tat ein „Beziehen“ statt oder liegt
ein solches zugrunde? Andererseits darf doch der Unterschied zwi-
schen relativierenden Prädikationen (solchen, die relative Sachver-
halte als Korrelate haben) und nicht-relativierenden (irrelative Sach-
15 verhalte) nicht verwischt werden. Es wird sich hier darum handeln,
die verschiedenartigen „Synthesen“, die beiderseits zum Ausdruck
kommen, zu klarer Gegebenheit zu bringen, beiderseits zurückzu-
gehen auf die Übergangsgestaltungen, die vor der schöpferischen
Gestaltung durch das eigentlich synthetische „Denken“ (und sonach
20 auch vor dem Ausdrücken) liegen, und nun das Gemeinsame zu
markieren, das die Rede vom Beziehen berechtigt, und andererseits
den Doppelsinn herauszustellen, der diesem Begriff anhaftet, sofern
die spezifische Rede von Beziehung auf die Relation hinweist, die
nur einen besonderen Fall von den im „beziehenden“ Denken sich
25 konstituierenden Sachverhalten anzeigt.
Es sind doch offenbar Unterschiede, ob ich sage „a ist weiß“ oder
ob ich sage „a ist größer als b“. Sachlich stehen sich hier gleich das
„weiß“ und das „größer als b“. Beides sind die Bestimmungen, die
dem Subjekt im Sachverhalt zukommen. Im einen Fall ist innerhalb
30 des Sachverhalts auf Seiten der Bestimmung ein „Gegenstand“ ge-
setzt, in Bezug auf den dem Subjekt das „größer“ zugesprochen wird,

1 Wohl September/Oktober 1911. – Anm. der Hrsg.


200 explikative und prädikative synthesen

welches nun wieder in besonderer Weise dem „weiß“ gleichgestellt


ist. Einerseits wird parallelisiert das „weiß“ und das „größer b“,
als Prädikate, als das, was das Subjekt ist, als seine „Bestimmung“;
andererseits wird parallelisiert das „weiß“ und das „größer“, und
5 es wird gesagt, das „weiß“ kommt dem Subjekt schlechthin, absolut
zu, als innere Bestimmung, das „größer“ kommt dem Subjekt zu als
relative Bestimmung, nicht absolute; sie hat eine Unselbständigkeit,
abgesehen davon, dass sie als Bestimmung ein Subjekt fordert; sie
kommt dem Subjekt nicht schlechthin, sondern in Bezug auf ein
10 Objekt zu.
Einmal heißt relative Bestimmung das bloße „Relat“, das aber
in der synthetischen Setzung eine Unselbständigkeit hat, die das „in
Bezug auf b“ mitzusetzen fordert, während die innere Bestimmung,
die absolute Adjektivität, diese Art Unselbständigkeit nicht hat. Im
15 anderen Fall heißt relative Bestimmung das Relat mit seiner notwen-
digen Ergänzung.1 Es ist die Frage, welche Analogie tiefer reicht,
das heißt, es ist die Frage, ob im primären und ursprünglichen Sinn
der Begriff die Bestimmung „weiß“ und „größer …“ umfasst oder
„weiß“ und „größer als b“. Es ist dabei aber vor allem auch die
20 Frage, wohin eigentlich das „als b“ gehört. Einerseits wird man sagen,
natürlich primär zu b: „größer als b“ ist ein Prädikat, wir bilden ja
nominal das Größer-b-Sein und sagen, es komme dem a, dem a’, es
komme eventuell allgemein vielen Subjekten zu. Andererseits könnte
man aber auch sagen: a, in Bezug auf b betrachtet, ist größer; im
25 Vergleich von a und b ist a größer, b kleiner. Gegenüber b ist a größer,
gegenüber c kleiner. Aber das sind nicht so einfache Gedanken wie
„a ist größer b“. Aber sie deuten vielleicht auf etwas hin.
Jedenfalls ist es wichtig, sich darüber klar zu werden, was für eine
Stellung das „als b“ hat. a ist (größer im Vergleich mit b), oder a ist
30 größer (im Vergleich mit b). Wir sagen auch: a in sich selbst ist weiß,
rund etc.; es hat Eigenschaften; a in Bezug auf andere Gegenstände
hat äußere Beschaffenheiten. Müsste ich, um „weiß“ zu prädizieren,
vervollständigen: „a in sich selbst ist weiß“ oder „a ist weiß an und

1 Relative Bestimmung als Prädikat – relative Bestimmung als Relat. Das absolute
Adjektivische: weiß. Das relativ Adjektivische: gleich, ähnlich, größer, lauter; unter b,
tiefer als b, neben b, benachbart mit b.
text nr. 11 201

für sich betrachtet“; ebenso wie ich sage „a ist größer in Bezug auf
b“?
Man könnte in Bezug auf all das auch fragen: Ist vielleicht zu
scheiden das Pr ädi ka t und das A d je k t ivi s ch e? Versteht man unter
5 Bestimmung Prädikat, das, was von dem Subjekt ausgesagt, auf die
Subjektsetzung hin gesetzt ist, so ist „größer als b“ Prädikat oder
Bestimmung. Andererseits, das Adjektivische, könnte man sagen, ist
nicht immer das Prädikat. Weiß als Prädikat, das ist eine als Prädikat
gesetzte Adjektivität. Aber in den relativen Prädikaten haben wir
10 eine Adjektivität, die mit etwas verbunden ist, was nicht Adjektivität
ist. Das „größer als b“ wird dem Subjekt zugesprochen, das steht
fest. Andererseits aber wird es nicht dem Subjekt adjiziert oder ist
nicht als bloßes Adjektiv erfasst. Das Adjektivische ist das „an“ dem
Subjekt Erfassbare bzw. Erfasste; so das „weiß“ aufgrund der eigen-
15 schaftlichen Explikation, aber auch aufgrund des Relativierens das
„größer“, „gleich“ etc. Aber das „als b“ ist nichts an dem Subjekt,
auch nicht „größer als b“ vollgenommen.
Damit wird allem Wesentlichen genügt sein. Das „als b“ gehört ins
Prädikat und ist im Prädikat eins mit dem adjektivischen Kern, den
20 es als Relatives fordert. Das schließt nicht aus, im Gegenteil, das for-
dert, vermöge der total verschiedenen „Form“ des Adjektivischen
und des bezüglichen Objekts, dass sich das eine und andere in sehr
verschiedener Weise auf das Subjekt bezieht. Das Adjektiv ist am
Subjekt; was aber das bezügliche Objekt anlangt, so geht ein bezie-
25 hender Blick von Subjekt zu Objekt etc., und auch im Sachverhalt
bzw. der Sachlage gehen besondere Linien von Subjekt zu Objekt.
Und das drückt sich in den obigen Redewendungen aus, welche das
adjektivisch Gesetzte vom bezüglichen Objekt getrennt zum Aus-
druck bringen. Es ist da noch genauer phänomenologisch zu forschen.
30 Es scheint doch, dass das Adjektivische für sich sozusagen erfasst,
eben dem Subjekt adjiziert wird auf dem Grund der beziehenden
Ineinssetzung. Aber wie kommt die Einheit des Prädikats „größer
als b“ zustande?
202 explikative und prädikative synthesen

§ 2. Die Frage nach den kategorialen Grundformen


von Prädikaten. Ist die Bestimmung durch Teile eine
Sonderform des eigenschaftlichen Bestimmens?

Absolute und relative Beschaffenheiten. Eine Prädikation, eine


5 bestimmende Prädikation, bestimmt, was ein Gegenstand ist. Sie
kann 1) einen Gegenstand, ein Subjekt, bestimmen nach dem, was er
an und für sich ist, nach seinem Eigensein, nach seinen Eigenschaften,
nach dem, was ihm nicht in Bezug auf „anderes“, sondern eben „an
und für sich“ zukommt. 2) Eine bestimmende Prädikation kann eine
10 relative sein, sie kann vom Subjekt aussagen, was es in Bezug auf
irgendwelche andere Gegenstände ist, bestimmen, was ihm in Bezug
auf diesen anderen zukommt.
Nun besteht hier eine Zweideutigkeit. Wohin sollen wir die Be-
stimmung durch Teile rechnen? Wenn wir aussagen „S hat T“, sagen
15 wir damit aus, was der Gegenstand „an und für sich“ ist oder was er
in Bezug auf „anderes“ ist?
a) Dieser Gegensatz kann so verstanden werden, dass das Prädikat
„rein dem Gegenstand selbst entnommen“ sein soll bei der Bestim-
mung des ihm „an und für sich“ Zukommenden und nicht durch ein
20 beziehendes Hinübergehen zu „anderen“, d. h. dem Subjekt nicht als
Teile einwohnenden Gegenständen und ihren eventuellen Teilen und
Momenten. Dann würden alle absoluten adjektivischen Prädikate
wie „weiß“, ebenso aber auch alle Bestimmungen durch Teile auf
der einen Seite stehen, auf der anderen Seite die relativen Prädikate,
25 die nichts von Teilen enthalten. (Man würde dann auch dazwischen
die Relationen finden, die zwischen Gegenständen bestehen, die sich
kreuzen etc. Die würden natürlich ins zweite Glied gehören.) Man
kann nun selbstverständlich in dieser Art objektiv vorgehen, also von
der Erwägung aus, dass ein Gegenstand in sich selbst seine Teile
30 hat, die ihm eigen sind, und seine „unselbständigen Momente“, die
für ihn adjektivische Eigenschaftsprädikationen ermöglichen; weiter,
dass der Fall möglich ist, dass für die Prädikation das in Betracht
gezogen wird, was sich ergibt, wenn wir beziehend zu Gegenstän-
den übergehen, die nicht Teile des Subjekts, des zu bestimmenden
35 Gegenstandes, sind (Stücke, Glieder, innere Momente).
b) Aber sehr viel wesentlicher ist ein anderer Gesichtspunkt. Wir
fragen nicht, was sich objektiv von einem Gegenstand durch Heran-
text nr. 11 203

ziehen seines eigenen Inhalts oder auch fremden Inhalts aussagen


lässt, sondern wir fragen nach den k ate gor i a le n Gr un d fo rm en
vo n Präd ik at en.
α) Lässt sich etwa sagen, dass das Bestimmen eines Gegenstandes
5 aus ihm selbst,1 ein „eigenschaftliches“ Bestimmen, eine Grundform
der Bestimmung ausmacht, der inneren, irrelativen Bestimmung, dass
„Eigenschaft“ etwas ist, was sich aus phänomenologischen Gründen
in grundverschiedener Weise konstituiert gegenüber der relativen
Bestimmung, dass demnach das Bestimmen in Bezug auf „andere“
10 Gegenstände eine zweite Grundform des Bestimmens ist (und korre-
lativ der Bestimmung)?
β) Und ist es vielleicht so, dass das eigenschaftliche Bestimmen
eine allgemeine Form ist, die zwei Sonderformen enthält, die adjek-
tivische Eigenbestimmung (Korrelat: die adjektivische Eigenschaft)
15 und die substantivische Eigenbestimmung (Korrelat: die Teile), oder
ist das nicht der Fall, womit gesagt wäre, dass das „S hat P“ zu den
relativen Bestimmungen gehört? Ferner, wenn das Erstere statthat,
dass der substantivischen Eigenbestimmung mit der Form „A hat T“
a priori entspricht eine relative Bestimmung als ihr Äquivalent und
20 dass das Wesen der relativen Bestimmung mit dem Sich-Beziehen
auf „andere“ Gegenstände mit dieser „Andersheit“ auf eine Form
hinweist, die ebenso gut etwas erfahren kann, was als Teil in dem
Subjekt ist, als was außer ihm ist?2
Wir hätten dann, der eigenschaftlichen Form der Teilprädikation
25 (dem eigenschaftlichen Sachverhalt, den wir den teilschaftlichen im
Gegensatz zu dem im engeren Sinne eigenschaftlichen, nämlich ad-
jektivischen, nennen könnten), ausgedrückt als „A hat B“, entspre-
chend eine relationelle Form „A enthält B als Teil“, „A ist Gan-
zes von B“, wie umgekehrt „B ist Teil von A“.3 Der teilschaftliche
30 Sachverhalt, würde man dann sagen, lässt sich nicht umkehren, der
relationelle aber, wie jeder relationelle, lässt sich umkehren.

1 1) „Bestimmen aus sich selbst“, das kann eben entweder heißen, das Subjekt ist der

einzige „Gegenstand“ dabei, die einzige logische Substanz, oder es ist mehr als eine
substantivische Gegenständlichkeit dabei. 2) „Aus ihm selbst“ kann aber auch heißen,
man geht in identifizierender Deckung, und zwar totaler oder partialer Deckung,
nicht über den Gegenstand hinaus.
2 Das habe ich gemeint, es ist aber nicht richtig.
3 Nein.
204 explikative und prädikative synthesen

Nun ist aber zu bemerken, dass, was die relationellen Bestimmun-


gen anlangt, wir auch bei ihnen den Unterschied des Adjektivischen
und Substantivischen haben: A ist ähnlich B, A hat Ähnlichkeit mit
B. Wir müssten dann sagen: Jede Bestimmung, ob sie relativ oder
5 irrelativ ist, hat entweder die Form adjektivischer Bestimmung oder
die Form des Gehabten, die nominalisierte Adjektivität. (Das no-
minalisierte Adjektiv Weiß ist nicht zu verwechseln mit der Farbe
Weiß.) 1 Sie hat entweder die Ist-Form oder die Hat-Form, also auch
für Teilrelationen: A ist Ganzes von B, A hat Ganzes von B-Sein.
10 Nun finden wir aber bei den Teilen das Eigentümliche, dass sie, wenn
sie „unselbständig“ sind, als „Fundamente“ für eine Adjektivität
dienen sollen, dass sie vermöge ihrer Unselbständigkeit als Momente
prädestiniert sind zu Bestimmungen irrelativer Art, und dass, wenn
sie selbständige Teile sind, sie ungeeignet sind als Bestimmungsfun-
15 damente; sie sollen vielmehr nur als Gehabtes fungieren können,
aber Gehabtes, das nicht aus einer Substantivierung eines Adjektivs
entstanden sein soll. Das alles ist phänomenologisch tiefer zu überle-
gen.
Jedenfalls ist zu beachten, dass die Unterscheidung der Bestim-
20 mungen in innere (irrelative, eigenschaftliche) und relative eine ka-
tegoriale, die logische Form angehende ist, während es eine ganz
andere Einteilung ist, wenn wir gegenüberstellen konstitutive und
nicht-konstitutive. Die konstitutiven sagen von einem Gegenstand
aus, was aus ihm selbst geschöpft ist, die nicht-konstitutiven, was
25 nicht. Das ist keine Einteilung aus der logischen Form.
Um nun die Verhältnisse, die phänomenologisch bei relativen und
irrelativen Bestimmungen vorliegen und bei Bestimmungen über-
haupt, allseitig zu klären, beginnen wir mit den inneren Bestim-
mungen, und da werden wir phänomenologisch zurückgewiesen auf
30 die Explikation (die innere Auseinanderlegung, innere Explikation),
diese merkwürdige Kontinuität verdeutlichender und „kenntnisge-
bender“ bzw. „kenntnisnehmender“ Betrachtung eines Gegenstan-
des.2 Wir fassen einen Gegenstand für sich ins Auge und b l i c ke n
i n i hn h i n ei n; wir durchlaufen in einem kontinuierlichen Einheits-

1 Vgl. Blatt I–III = S. 285,23–290,3.


2 Gut.
text nr. 11 205

bewusstsein, was uns dabei zu einem besonderen Erfassen kommt.


Die erfasste Einzelheit, die insofern nicht für sich gilt, als sich in
ihr der Explikand verdeutlicht bzw. in ihr zu erweiternder Kenntnis
kommt, kann selbst wieder Explikation erfahren und wird dabei in
5 Relation zu den daraus gezogenen Explikaten zum relativ für sich
Geltenden, aber nur relativ; wie denn auch das Explizierte mittelbar
den Hauptexplikanden expliziert, der sich in ihm in seiner Beson-
derheit zeigt.1 Auch Gruppen von Einzelheiten können in gleicher
Stufe als relativ für sich geltende Gegenstandseinheiten erfasst und
10 in einer Gesamtform erfasst werden. (Es ist auch zu bemerken, dass
selbst Beziehungen solcher untereinander und dass eigenschaftliche
Prädikationen vollzogen werden können und dass dabei solche voll
ausgearbeiteten Prädikationen explikativ fungieren können, kennt-
nisgebend, während dabei die auf den Hauptexplikanden bezogenen
15 Prädikationen unterbleiben.)2

§ 3. Einstufige Explikation. Die schon in der bloßen


Explikation auftretenden Formen gegenüber
den spezifisch prädikativen Denkformungen

Wir beschränken uns auf Explikate erster Stufe (bzw. Explika-


20 tionen) und wollen studieren, wie sich aufgrund solcher Explikatio-
nen Denksynthesen bilden, Sachverhalte einfacher Art konstituieren,
Subjekte als Träger von Bestimmungen, und zwar Prädikationen der
Art wie „G ist α“ und „G hat A“. Es ist von vornherein klar, dass
das Mit-Heranziehen von Explikationen höherer Stufe komplexere
25 Formen ergeben würde, mit reicher gebauten logischen Formen wie
„S hat A, welches m ist“, „S hat A, welches ρ B ist“ und dgl. Dabei
treten in zweiter Stufe auch die Relationsformen auf, welche wir in
erster Stufe erst studieren müssen, aber wie sich bald zeigt, nicht in der
inneren Explikation, sondern aufgrund der äußeren relativierenden
30 Explikation.

1 Dieses absolute und relative Für-sich-Gelten macht den Unterschied zwischen

Subjekt und dem bloß zur Bestimmung dienenden Objekt (dann immer Relation); das
Gemeinsame ist dabei die Substantivität.
2 Das ergibt dann die attributiven Bestimmungen.
206 explikative und prädikative synthesen

Was die erste Stufe der Denksynthesen anlangt, die auf schlich-
ter einstufiger Explikation beruhen, so nehmen wir auch da den
einfachsten Fall, nämlich den, dass nicht „Ergebnisse“ von Expli-
kationen hineingezogen werden in Denkfassung in neuen Explika-
5 tionen bzw. in die Denksynthesen; wir schließen, deutlicher gespro-
chen, jederlei Attributionen aus. Also, etwa von G ausgehend als
Explikand, vollziehen wir einen ersten und einzigen Schritt der Ex-
plikation gegen a hin, wobei a die herausgehobene Einzelheit ist,
in der sich G „expliziert“, sei es, dass es sich bloß verdeutlicht,
10 sofern das G schon das a in seinem „Sinn“ enthält, sei es, dass
es sich in dem a bereichert, in kenntniserweiternder Weise bekun-
det.
Statt dass nun die Explikation weiterginge zu neuen Einzelheiten,
in denen das G sich immer von neuen Seiten zeigt, vollziehen wir
15 eine dem Wesen nach hier immer mögliche Einstellung. Im expli-
zierenden Übergang hat das G etwas erfahren, es ist nach ihm das
explizite G, das verdeutlichte, das nach dieser Seite a zur Kenntnis
gekommene, und wenden wir uns von neuem ihm zu, so steht es in
offenbar neuer Weise da. Und es steht als das da, sofern wir es nicht
20 bloß von neuem ins Auge fassen, sondern in Bezug auf das noch
im Griff verbleibende Explikat a ins Auge fassen, und wir können
nun in einer neuen Form den Übergang von G zu a vollziehen; es
kommt uns (weiter lässt sich wohl hier nichts sagen) der Sachver-
halt „G ist a“ zum Bewusstsein, wobei G die Form des Subjekts,
25 des Untergesetzten, hat, a die des Daraufhin-Gesetzten: Auf dem
Grund der Subjektsetzung vollzieht sich die Prädikatsetzung derart,
dass sie nicht bloß zwei aufeinandergelegte Setzungen sind, sondern
eine Einheit der Setzung, indem sich eben das „G ist a“ oder „Das
ist das“ konstituiert. G wie a haben dabei ihre Formen im Sach-
30 verhalt und werden im Allgemeinen irgendwie begriffen sein, etwa
als „Dies ist weiß“ (wofern wir keine attributiven Bestimmungen
heranziehen wollen und damit zusammenhängend Erkenntnis unter
Begriffen).
So viel muss man sich von vornherein klarmachen: dass es ein
35 wesentlicher Unterschied ist, bloß explikativ von G zu a und dann
eventuell in kontinuierlicher „Betrachtung“ immer wieder zu neuen
Explikaten überzugehen und andererseits Denksynthese zu voll-
ziehen, in welcher allererst das G zum Gegenstand-worüber wird, zum
text nr. 11 207

Gegenstand einer Untersetzung, der als solcher eine korrelative syn-


taktische Form hat innerhalb einer einem Sachverhalt eigentümlichen
Gesamtsyntax. Und in dieser hat auch das a seine syntaktische Form,
wie dann auch das „ist“ hervortritt als ein unselbständiges, die Art der
5 Einheit des Sachverhalts mit ihren beiden Gliedern kennzeichnendes
Moment.
Was für Formen sind das nun, die in diesem einfachsten Fall auf-
treten können? Wir fragen wohlgemerkt nicht nach den Erlebnissen
und auch nicht nach den Themata, sondern nach den gegenständ-
10 lichen Formen, und speziell nach denen auf Seiten des Prädikats.
Das Prädikat ist eine allgemeine Form des hier sich konstituierenden
Sachverhalts. Aber wie steht es mit dem Explikat a, kann es nur auf
eine Art in die Prädikatform eintreten oder auf mehrere Arten, und
hängt es vom Inhalt des a nicht ab, in welche Formen es überhaupt
15 eintreten kann bzw. in welche es zunächst eintreten muss?
Es macht nun offenbar einen wesentlichen Unterschied für die
Form des in der Denksynthese erfassten Sachverhalts aus, ob das
Explikat die Form eines „eigenen Gegenstandes“, sagen wir gera-
dezu eines nominalen Gegenstandes, annimmt (oder die Form der
20 Su b s t a n t i v i t ä t, wie wir in Erweiterung und bei einiger Ände-
rung des grammatischen Ausdrucks auch sagen können) oder die
der Adjektivität, der adjektivischen Bestimmung. Ist schon innerhalb
der bloßen Explikation nicht von Substantivität und Adjektivität die
Rede und auch von der Form des „Subjekts“ und „Prädikats“? Eine
25 heikle Frage! Ob nicht schon da Unterschiede in der Weise des gegen-
ständlichen Habens bestehen, neben den wesentlich zur Explikation
gehörigen Formen, die das Explikat als solches und den Explikanden
als solchen auszeichnen und wieder das Explikat als Explikanden
von Explikaten zweiter Stufe und dgl. Es möchte nämlich scheinen,
30 und mir selbst hat es so geschienen, dass z. B. ein selbständiges Glied
eines kollektiven Gegenstandes, wie einer Allee, in der Explikation
ganz anders charakterisiert sei als ein Eigenschaftsmoment, wie eine
explizierte Farbe oder Form, ein Glanz und dgl. (Der Glanz darf
dabei nicht als Lichtflecken, ebenso eine dunkle Färbung nicht als
35 ein darauf geworfener Schatten aufgefasst sein: Das sind dann wieder
eigene Gegenstände!)
Für das eine Glied des Gegensatzes können natürlich auch zu-
sammengesetzte Gegenstände Beispiele abgeben, z. B. die Klinge
208 explikative und prädikative synthesen

am Messer, der Griff, der Stöpsel, der in der Flasche steckt, die als
verstöpselte einheitlich aufgefasst ist und dgl. Man möchte nämlich
sagen, dass die Formung als Explikand schon voraussetzt oder mit
sich führt eine Gegenstandsformung, nämlich ein Erfassen als eigenen
5 Gegenstand, und zwar als den auch, auf den es „abgesehen“ ist. Und
weiter möchte man sagen, dass unselbständige Gegenstandsmomente
in der Explikation zunächst nicht als eigene Gegenstände, sondern in
einem anderen Modus (dem die Adjektivität in der ausdrücklich prä-
dikativen Synthesis entsprechen würde), in dem der unselbständigen
10 Geltung, erfasst werden (der Nicht-Eigengeltung, also hier: nicht als
substantivische, nicht hätten sie die Form des „Prädikats“, des „an“
und des bestimmenden „an“); und wenn sie, wie z. B. die räumliche
Form, eine Explikation erfahren sollen, erhalten sie die Eigengel-
tung (= substantivische Form). Selbständige Teile aber, Glieder des
15 Gegenstandes, Stücke, erhalten notwendig gleich die Auffassung der
Eigengeltung und können keine andere überhaupt erfahren. (Die
Substantivität, aber nicht die Subjekt-ivität: Tritt Explikation zweiter
Stufe ein, so erhalten sie die Form der dienenden Subjektivität, des
Trägers einer Attribution.)
20 In diesem Fall, wenn also diese Auffassung richtig ist, so würde
sich innerhalb der Synthese die nominale und adjektivische (ebenso
subjektivische und prädikativische) Fassung finden, weil sie eigent-
lich schon vorher in der Explikation da war. Die Synthesis bringt
neue Formungen hinein, die spezifisch prädikativen Denkformun-
25 gen, die prädikative Subjektformung, die Form der Untersetzung,
die die Form des Explikanden annimmt (und dann auch die zum
Explikanden wesentlich gehörige Form der eigenen und tragenden
Objektivität, die nominale und subjektivische in unterer Formung),
und andererseits die prädikative Prädikatformung als Daraufhin-
30 Setzung, und Subjekt wie Prädikate einig in der Sachverhaltsform,
wobei das Prädikat zukommende Bestimmung des Subjekts ist. (Die
Hauptsache ist, dass, indem Prädikatsetzung auf Subjektsetzung sich
gründet, das Bewusstsein, dass eines das andere ist, erwächst.)
text nr. 11 209

§ 4. Die Frage nach dem Unterschied


und Verhältnis zwischen den beiden
Sachverhaltsformen „S ist p“ und „S hat P“

Sicher ist das aber, dass in der Synthese jedem unselbständigen


5 Explikat zweierlei entsprechen kann: Wir haben die beiden Sach-
verhaltsformen „S ist p“ und „S hat P“, während jedem selbständi-
gen Explikat ausschließlich die Form „S hat P“ entsprechen kann.1
Jede „einfache“ Explikation2 muss offenbar eine dieser beiden For-
men haben, welche Formen und wesentlich verschiedene Formen
10 des geurteilten Sachverhalts andeuten. Jedes Subjekt (jeder prädi-
kativ zu bestimmende Gegenstand) hat Eigenschaften, hat konsti-
tuierende, innere Bestimmtheiten, die auf dem Grund einer Ex-
plikation zur synthetischen Konstitution kommen im Sachverhalt
konstituierenden Bewusstsein. In diesem haben wir überhaupt erst
15 Prädikate im eigentlichen Sinn und hier eigenschaftliche Prädikate,
Bestimmungen; Bestimmungen, die, was dem Gegenstand eigen ist,
von ihm als Bestimmung zur „Aussage“, zur schöpferischen Set-
zung bringen („geschaffen“ wird das „S ist p“). Jeder adjektivi-
schen Eigenschaft entspricht ein gehabter „Teil“; gehabt ist dann
20 in der Habens-Synthese die nominalisierte (im besonderen Sinne
„vergegenständlichte Eigenschaft“). Im Ganzen bin ich nach wie
vor geneigt und muss es sein, die Eigenfassung schon ins Explikat
zu legen; so glaube ich, das phänomenologisch Gegebene ansehen zu
müssen.
25 Es ist nun eine wichtige Frage, die mir viel Beschwerden gemacht
hat, zu entscheiden, ob dieser so entsprossene Sachverhalt „S hat
P“ als ein Relationssachverhalt, als ein relativer, gelten kann.3 Also
die Frage ist: Ist derjenige Sachverhalt, der sich in der prädikativen
Synthese „S hat P“ konstituiert, und zwar in derjenigen, die aus
30 der Explikation entspringt, der Relationsverhalt zwischen Ganzem
und Teil, und zwar „S hat P als Teil“? Bedingt der Unterschied

1 Sicher vor allem ist, dass das Subjekt der Synthese Nominalform haben muss.
2 Einfache Explikation = eine solche, wo eben das Explikat nicht wieder Explikand
wird. Andererseits ist sie nicht immer ganz schlicht, denn die substantivische Fassung
des unselbständigen Explikats ist eine Komplikation im Bewusstsein.
3 Ja, das muss er.
210 explikative und prädikative synthesen

innerhalb der Explikation, darin bestehend, dass das Explikat einmal


vergegenständlicht ist als substantivisches Eigengegenständliches, das
andere Mal adjektivische Form hat, auch schon ohne weiteres den Un-
terschied zwischen der adjizierenden eigenschaftlichen Prädikation
5 und der relativierenden Teilrelation?1 Oder ist es nicht so? Müssen
wir sagen, dass auf dem Grund der Explikation mit eigenvergegen-
ständlichtem Explikat eine ursprüngliche Sachverhaltsform „S hat P“
erwächst, die wesentlich zu unterscheiden ist von der Relationsform
„S umfasst P als Teil“, sofern diese nicht in der bloßen Explikation,
10 sondern in einer anderen Betrachtungsform, in einem relativieren-
den Betrachten (einem Beziehen in neuem Sinne) ihre Quelle hat?2
Natürlich so, dass Äquivalenz besteht.
Das ist sicher, dass jede Prädikation ein gewisses Beziehen vor-
aussetzt, wofern sie in voller „Eigentlichkeit“ vollzogen sein soll. Im
15 inneren Explizieren, im Betrachten des Gegenstandes in sich selbst,
erleben wir ein kontinuierliches Einheitsbewusstsein, und zwar ein
„beziehendes“ Übergehen von S zu p in einem Sich-einig-sein-und-
Bleiben. Zur Synthesis der Prädikation bedarf es vorher des Erfassens
von S und des Hinübersehens zu p, also doch eines „Beziehens“, aber
20 reiht sich diesem Beziehen ein neuartiges an, wenn wir Relationen
vollziehen und speziell Teilrelationen?
Festhalten müssen wir dabei Folgendes: Das „S hat P“, das sich uns
aus der Explikation ergab, konstituierte sich, eben weil es und so wie
es sich aus ihr ergab, genau so wie das „S ist p“. Wir finden da schlecht-
25 hin keinen anderen Unterschied als den, dass einmal die adjektivi-
sche, das andere Mal die nominale Form vollzogen ist, und das sagt,
Eigenvergegenständlichung oder Nicht-Eigenvergegenständlichung,
weiter nichts. Haben wir ein unselbständiges Moment des Gegen-
standes expliziert, so stellt sich alsbald die Hat-Form ein, sowie uns
30 an ihm etwas auffällt, wir es also selbst wieder explizieren, aber
darin fortgesetzt das S zur Explikation bringen; wofern wir eben die
Explikation in Bestimmung, in prädikative Form verwandeln wollen.
Eines neuartigen Prozesses bedarf es weiter nicht.
Man möchte versuchen zu sagen: Dieses „hat“ ist im Grunde
35 nur ein anderes „ist“, der Gegenstand bestimmt sich durch das in

1 Ja.
2 Das wäre Konstruktion.
text nr. 11 211

ihm selbst Liegende. Er enthüllt sein Sein, was er in sich ist, und
das tut er in der Explikation. Es ist außerwesentlich, ob das Explikat
verselbständigt wird oder nicht; für die Art der synthetischen Fassung
bedeutet es nicht sehr viel; eben nur dies, dass die Form der Selb-
5 ständigkeit oder Unselbständigkeit der Gegenstandsfassung auftritt.
Aber das ist verkehrt. Warum heißt es dann nicht „Der Gegenstand
ist Weiße“, „Der Gegenstand ist das Gold, der Teil; das Tintenfass ist
der Deckel“?
Eben das „ist“ fordert ein adjektivisches Prädikat, ein solches, das
10 sich im „Übergang“ als „an“ dem Träger konstituiert. Das „hat“
aber ist kein „ist“, seine Ergänzung ist ein Substantivisches, etwas,
das als kein „an“ konstituiert ist. Aber im „hat“ steckt ein „ist“.

§ 5. Das der Erfassung des relationellen Sachverhalts


zugrunde liegende Übergehen. Die dem Gegenstand durch
15 den beziehenden Übergang erwachsende Bestimmung
bedarf zu ihrer Erfassung keiner Explikation mehr

Bei Relationen, unter Ausschluss der zwischen Ganzem und Teil


etc. waltenden Relationen, beruht die Konstitution der relationellen
Sachverhalte und Bestimmungen nicht auf innerer Explikation.1 Wir
20 könnten sagen, anstelle der Explikation (immer = innere Explikation)
fungiere hier Applikation (und applikative Explikation = äußere) als
das implicite die relationellen Sachverhalte „Konstituierende“. Wir
können jedenfalls von links zu rechts, von laut zu leise übergehen und
zurückgehen und dabei auf das eine und andere Objekt gerichtet sein,
25 ohne dass wir darauf „hinsehen“ (in einem spontanen Sehen), dass
A größer B, A intensiver wie B etc. ist, also ohne den Sachverhalt
zu fassen. Eventuell fordert es die Konstitution der Relation, dass
neben dem Übergehen von A zu B und umgekehrt auch der eine
oder der andere Schritt der inneren Explikation vollzogen wird, so
30 zum Beispiel wenn wir Gleichheit oder Verschiedenheit in Hinsicht
auf Farbe des Gegenstandes und dgl. konstatieren sollen. Anders,

1 Hier wird also nur die Frage behandelt, ob eine beliebige Relation etwa nach dem

beziehenden Übergang noch Explikation fordert oder nicht.


212 explikative und prädikative synthesen

wenn wir totale Gleichheit erfassen oder totale Verschiedenheit,


in dem Sinn etwa, in dem wir bei zwei gleichen Exemplaren einer
Art von Bäumen, die vollen Konkreta zusammenhaltend, Gleichheit
konstatieren und bestimmend aussagen. Im Übergang vom einen
5 zum anderen, A erfassend, B erfassend und zugleich A festhaltend,
vollziehen wir ein Hinüberbringen des A auf B, ein Überschieben
und eine Synthese der Deckung. Erfassen wir A aufs Neue, so hat
sich gegenüber vorhin sein Bewusstsein geändert; e s ha t du rch
d en D e c k un g süb erg an g s oz us ag en et wa s e rfa h ren (ganz
10 ähnlich wie bei der inneren Explikation oder wie nach ihr das G
ein modifiziert Bewusstes ist, als ein solches, das Verdeutlichung
etc. erfahren hat).1 Es ist ihm implicite schon die Bestimmung zu-
gewachsen. Aber das zeigt sich eben im erneuten Übergang zu B im
Hinblick auf das „A ist B“. Nur hier ist die Weise der Synthese
15 eine ganz andere, nicht eine Synthese der Explikation (die auch
so etwas wie „Deckung“ heißen kann), sondern eine Synthesis der
Gleichheit.
Es ist nun evident, scheint es, dass die Weise der Erfassung des
Sachverhalts mit seiner artikulierten Bestimmung genau die gleiche
20 ist wie bei den in der Explikation entspringenden Sachverhalten. Es
war also eine Verirrung, wenn ich zeitweise von dieser nächstliegen-
den Anschauung abgegangen bin und gemeint habe, es wachse dem A
durch den Übergang eine Bestimmung zu, die dann allererst expliziert
werden müsste. Das war grundverkehrt. Die Bereicherung ist ja ganz
25 analog wie diejenige, die der Explikand in einer explikativen Synthese
erfährt.

1 Sagt man, im einen Fall hat G die Eigenschaften „von vornherein“, im anderen

hat es relative Bestimmungen erst im beziehenden Hinübersehen auf „andere“ Ge-


genstände (oder es hat seine inneren Beschaffenheiten, auch wenn es mit keinem
anderen Gegenstand verbunden ist, auf keinen anderen bezogen), so ist das schief.
Aber es ändert nichts daran, dass auch Eigenschaften nur bewusstseinsmäßig „gehabt“,
erfasst, gesetzt sind in einem explizierenden Beziehen und dass Teilerfassungen dann
mit den Eigenschaften zusammenstehen als inneres Beziehen des Gegenstandes auf
„sich selbst“ gegenüber dem äußeren Beziehen.
text nr. 11 213

§ 6. Die Erfassung innerer und relativer Merkmale.


Die Vorhandenheit und Erfassbarkeit relativer
Merkmale setzt ein beziehendes Übergehen voraus.
Die Erfassung der Merkmale ist noch keine
5 Erfassung des Sachverhalts. Merkmal und Teil

Umkehr (natürlich falsch); These: Es ist nicht wahr, dass innere


Bestimmung und relative Bestimmung einander im Wesen und in der
Erfassung ganz gleich stehen. Es ist nicht wahr, dass eigenschaftliche
Bestimmung und entsprechende Teilbestimmung (als relative) sich
10 bloß unterscheiden durch die gegenständliche Fassung des Explikats.
Es ist nicht wahr, dass das Hin- und Hergehen beim eigenschaftlichen
Bestimmen (beim Explikativen überhaupt) ein Beziehen ist im selben
Sinn wie das echte Beziehen der Relationen.1 Habe ich mich vorhin
fast gewundert, wie ich zwischen Explikation und Relation einen
15 Schnitt annehmen konnte, so wundere ich mich jetzt, wie dieser
Schnitt übersehen werden kann, da er doch offenkundig ist.
Wir wollen einmal eine Vergleichung vollziehen:2 Mir erscheint
jetzt etwa (während ich nachdenke und, wie ich dabei gewohnt bin,
nicht fixiere) das Doppelbildpaar dieser Füllfeder. Ich vergleiche
20 und stelle mich zunächst nicht auf den Standpunkt eines oder des
anderen Gliedes (Bildes). Hinüber- und herübergehend sehe ich nun
an dem einen Bild das „dunkler“, am anderen das „heller“, am einen
Federbild das „länger“, am anderen das „kürzer“. Dabei sehe ich
das „an“ jedem Bild, so wie ich, oder analog wie ich, an ihm die
25 Farbe oder Form sehe, das ist, sie expliziere. Ich merke allerdings
hier eine gewisse Mittelbarkeit. Das „heller“ und „dunkler“ ist hel-
ler etc. bezüglich der Färbung. Ich kann offenbar in Versenkung
in das Phänomen (ich lebe durchaus in Intuition!) sagen, dass in
sich dem Gegenstand die Färbung zukommt und diese explikativ
30 hervortritt und an der Färbung der Charakter einmal des „heller“,
das andere Mal des „dunkler“, einmal satter, das andere Mal minder
satt.

1 Das natürlich.
2 An den Rand des folgenden Textes hat Husserl geschrieben: „Richtig und brauch-
bar. Nota bene“. – Anm. der Hrsg.
214 explikative und prädikative synthesen

Andererseits mache ich hier nicht die Färbung zum eigenen Ge-
genstand und eine Mittelbarkeit der Explikation tritt nicht hervor.1
Vielmehr, die Heller-Färbung tritt hervor einheitlich, und der Ge-
genstand steht als heller gefärbt da, und ich muss sagen, so wie ohne
5 vergleichenden Übergang der Gegenstand explikativ als gefärbt er-
fasst ist, so nach dem vergleichenden Übergang explikativ als heller
gefärbt, und weiter explizierend in abgesetzten Schritten kann ich
dann finden: Der Gegenstand ist gefärbt, und diese Färbung ist eine
hellere.
10 Aber heller in Bezug auf B. Das „heller“ finde ich an A, aber
„sofern“ es Endpunkt des Übergangs von A aus ist, oder jedes der A
und B hat sein Beziehungsmerkmal, sofern es im Übergangsbewusst-
sein, das zwischen A und B sich etabliert, bewusst ist. Aber das A
und B enthält selbst nichts von einem „Bewusstsein“, aber es haftet
15 dem „heller“ und „dunkler“ das „in Bezug auf“ (was keine Rede
vom Akt des Beziehens ist) an. Ich finde das „heller“ an A, aber
über dieses Moment der Explikation erstreckt sich etwas hinaus, der
Fangarm gegen B hin.
Vollziehe ich keine innere Explikation und blicke vom ganzen
20 unexplizierten A zu dem B, so hat dieses den Charakter des „gleich“
(ebenso den des „ähnlich“) und ebenso, wenn ich, Farbe explizie-
rend, vom einen zum anderen übergehe: gleich hinsichtlich der Farbe,
ähnlich hinsichtlich der Farbe. Und ist es nicht ebenso bei anderen
Relationen? So bei den Lagerelationen: Von A gehe ich zu B über,
25 dabei hebt sich die Lage ab, die beiden Bilder sind durch eine Einheit
der Lage verbunden, und diese ist verschieden, je nachdem ich die
Feder halte. Diese Einheit lässt sich durchlaufen, und der Übergang
ist immer wieder je nach der besonderen Form der Einheit ein ver-
schiedener, und im Übergang hat jedes einen Charakter und jedes
30 einen anderen.
Also, an dem A erfasse ich aufgrund des Übergangs und seiner
Synthese die relativen Charaktere, so wie ich an ihm die inneren
Charaktere aufgrund der explikativen Übergangssynthese explikativ
erfasse; nur das ist eigentümlich, dass die inneren Charaktere rein
35 aus dem A selbst durch bloß explikative Synthese geholt sind, an ihm

1 Doch das ist mittelbar.


text nr. 11 215

sind, ohne dass es eines Übergehens bedürfte zu einem „anderen“,


sondern nur zum eigenen, während die relativen erst im Übergang
zu anderem erwachsen und einen Fangarm zum korrelaten Objekt
haben.
5 Ferner: Es scheiden sich uns relative Charaktere, die dem A, sofern
es als α expliziert ist, zuwachsen (und speziell an dem α dann haften
und erst dadurch am A), andererseits relative Charaktere, die ihm un-
abhängig von solcher Explikation zuwachsen, als relative Charaktere
des Gesamtgegenstandes schlechthin (Lagencharakter, Gleichheits-,
10 Ähnlichkeitscharakter etc.). Beiderseits haben die relativen Charak-
tere etwas Sekundäres. Der innere Charakter des Ganzen, und zwar
der unmittelbare, tritt hervor in schlichter Explikation, der äußere
Charakter des Ganzen durch Applikation, durch erfassende Hinzu-
nahme eines anderen, und wechselt mit diesem anderen.1
15 Was ist damit gewonnen? Unser Ergebnis ist: An de m A e rfa ss e
i c h w i e i n ne r e , s o r elat ive M er k m ale. Innere Merkmale kom-
men zur Erfassung schlicht durch E igens ch af t- E x pl ik a ti on: Ich
erfasse A und dann, auf dem Grund der A-Erfassung, an dem A das
„weiß“. Ich erfasse es nicht als Gegenstand für sich, ich erfasse es in
20 ganz eigenartiger Weise: Die Intuition lehrt uns das kennen, dieses
schlicht vom Gegenstand und seiner Erfassung ausgehende, an ihm
den erfassenden Blick auf das „weiß“ richten. Und sie lehrt uns, dass
das so Erfasste, wir sagen, das innere Merkmal (die innere Beschaf-
fenheit oder „Eigenschaft“), noch nicht der Sachverhalt bzw. dass
25 die Merkmalserfassung noch nicht S a ch v e r ha l t s erf a s su ng ist. Es
bedarf der geänderten Einstellung des Blickes und der synthetischen
Konstitution des „A ist weiß“.
Nicht so schlicht geht es bei Relationen zu. Gewiss. Ich muss erst
das beziehende Verhalten, den Übergang von A zu einem anderen
30 Gegenstand üben, zu B. Aber zunächst nur, damit wieder ein Merk-
mal, hier das äußere, vorhanden und erfassbar sein kann. Erst muss
es konstituiert sein, damit ich es erfassen kann. (Auch das innere
Merkmal muss erst konstituiert sein.) 2

1 Das ist doch schief. Es kann doch auch A und B ein Stück gemein haben. Ich müsste

also unterscheiden: 1) Synthesen der Identifikation, 2) Synthesen der Vergleichung, 3)


Synthesen der Verbindung, 4) Synthesen der eigenschaftlichen Bestimmung.
2 Da steckt der Fehler. – Das Konstituieren des inneren Merkmals besteht eben in
216 explikative und prädikative synthesen

Durch den Übergang zu B hat die „Vorstellung“ des A, der


dem Erfassen des A zugrunde liegende Sinn der gegenständlichen
Auffassung, einen Sinneszuwachs erfahren. Das Erfassen des äuße-
ren Merkmals aber ist nachher phänomenologisch im Wesentlichen
5 gleichartig mit dem des inneren. Dem Allgemeinen nach, können
wir sagen, sind Merkmale, ob innere oder äußere, eben Merkmale,
in gleicher Weise am Gegenstand vorfindlich (abgesehen von dem
Ursprung durch beziehenden Übergang von Nominalien zu Nomina-
lien oder schlicht ohne solchen Übergang). Und gebrauchen wir das
10 Wort „Explikation“, um das Vorfinden des „an einem A“ aufgrund
der A-Erfassung zu bezeichnen, dann werden äußere Merkmale wie
alle Merkmale in der Explikation vorgefunden, erfasst.1 Es würde bei
diesem Wortgebrauch „explizieren“ soviel heißen wie „Merkmale,“
„Bestimmungen“, an einem Gegenstand erfassen, erfassen, was der
15 Gegenstand ist. Und es würde sich überall in gleicher Weise un-
terscheiden das bloße Explizieren als Erfassen der Merkmale am
Gegenstand (des Sinnesinhalts des Gegenstandes, Merkmalsbestands
desselben) und das Erfassen des Sachverhalts „A ist a“, „A ist ς
B“.
20 Dass dies alles richtig ist, kann nicht dem mindesten Zweifel unter-
liegen.2 Alles habe ich in dieser Überlegung auf genaueste Intuition
gegründet. Es versteht sich jetzt auch, warum das „ς“ nicht zum „ist“,
sondern zum B gehört. Es versteht sich die adjektivische Form und
die Gleichartigkeit in der Sachverhaltsfunktion für das innere wie das
25 äußere Prädikat, und zwar in letzter Hinsicht das „Relat“. A ist weiß;
A ist gleich – mit B; A ist groß – in Bezug auf B, oder größer – als
B; A ist weit weg – von B usw. Die Ergänzung des Relatbestandes
(des relativen Prädikats nach dem Bestand, der wirklich an dem A
sich findet) entspricht dem „Fangarm“, dem Zeiger auf das Korrelat-
30 Objekt.

der Explikation selbst. Wenn ich von G zu a übergegangen bin, habe ich eben das
Bewusstsein des a an G oder des G als Subjekt des a.
1 Explikation wäre dann der Name für die konstituierende Übergangssynthese.
2 Ganz gewiss, aber nur das ist nicht gezeigt (und konnte nicht gezeigt werden), dass

allererst eine Explikation das relative „an“ heraussondern würde und könnte. Das
„an“ ist zwar ein „an“, aber prinzipiell nicht als ein „in“ zu fassen.
text nr. 11 217

Es bleiben nun die Schwierigkeiten des Teilverhältnisses, der zu-


gehörigen Merkmale und Sachverhalte.1 Me r km a l i st n i ch t T e i l.
Der Teil ist in A, das Merkmal ist an A. Die Merkmalserfassung
ist eine ganz bestimmte Erfassungsweise (in einer ganz bestimmten
5 synthetischen Materie fundiert); die Teilerfassung ist etwas anderes,
ist Relationserfassung, und dem Teil läuft parallel das Merkmal, das
äußere Merkmal „ist Ganzes von B“, „umfasst B“ etc. Teile sind
relativ zu dem, was sie hat, selbständig, Merkmale sind unselbständig.
Freilich kann die Selbständigkeit wie bei Weiße als Gegenstand
10 bloß in der Verselbständigung liegen, die in der „Nominalisierung“
liegt. Aber das bedarf immer wieder der Überlegung, ob die „Nomi-
nalisierung“, die das innere Merkmal (aber auch jedes äußere) erfah-
ren kann, das Merkmal in einen Teil verwandelt und zwischen Subjekt
und Merkmal eine Relation zwischen Ganzem und Teil herstellt.2
15 Also, A hat Ähnlichkeit mit B: Liegt darin, dass A in Bezug auf
diesen neuen Gegenstand „Ähnlichkeit mit B“ ein relatives Merkmal
erhält, das also etwas Neues „an“ ihm ist, dasselbe, das in jedem „hat“
liegen soll: also „hat“ = „ist habend“?3

1 Das ist nun eine Sache für sich.


2 Ja, das tut es.
3 Synthesen der Identifikation. Synthesen der Vergleichung, der Verbindung, der

eigenschaftlichen Bestimmung. Nicht behandelt habe ich aber die Synthese der Ein-
ordnung, z. B.: „Dies ist ein Mensch“.
Nr. 12

D i e sc h ö pf eris c h e E rz e ugu n g
vo n Sa c h ve r h alt en , i hr e O b je kt iv i e ru ng
un d i hr e Exp li kat io n 1

5 § 1. Auffassung, Sich-Aufdrängen
und Richtung-auf im Erfassen

Das Sich-Hinwenden auf „vorgegebene“, „im Gemüt bereitlie-


gende“, „vorliegende“ Gegenstände, das Sie-erfassen-und-gegen-
ständlich-Machen. Die sinnlich-anschaulichen und anschaubaren Ge-
10 genstände, Dinge, Vorgänge, Gruppen von Dingen, Konfigurationen
von Dingen – aber auch Momente in Dingen, Eigenschaften: die
Farbe, die Gestalt, die Dauer, aber auch „die Dingseite (Seite dieses
Buches), so wie sie da erscheint“, wieder die sinnliche Darstellung
dieser Seite.
15 Auf „unselbständige“ Gegenstände kann geachtet werden: Dabei
muss aber vorgegeben, „vorliegend“ sein, wenn auch nicht eigenes
Objekt der Erfassung sein, der zugehörige selbständige Gegenstand,
der ganze. Es kann sein ein Gegenstand, der in der Zeit dauert, sich
verändert oder unverändert bleibt, sich bewegt oder unbeweglich
20 bleibt, oder es kann ein Vorgang sein. Ich kann auf die Bewegung,
auf die Veränderung gerichtet sein, ich kann aber auch gerichtet sein
auf das sich bewegende Ding.
Nun ist da e i n un d d a s s e l be „ B e r e it l i e g e n de “, u nd e s
si n d ver s ch i e d e ne Ge g e n s t ä n de d ar au s zu „ e n tn e h m en “; es
25 können aus dem Bereitliegenden durch Hinwendung und Erfassung
verschiedene Gegenstände erfasst, zu Gegenständen im besonderen
Sinn, zu Objekten, werden. Doch das ist eine Änderung in der
Redeweise: „Bereitliegend“ nannte ich oben die Gegenstände und
wir sprachen davon, dass Gegenstände, ehe sie Objekte sind, zu Ob-
30 jekten werden. Man ist aber da gezwungen, sich genauer zu überlegen,
was erlebnismäßig vorhanden ist. Ich bin dieser Kupferschale zuge-

1 23. 9. 1911. – Wichtig.


text nr. 12 219

wendet, und in der Umgebung, im erfüllten Gesichtsfeld heben sich


allerlei „Gegenstände“ ab, denen ich nicht zugewendet bin, die ich
nicht erfasse, auch nicht im Griff habe. Nun wende ich mich dem
einen oder anderen zu. Wir finden in einer eigentümlichen Refle-
5 xion, dass vor der Zuwendung die betreffenden Gegenstände schon
„bewusst“ waren, dass sie sich „aufdrängten“; dem Erfassen geht
ein Sich-Zuwenden zu einem „Sich-Aufdrängenden“ öfters merklich
(nachträglich merklich) vorher.
Was sich da aufdrängte, war etwa das Ding. Es könnte sich aber
10 auch die Farbe oder Form des Dinges aufdrängen: desselben Dinges.
Hier in dem vor der Erfassung Liegenden ein Gemeinsames: Die
Form des Aufdrängens und das „Ding“, das die betreffende Farbe
oder Form hat, das in gewisser Weise „bewusst“ ist, aber in verschie-
dener Form, sofern eben einmal das Ding selbst und einmal seine
15 Farbe, seine Form sich aufdrängte. Dabei ist es nicht ganz sicher, ob,
wenn sich die Farbe aufdrängt, sich nicht vorher das Ding aufdrängen
und wohl gar zur Erfassung kommen muss, wonach dann erst als
zweiter Schritt das unselbständige Moment oder der Teil, das Glied
sich aufdrängt.
20 Ob immer diese Unterscheidung zu machen ist, ob immer die
erfassende Zuwendung ein Aufdrängen voraussetzt? (Zum Beispiel
auch, wenn ich etwas höre; jemand spricht mich an, während ich in
meinen Sachen lebe: Die Worte drängen sich auf, werden bemerkt,
alsbald drängen sich die Gedanken auf, und ich richte den erfassen-
25 den Blick und den synthetischen in das Gesagte.) Ein Aufdrängen,
das vorhergeht, das ist schwer zu entscheiden. Jedenfalls, dass, wo
eine Erfassung wirklich stattfindet, „anders gerichtete“ Erfassungen
möglich sind und möglich waren (auf Grund eventuell verschieden
gerichteter Aufdrängungen) und was die Möglichkeit dazu hergibt,
30 das ist ein phänomenologisch eventuell Gemeinsames.
Versucht man zu sagen, es liege Auffassung zugrunde vor der
Erfassung, so tritt uns hier die merkwürdige Schwierigkeit entgegen,
welche in dem Phänomen liegt: Auffassung ist Auffassung als etwas,
also Auffassung als Ding, Auffassung als Vorgang, Auffassung als
35 Dingeigenschaft etc. Ist die hier in Rede stehende Auffassung vor
der Erfassung Auffassung als das eine oder andere oder als alles das
zusammen? Darauf wird man antworten: Es sei zu unterscheiden
zwischen A u f f as s u n g, hier auch wohl zu sagen: phansische Er-
220 explikative und prädikative synthesen

scheinung bzw. Erscheinungskontinuität, und „Ri c ht ung - a u f“. Die


Richtung-auf kommt herein schon durch das Si ch -Au fd rä n ge n
und durch das spontane Erfassen und explizierende Betrachten. Die
b loß e A uf f as sun g, die bloße Erscheinungskontinuität, ist n i c ht
5 R ic h t u n g auf das Ding, das dauert und sich dabei ruhend hält,
verändert etc., oder gar Richtung auf Dingseiten, auf Merkmale, auf
Momente der Erscheinung selbst, auf den Vorgang etc. Das alles
„liegt“ in der Auffassung, und sie selbst ist nichts anderes als eine
gewisse Kontinuität von Erscheinungen, von der wir sagen, dass
10 sich dabei die Erscheinungen „decken“, dass sie Bewusstsein, ob-
schon nicht Erfassung von Einheit sind. Aber dieses „von“ sagt nicht
Richtung-auf.
Man kann vielleicht sagen, dass diese Auffassung „in erster Linie“
Auffassung des dauernden Dinges sei, sofern dieses – wenn überhaupt
15 „auf Grund dieser Auffassung“ ein Sich-Aufdrängen statthat und
Erfassen – sich notwendig zuerst aufdränge, in zweiter Linie Farben,
sonstige Eigenschaften; wieder die Dauer, der Vorgang; wieder, im-
mer in anderer „Richtung“, die Erscheinungen selbst. Aber hat nicht
auch schon vor dem Erfassen eine Allee ihre Einheit, und drängt
20 sie sich nicht als Einheit auf, ehe sich noch die einzelnen Glieder
aufdrängen?
Es ist schwer, in der Auffassungsreflexion die Erlebnisse (die „Phä-
nomene“) zu befragen, und nur dadurch können wir ja Kenntnis hier
gewinnen. E s bl e i b t a l s o p r ob l ema t i sc h, in w ie f er n g ew is se
25 R i cht un g e n d es S i c h - A uf dr ä n g e n s vo n G e ge ns tä n den un d
d e s E rfa s s e ns de r s e l be n d u r c h di e p ur e Auf f a ss un g p rä de-
s tin i e rt si n d, ob hier Gesetzmäßigkeiten der Stufenfolge bestehen.
Aber sicher ist, dass die zu erfassenden Gegenstände, die sich in der
Erfassung offenbarenden, schon verborgen „vorliegen“ in Auffas-
30 sungen, und in Auffassungen, die im Allgemeinen nicht nur diese,
sondern so manch andere Gegenstände in sich geborgen oder ver-
borgen haben. Wie weit die Wesenszusammenhänge hier reichen und
wie sie zu beschreiben sind, ist ein Problem. In der „Auffassung“
haben wir also potenzielle Gegenständlichkeiten, in der Erfassung
35 haben wir aktuelle, nur in ihr ist wirklich etwas gegenständlich: Es ist
eben erfasst und noch in Fassung, ergriffen oder noch im Griff.
text nr. 12 221

§ 2. Blinde und von Erfassung durchleuchtete


Gegenstandsphänomene. Affektives Zuhandensein
gegenüber dem Zuhandensein aus schöpferischer
Spontaneität. Das Ergreifen und Explizieren der
5 durch Synthesis konstituierten Gegenstände

„Auffassung“ ist offenbar ein wenig gutes Wort.1 Ich sagte auch in
der bevorzugten, aber noch unklar begrenzten Sphäre unserer Über-
legung „Erscheinung“. Sagen können wir auch „Gegenstandsphäno-
men“ oder „Gegenstandsphansis“. Und es handelte sich im Kreise
10 unserer Betrachtung um solche Gegenstandsphänomene, die vor der
Erfassung in sich „dunkel“ sind, nicht etwa selbst schon Erfassungen
einschließen. Man wird hier sofort an den Le i bn i z’schen Gegensatz
zwischen bloßen Perzeptionen und Apperzeption denken, obwohl
man leicht sieht, dass er sich mit dem, was hier in Frage steht, nicht
15 völlig deckt. Wenigstens gehen unsere Intentionen viel weiter. Wir
haben also zunächst blinde Gegenstandsphänomene, in denen nichts
von Erfassung lebt, gegenübergestellt solchen, in denen Erfassung
statthat, und zwar in dem Sinn, dass aus den blinden das Erfassen
einen Gegenstand erfasst, etwas g eg en s t änd li ch m ac ht. Hierbei
20 ist zu untersuchen, wie sich das Gesamtphänomen des Erfassens zu
dem blinden Gegenstandsphänomen verhält, inwieweit das Erfasste
gegenüber dem allgemeinen Charakter des Erfassens einen Gehalt
hat, der wesentliche Gemeinsamkeit besitzt mit dem blinden Phäno-
men, wie sich ja auch darin anzudeuten scheint, dass das erfassende
25 Phänomen Modifikationen zulässt, wodurch es auf Grund desselben
ihm einwohnenden Gehalts andere Gegenstände entnehmen lässt
und dieselben, von denen es heißt, dass sie aus dem blinden zu
entnehmen sind.
Wir haben aber noch einen anderen Gegensatz mit angedeutet:
30 vo n Er f ass u n g n i c h t d ur c h l e u c ht e t e Ge g e n st a n ds p hä no-
m e n e u nd v o m Er f as s e n d ur c h l e uc hte t e. Das Letztere umfasst
nicht nur die Phänomene, in denen aus einem blinden Phänomen
ein in ihm verborgener Gegenstand entnommen wird, sondern auch

1 Eben nicht bloße Auffassung, sondern Gegenstandsbewusstsein vor der Zuwen-

dung.
222 explikative und prädikative synthesen

die Fälle, wo Erfassen mit Erfassen sich zu einer Synthesis einigt


und eine Gegenständlichkeit dadurch produktiv konstituiert wird,
die doch nicht erfasst ist. Von vornherein ist hier zu beachten, dass,
wenn sich Akte der Erfassung synthetisch aufeinander bauen, eben
5 das die Synthesis charakterisiert, dass sie ein Aktganzes erzeugt, das
als Ganzes nicht Erfassung ist, aber ein Bewusstsein-von, ein Blick
auf: nämlich das Thema.
Es kann sein, dass Gegenstände „vorgegeben“, „vorliegend“,
„vorhanden“ sind, und zwar bewusstseinsmäßig (erlebnismäßig),
10 während nichts von Erfassen aktuell ist, das sich auf sie bezieht,
genauer auf das gesamte Gegenstandsphänomen, dem sie zu entneh-
men sind, sich gründet. Und es kann sein, d a ss G e gen s tän d e z um
„ Vo r ha n d en “ - S ei n kom m en a u f s c h öpf e ri sc he We i se, näm-
lich dadurch, dass Gegenstandserfassungen auf Gegenstandserfas-
15 sungen sich synthetisch bauen, und das Wort „synthetisch“ sagt, dass
als Ergebnis dieses Sichbauens ein „vorhandenes Gegenständliches“,
ein Gegenstandsphänomen, Erlebnis ist, das eben v or h and e n i s t
f ür e i n m ög l i ch e s n e u e s E r fa ss en un d  nic ht in der S y n-
t h e s e s e l b s t e rf a s st i s t , s o n de rn z u s ei ne r E rf as s un g e i ne n
20 ne u e n a c t us b e n öt i g t.1 Vielleicht sagen wir besser „zuhanden“.
Also, Gegenstände sind zuhanden, das sagt, gewisse Erlebnisse sind
im Zusammenhang eines Erlebens (eines erlebenden Subjekts: was
immer das phänomenologisch besagen mag), aus denen ergreifende
Akte die betreffenden Gegenstände ergreifen können.
25 Das Zuhandensein kann ein af f e k t i v es sein: Wir sind affiziert,
rein rezeptiv, passiv. Keine Spontaneität ist an dem Zuhandensein be-
teiligt, wobei dahingestellt bleiben mag, ob die Affektion auf frühere
Spontaneität zurückweist oder nicht. Das Zuhandensein kann ein
spontanes sein (das bloß Zuhanden- und nicht Ergriffensein); es ist
30 eine schöpferische Spontaneität, welche das Gegenstandsphänomen,
das Vorhandensein des Gegenstandes erzeugt.2 (Würden wir das Wort
Konstitution hier anwenden wollen, so würden wir von affektiver und
schöpferischer Konstitution zu sprechen haben.)

1Gut. Hier ist Erfassen also Gerichtetsein-auf.


2Man kann ad Spontaneität aber fragen: Gibt es nicht Freiheit des Durchlaufens
im Hintergrund? Ist unter Spontaneität hier nicht eine Ich-Aktivität, eine besondere
Spontaneität gemeint?
text nr. 12 223

Nun bleibt aber noch Folgendes zu erwägen. Ist uns ein Ge-
genstand durch Affektion vorgegeben und ist er im sehenden Akt
ergriffen, so kann er expliziert werden. Das Ergreifen setzt sich fort
im Analysieren, im Explizieren des gegenständlichen „Inhalts“. Wir
5 haben also das Gegenstandsphänomen als bloßes Zuhandensein, das
modifizierte Gegenstandsphänomen als Ergriffensein und als Pro-
zess der Explikation, dazu das „noch im Griff sein“ gegenüber dem
aktiven Ergreifen und Ergriffen-Haben.
Gehen wir nun über zu den syn th eti sch en Akte n, den Syn-
10 thesen von Akten des Ergreifens und Im-Griff-Habens, so erzeu-
gen diese neues Vorhandensein mit neuen Gegenständlichkeiten, die
nicht beschlossen sind in den Gegenstandsphänomenen der Fundie-
rung. Wenn nun ein Ergreifen auf diese Gegenstände geht, und zwar
auf den gesamten durch die Synthesis konstituierten Gegenstand, so
15 kann auch der expliziert werden; zum Beispiel, A enthält B – nun
werfe ich einen erfassenden Griff auf diesen Sachverhalt und kann
nun sagen: Er enthält „A“, „B“, die Form „enthält“ etc.
Dann also dient die erneute Erfassung des A als explizierender
Akt, ebenso die von B. Was die Form anlangt, so wird sie nun ex-
20 plikativ erfasst. Aber sie wird, obschon sie vorher nicht erfasst war,
doch nicht aus dem Dunkel hervorgezogen. Überhaupt ist es das
Eigentümliche dieser Zuhandenheiten, dass man einerseits sagen
muss: Im „A hat B“ sei A und B erfasst und nichts anderes, und
dass ein eigener erfassender Griff auf das Ganze als Ganzes möglich
25 ist, andererseits aber, dass man doch sagen muss, der „Blick“ ruhe
auf A nicht nur und auf B, sondern auch auf dem „Haben“, und der
Sachverhalt sei in dieser originären Form durchaus „gesehen“, im
hellen Bewusstsein bewusst, und das viel besser, möchte man sagen,
als in dem zurückblickenden einheitlichen Ergreifen, wie wenn wir
30 anknüpfen: „Dieser Sachverhalt …“.
224 explikative und prädikative synthesen

§ 3. Schlichtes Ergreifen und sich daran


anschließende schrittweise Explikation eines
Dinges bzw. eines Vorgangs gegenüber der
schrittweisen Erzeugung des Sachverhalts im Urteil

5 Die Hauptfrage ist hier vor allem: Ist es durch genaueste phänome-
nologische Analyse wirklich zu bestätigen, dass das objektivierende
„Ergreifen“, wie wir es bei Zuwendungen der Gewahrung (Wahrneh-
mung) finden, auf eine Stufe zu stellen sei mit dem zurückgewendeten
„Nominalisieren“, das auf ein aktuelles Urteilen „S ist P!“ folgend
10 sich anschließt als „diese Tatsache, dass …“, und nicht vielmehr schon
mit dem aktuellen Urteilen selbst?
Jemand möchte sagen:1 Ich sehe das Ding, betrachte es. Ebenso
in der Erinnerung: Dem Erinnerten wende ich mich zu, erfasse es.
Ebenso in der Phantasie. Nun ebenso, warum sollte das so wesentlich
15 verschieden sein, „sehe“ ich, dass dieses Papier weiß ist. Urteile ich
„Dieses Papier ist weiß!“, so bin ich doch all dem zugewendet, nicht
bloß wie im ersten Schritt „dieses Papier“ dem Papier und dann dem
„weiß“, sondern diesem Ganzen „Dieses Papier ist weiß!“. Es ist
dabei gleich, ob ich aufgrund der Wahrnehmung oder Erinnerung
20 oder Phantasie urteile.
Freilich, dem Ding mich zuwendend vollziehe ich ein schlichtes
Ergreifen, in einem Griff fassend, und daran schließt sich Explikation,
Schritt für Schritt. Andererseits, wenn ich den Sachverhalt „sehe“,
ich ihn im anschaulichen Urteilen „erfasse“, so ist das eben kein
25 schlichtes Ergreifen eines zuhanden Seienden, nichts dem ich mich
„einfach“ zuwenden könnte. Es ist vielmehr e i n s ch ri ttw ei s es
E r g re i f e n, wobei sich schrittweise das Ergriffene allererst konsti-
tuiert, und das macht den allerbedeutsamen Unterschied. Die Sach-
lage ist dabei freilich2 auch wieder ganz anders als in den Fällen
30 eines oft so abwechslungsreichen Vorgangs, der auch immer Neues
hereinbringt, das im Erfassen des Vorgangs immer neu zum Erfassen

1 Dass dieses falsch ist, wird nachher erwiesen, zunächst „Begründung“ der Ansicht.
2 In gleicher Art kann hier herangezogen werden das Sich-Konstituieren des Gegen-
standes äußerer Wahrnehmung in der Kontinuität der Erscheinungen, wenn ich über
den Gegenstand hinblicke und immer Neues von ihm sehe.
text nr. 12 225

kommt. (Nicht alles schlichte Ergreifen ist ja Zuwendung zu einem


schon im Voraus zuhanden Seienden, schon längere Zeit Bewussten,
ehe es ergriffen wäre. Beim Ergreifen eines Vorgangs streckt das
Ergreifen dem stetig Neuen und Neuen die offene Hand entgegen.
5 Sowie es „auftritt“, wird es ergriffen.) Der Vorgang spielt sich all-
mählich ab und tut es im einheitlichen Erfassen, das ihn erfasst, aber
nicht erzeugt; es tritt auf, ich erfasse es. Hingegen der Sachverhalt
wird zwar auch schrittweise ergriffen, aber auch durch das Ergreifen
allererst erzeugt. Die Gegebenheit des Vorgangs ist eine rezeptive
10 Gegebenheit, die des Sachverhalts eine produktive.
A ber das a ll es d a rf u ns n ic ht ir re m ac he n, und zudem ist
das Letztgesagte unklar. Was soll das sagen, der Sachverhalt wird
erzeugt? Erzeugt sich nicht auch der Vorgang? Und inwiefern soll
einmal das Ergreifen nicht erzeugen und das andere Mal erzeugen?
15 Wir sehen freilich wesentliche Unterschiede: Einmal verhalte ich
mich schlicht ergreifend, und obschon ich eventuell Schritte habe,
sofern der Vorgang zum Beispiel einer Melodie diskrete Teile hat,
so ist das Ergreifen der Einheit des Vorgangs außerwesentlich. Auch
wenn ich ihm nicht zugewendet wäre, auch wenn er sich bewusstseins-
20 mäßig abspielte, während ich anderem zugewendet bin, konstituierte
er sich als einheitlicher Vorgang, nur als unerfasster. Aber damit
der Sachverhalt überhaupt konstituiert ist (in Gegebenheitsweise),
bedarf ich der Schritte der Zuwendung und produktiver Setzung;
durch sie erst gewinnt das Bewusstsein die Bewusstseinsformen des
25 konstituierten Sachverhalts.
Vor allem aber heißt es, sich nicht verwirren lassen. Ich erfasse
einen Ton, der anfängt und aufhört, ich erfasse einen Vorgang, der
seine bald gleichen, bald wechselnden Phasen und Glieder hat. Das
Erfassen ist ein zeitlich kontinuierliches, und in jeder Phase des Er-
30 fassens erfasse ich schlicht etwas von der Sache, etwas vom Vorgang
(es tritt auf, ich nehme es), und das Vorher-erfasst-Gewesene ist, da
ich nicht einer punktuellen Phase, sondern einem konkreten Gegen-
stand, und nicht einem Glied des Vorgangs, sondern einem Vorgang
zugewendet bin, in der Retention festgehalten. Eben das ist schlichtes
35 Erfassen eines Gegenstandes, sich so verhalten.
Ganz anders steht die Sache, wenn wir das Urteil vollziehen „S
ist p!“, „Dieses Papier ist weiß!“ Hier erfassen wir eben nicht, es
ist nicht etwas da, dem wir uns zuwenden, nach dem wir fassen,
226 explikative und prädikative synthesen

greifen, sondern wir stellen etwas hin, setzen es in formend erzeugen-


der Weise, bzw. ein anderweitig Gegebenes, in einem anderweitigen
echten Erfassen Gegebenes setzen wir als „dieses“, subsumieren es
unter Papier und stellen hin „dieses Papier“ usw. In gewisser Weise
5 handelt es sich um Produktionen, und in ihnen sind die Produkte
freilich „im Blick“ des Bewusstseins. Aber dieser Blick ist nicht ein
wahrnehmender, nicht ein erfassender im prägnanten Sinn.
Wir werden sagen können und müssen: Der Prozess vollzieht sich
in Schritten, und jeder Schritt hat allerdings ein Gemeinsames mit
10 dem schlichten Erfassen. In jedem Erfassen sind wir auf das Erfasste
hi n g e r ic ht et. So sind wir auch im „dies“ und so in jedem Schritt
a uf e t w as ge ri c h t e t, das eventuell in einem unterliegenden schlich-
ten Erfassen Erfasstes ist. Also die Gemeinsamkeit liegt in dieser
Richtung-auf.
15 Andererseits aber ist es falsch zu sagen: Es liege nicht nur ein
schrittweises Gerichtetsein, Zugewendetsein (und gleichsam Erfas-
sen im weiteren Sinn) vor, sondern durch diese „erfassenden“ Akte
konstituiere sich allmählich ein Ganzes, dem wir in gleicher Weise
zugewendet sind oder das im ganzen Prozess das „Ergriffene“ sei.
20 Mitnichten. Will man schon das Sich-Richten jedes Schrittes ein
produktives Ergreifen oder Erfassen nennen, sofern ja das, was da
Zielpunkt der Richtung ist, im Blick ist oder im Griff ist, so ist
doch evident, das in diesem Sinn der ganze Sachverhalt eben nicht
„ergriffen“ ist (nicht Zielpunkt der Richtung-auf). Es ist zwar analog
25 wie beim Vorgang jeder Schritt „noch bewusst“ und festgehalten,
aber es ist nicht der Sachverhalt so bewusst wie ein Vorgang, nicht
„Objekt“ der Richtung-auf. Um den Sachverhalt als Objekt, als Rich-
tungsziel zu haben, müssen wir vielmehr reflektieren, nominalisieren.
(Und auch dann ist zu unterscheiden zwischen dem ganzen Gebilde
30 in der nominalen Form, das „bewusst“ ist, und dem, was Zielpunkt
der Richtung ist. Doch das führt genauer besehen in eine andere
Linie.)
text nr. 12 227

§ 4. Der Unterschied beim Sachverhaltsbewusstsein


zwischen der Zuwendung zum Thema und der Richtung
auf den Gegenstand. Die Zuwendung zum Sachverhalt
im Wie gegenüber der nominalisierenden Reflexion
5 als Richtung auf den Sachverhalt schlechthin

Damit sind unsere Fragen beantwortet: Im schrittweisen Sach-


verhaltsbewusstsein, das wir Urteilen nennen, „konstituiert sich“
originär eine neuartige Gegenständlichkeit, aber sie ist nicht ge-
genständlich in dem prägnanten Sinn der Richtung-auf. Sie kann es
10 werden, und dazu bedarf es eines Erfassens, Sich-Richtens-auf. Also
nur gewisse eigenartige Akte, die das Eigentümliche haben, schon
„konstituierte“ Gegenständlichkeit vorauszusetzen, sind erfassende;
und derart erfassende Akte, sich aufeinander bauend, konstituieren
Neues, das aber, indem es sich so konstituiert, dadurch erst fähig wird,
15 in einem neuen Erfassen eben erfasst zu werden.
Andererseits ist bei der offenbaren Gemeinsamkeit des Begriffs
Erfassen sorgsam zu scheiden: Dasjenige Erfassen, das wir im schlich-
ten Anschauen finden, und dasjenige, das wir als Untersetzung im
Urteil finden. Das schlichte und eigentliche Erfassen (im klaren An-
20 schauen oder im dunklen, schlichten Vorstellen) kann dem Unterset-
zen zugrunde liegen und mit ihm einig sein: wie dann das ganze Ur-
teilen auf Anschauen gegründet und mit ihm eins sein kann (genauer
gesprochen: eins mit dem schlicht erfassenden Akt, dem schlichten
Zuwenden). In der Oberschicht hat dann das Zuwenden des Unter-
25 setzens „Richtung-auf“, die auch ohne Anschauung bestehen kann
und dann eine Denkzuwendung und ein Sich-richten des Denkens ist.
Aber ist wirklich alles schon aufgeklärt?
Es ist doch noch Folgendes zu bedenken.1 Erfassen im eigent-
lichen Sinn ist Nehmen eines Sich-Gebenden. Darin liegt ein Zuge-
30 wendetsein zum Sich-Gebenden, ein Darauf-Gerichtetsein. Zwischen
Zugewendetsein und Gerichtetsein ist hier nicht zu scheiden.
Was das Gerichtetsein anlangt, so ist es im Fall eines vielgestaltigen
Vorgangs und im Fall einer durchlaufenden Erfassung, bei welcher
eine Erscheinungsreihe abläuft, während das Erscheinende eines und

1 Zuwendung und Richtung-auf bei den synthetischen Akten ist nicht ein und

dasselbe.
228 explikative und prädikative synthesen

dasselbe ist, worauf wir gerichtet sind, eigentlich etwas Komplexes


und sich stetig Wandelndes. Ein dauerndes Objekt, über das wir hin-
blicken, bietet, vermöge der immer neuen Erscheinungen innerhalb
einer Erscheinungskontinuität, immer Neues vom Objekt bzw. auch
5 immer näher sich Bestimmendes, in immer neuer Weise Gegebenes
von dem schon weniger klar Gegebenen usw. Der lebendige Strahl
richtet sich immer auf Neues vom Objekt; aber das soeben im Strahl
Gelegene ist zugleich festgehalten (mag es auch „zurücksinken“,
an Klarheit einbüßen, wiedererfasst neue Klarheit gewinnen und
10 im Wiedererfassen den Charakter des „wieder“ erhalten usw.). Im
Zeitbewusstsein expandiert sich der kontinuierliche Strahl, sofern er
immer neue Lebendigkeit ist, und zeichnen können wir das nur so:

Die Zuwendung oder Richtung-auf ist die auf das Objekt, und
15 sie konstituiert sich dadurch, dass ein lebendiger Strahl des Sich-
Richtens auf immer neue Phasen (zumindest Zeitphasen) geht und
zugleich durch Retention das Erfasste in seiner Einheit erfasst bleibt.
Das Sich-Richten ist dabei ein Modus der verlaufenden und in ihrer
Art in Retention verbleibenden Erscheinungen.
20 G a n z a nd e rs ist die Sachlage für sy n t het is ch s ic h kons t it u-
i e re n de G e g e n stä n d l i ch k e i te n, also etwa im kategorischen Ur-
teil. Hier finden wir in den „Schritten“, in denen sich der Sachverhalt
bewusstseinsmäßig konstituiert auch je eine Richtung-auf. Aber es
ist nicht e i n lebendiger Richtungsstrahl, der durch schlichte Erschei-
25 nungen hindurchgeht in der beschriebenen Weise. Der Erscheinung
(Apparenz) entspricht hier das bestimmte logische Gebilde, etwa
das nominale Subjekt usw. Jedes solche Glied wird, wenigstens im
Allgemeinen, in mehreren Strahlen sich konstituieren, aber so, dass
nicht etwa die Retention das in den früheren Strahlen „Erfasste“,
30 sagen wir Erstrahlte, in die Gegenständlichkeit hineinnimmt, die die
Gesamtrichtung-auf, die dem abgeschlossenen Nominale zugehört,
erstrahlt. Die Richtungen der Glieder des Nominale richten sich nicht
(es sei denn ausnahmsweise) auf dasjenige, worauf sich das ganze
Nominale richtet.
text nr. 12 229

Es ist ferner aber auch zu sagen: In gewisser Weise, das lehrt die
phänomenologische Evidenz, wird doch in jedem Schritt nicht nur
Neues getroffen, worauf die Richtung-auf geht, sondern es wird, was
einmal getroffen war, auch festgehalten: obschon es im Allgemeinen
5 aufhört, zu dem zu rechnen, worauf die Richtung-auf des Gesamtkon-
stituierten, des Gliedes des Sachverhalts, geht. Jedes „Glied“ hat wohl
eine Richtung-auf (nur so ist es Syntagma), und wir scheiden für jedes
das „Gegenständliche“, das, worauf wir urteilend in diesem Glied
gerichtet sind (diesem Glied als vollständig konstituierten), und was
10 im Blick ist als Festgehaltenes der diese Richtung konstituierenden
und doch außer ihr liegenden Richtungen. Das Gegenständliche hat
sein Wie, das im Blick ist, „der Kaiser, welcher den Reichstag eröffnet
hat“: Auf das alles haben wir nicht nur hingesehen, der Blick ruht,
wenn wir zu Ende sind, fortgesetzt darauf. Nur auf den Gegenstand
15 Kaiser sind wir aber mit dem ganzen Nominale gerichtet. Das, was
der Apparenz im Fall der schlichten Erfassung einigermaßen ana-
log ist, nämlich das Nominale, ist in eigentümlicher Weise im Blick
und doch nicht in Richtung-auf. A ls o t rete n h ie r a us e in a nde r :
Zu we n d u ng z u d e m „ T he m a “, zu dem ganzen Gehalt des Nomi-
20 nale, und R i ch t un g a uf de n Ge g e nst and. Und zugleich ist es klar,
dass, wenn wir Kategorialien auf Kategorialien bauen und ein eventu-
ell sehr komplexer Sachverhalt in der jeweiligen kategorialen Form
sich konstituiert, dass dann de r S a c h v e rh al t ni ch t Z i el p unk t
e in e r Ri c h t u ng - au f i s t, wä h r e nd e r d oc h G eg en g li e d ei ne r
25 Z u w e nd u n g i s t.
Aber wir dürfen noch immer nicht zufrieden sein. „Zugewendet“
(thematisch) sind wir dem Sachverhalt im Wie, all dem, was schritt-
weise Zielpunkt von Richtungen war und in gewisser modifizier-
ter Weise auch bleibt, und was das gesamte „Thema“, den ganzen
30 Satz aufbaut. Und diese Zuwendung bezeichnen wir als Zuwen-
dung zum Sachverhalt im Wie, denn, was da im Blick ist, das ist
in seinen Bestandstücken eben das, was schrittweise in Richtung
war.
Vollziehen wir nominalisierende Reflexion, so ist der Sachverhalt,
35 aber nicht der Sachverhalt in diesem „Wie“, sondern der Sachver-
halt schlechthin Zielpunkt der Richtung-auf. Ganz ebenso wie im
Nominale der Gegenstand schlechthin in Richtung-auf ist. Um den
Sachverhalt im Wie gegenständlich, also als Zielpunkt zu haben, be-
230 explikative und prädikative synthesen

dürfen wir einer anderen Reflexion, die das, was vordem „im Blick
der Zuwendung“ war, zum Zielpunkt einer „Richtung-auf“ macht.
Kann man sagen, eine Analogie besteht hier darin: Ein sinnlicher
Gegenstand ist Zielpunkt nur dadurch, dass der Strahl der Richtung
5 durch bestimmte Erscheinungen geht? Dadurch ist der Gegenstand
nach bestimmten „Seiten“ dargestellt und steht in ihnen bewusst-
seinsmäßig da. Und viele Erfassungen, die alle denselben Gegenstand
erfassen, also dieselbe Richtung haben, können sich dadurch unter-
scheiden, dass sie denselben Gegenstand in einem verschiedenen Wie
10 erfassen. Das „im Wie“ ist im Blick, aber nicht in der Richtung, nicht
ihr Ziel.

§ 5. Explikation und Verdeutlichung des


Sachverhalts durch Wiedererzeugung. Die doppelte
Art des Sachverhaltsbewusstseins. Die beiden
15 Arten von Originarität bei synthetischen Akten

Nachdem wir im artikulierten Urteil einen Sachverhalt konstitu-


iert haben, können wir den Blick auf den Sachverhalt als Einheit
richten, und nun haben wir ihn gleichsam wie einen schlichten Ge-
genstand. Diesen können wir uns näher bringen, analog wie wir einen
20 schlichten Gegenstand explizieren. Wir bringen ihn „näher“, indem
wir nämlich in wiederholter synthetischer Konstitution aussagen „S
ist p!“ und dabei das Ausgesagte im schlichten Blick festhalten. Wir
sagen etwa so: S ist p! Das Wetter ist trüb geworden! Diese Tatsache ist
landwirtschaftlich von großer Bedeutung, diese Tatsache: Das Wetter
25 ist trüb geworden. Wir wiederholen etwa und das halten wir fest.
Wiederholend, neu erzeugend expliziert sich gleichsam die Meinung
von dieser Tatsache (das Gemeinte).
Ist das nun wirklich Explikation? Es ist, wird man sagen, Erfül-
lung, Bekräftigung der „Meinung“. Aber liegt nicht das Erfassen des
30 Sachverhalts (als kontinuierliches Ergriffen-Haben) zugrunde und
deckt sich nicht damit schrittweise das „S ist p“? In der Erneuerung?
Ganz wohl. Aber in der Dingexplikation betrachte ich das Ding, aber
hier betrachte ich nicht den Sachverhalt. Doch warum könnte ich das
nicht? Ich vollziehe „S ist p“ und sehe mir nun den Sachverhalt immer
35 wieder an. Ich sehe mir ihn an: Ich wende meinen Blick auf ihn als
text nr. 12 231

einheitlichen Gegenstand und sehe mir seine Teile an. Ich durchlaufe
explizierend seine Teile, natürlich in geänderter Einstellung, wobei
ich aber immer wiederholen muss: Es ist ein Neu-Urteilen und doch
in geänderter „Einstellung“.
5 Das obige Beschriebene war etwas irreführend, insofern als ich
nach Vollzug des Sachverhaltsbewusstseins und Rückwendung auf
den Sachverhalt als Gegenstand neue Urteile anknüpfen will, wobei
das Vorstellen des Sachverhalts inzwischen, während meiner Rich-
tung auf neue Gedanken, leer oder unklar geworden ist, und nun
10 habe ich das Bedürfnis, mir den Sachverhalt näher zu bringen, klarzu-
machen, mir ihn wieder vor Augen zu stellen, was nicht Explikation
ist, nämlich nicht Analyse und Einzelerfassung von Teilen.
Es tritt hervor, d ass N ä her b ri ng en , Kla r - und D e ut l ic hm a-
c he n be i d e n s i nn l ic he n un d k a t ego ria l en G eg e ns t än dl i ch -
15 k e i t e n Ve r s c hi e d e n es f o rde rt: Bei den sinnlichen, insbesondere
den sosehr inhaltsreichen dinglichen, Analyse, bei den kategorialen
Wiedererzeugung, die eo ipso deutlich ist, weil in ihr selbst schon Ar-
tikulation liegt. Aber ich kann auch hier sagen: Mit der Neuerzeugung
und ihrer Artikulation findet zugleich hinsichtlich des „schlichten“
20 Sachverhaltsbewusstseins Verdeutlichung im Sinn der Explikation
statt.
Ein eigentümlicher Unterschied ist aber der, dass schlichte sinnli-
che Erfassung, wenn sie anschaulich, gebende oder quasi-gebende
sein soll, nur ein Zuhandensein voraussetzt, das rein affektiv ist,
25 während das schlichte Erfassen des Kategorialen nur in Hinblick auf
artikulierte synthetische Erzeugung bzw. auf das in ihr Konstituierte
möglich ist.
Und ein weiterer Unterschied ist, dass nun doch das Zuhandenha-
ben des Sinnlichen blind ist und das des Kategorialen nicht: nota bene
30 des anschaulichen Vorhandenseins. (Denn schon das Vorhandene
kann anschaulich und unanschaulich sein: klar und dunkel.) Und
da liegt wieder die Schwierigkeit. Ich habe mich ja dazu verstanden,
das schlichte Erfassen, Zum-Gegenstand-Machen des Sinnlichen und
das Zum-Gegenstand-Machen oder Erfassen des Kategorialen (in
35 einer „Reflexion“, die Synthesis voraussetzt), auf gleiche Stufe zu
stellen und unter denselben Begriff zu bringen. (Das ist vollkommen
berechtigt nach dem Gemeinsamen der „Richtung-auf“.) Aber ist
es vermeidlich, andererseits auch anzuerkennen, dass jedes solche
232 explikative und prädikative synthesen

Erfassen etwas gemeinsam hat mit dem Bewusstsein in der Synthesis


selbst?
Gewiss. Es ist etwas spezifisch Eigentümliches, das Zum-Gegen-
stand-Machen-und-Haben, das Objektivieren, wie es im einen und
5 anderen Fall vorliegt, ob wir auf ein Ding hinsehen oder auf einen
Inbegriff oder auf einen Sachverhalt. Andererseits, wenn wir urteilen,
sind wir doch dessen „bewusst“, in einem anderen Sinn „zugewen-
det“ dem „S – ist p“. Aber diese Zuwendung ist eben keine Objek-
tivierung, kein Gerichtetsein-auf. Umgekehrt werden wir aber sagen
10 müssen, die Objektivierung ist a uc h Zuwendung?
Ein Sachverhalt ist in doppelter Art bewusst (ein kategorialer,
überhaupt synthetischer Gegenstand): 1) originär, synthetisch-schöp-
ferisch, aber nicht objektivierend; 2) in einer objektivierenden „Re-
flexion“, schlicht.
15 Jedes synthetisch-schöpferische Bewusstsein eines Sachverhalts
(eines synthetischen Gegenstandes) ist in Objektivierungen fundiert
und schließt sie in sich ein. In gewisser Weise gilt das zwar auch von
dem „frischen“ objektivierenden Erfassen des Sachverhalts: Aber
die Objektivierungen haben dann sämtlich den Charakter von Fest-
20 haltungen (es sei denn in der explizierenden Wiedererneuerung). Ich
spreche von frischen objektivierenden Akten des Erfassens. Nämlich
s y n t h e t i sc he A kt e s i nd i n ve r s ch iede ne m S in n o ri g i när
u n d n i c ht o r i g i n är.
1) Sie sind ursprünglich synthetisch, wirklich schöpferisch vollzo-
25 gen in Artikulation, oder sie sind nicht schöpferisch vollzogen, sie
haben ihre Artikulation eingebüßt, sie sind verworren, z. B. verwor-
renes „Auffassen“ eines Satzes oder urteilendes Aussprechen. Diese
Verworrenheit ändert nichts am allgemeinen Charakter des Aktes:
Das Urteil ist verworrenes Urteil. Es ist diese Verworrenheit nicht zu
30 verwechseln mit einem objektivierenden Vorstellen des Sachverhalts.
2) Die andere Art der Originarität ist die der Klarheit und Evidenz,
die ihrerseits Artikulation fordert. Genau dasselbe gilt vom objek-
tivierenden Erfassen von Sachverhalten: Es kann klar und deutlich
sein, artikuliert, sofern es sich auf eine artikulierte Synthese zurückbe-
35 zieht, nicht artikuliert, verworren, sofern es sich auf eine verworrene
zurückbezieht.
Wohl eine andere Verworrenheit ist die, wo keine soeben noch
vollzogene deutliche oder verworrene Synthesis bewusst ist und ich
beilage xviii 233

etwa das Verständnisbewusstsein vollziehe „die Tatsache, dass Sp


ist“ – so einfachhin.

Beilage XVIII
Rezeptive und produktive Objektivation. Das schlichte
5 Erfassen eines sinnlich-rezeptiv Vorgegebenen
gegenüber dem Erfassen im Erzeugen einer
neuen Materie in höheren Objektivationen1

Schlichtes Erfassen (schlichte Zuwendung), Sondererfassen in der Ex-


plikation, beziehendes Erfassen als das spezifisch thematische oder logische
10 Erfassen in seinen verschiedenen logischen Formen: Das ist zunächst eine
Reihe von sozusagen formalen Gestaltungen. Wir brauchen notwendig ein
Wort, das sie alle umspannt, wie sie offenbar wesensmäßig zusammengehö-
rig sind und verwandt sind. Es bleibt wohl kein besserer Name übrig als
„O b je kt iv a t io n“, und zwar r ez ep t i ve O b jek t iv ati o n für das schlichte
15 Erfassen, p r o d uk t ive Obj e kt iva ti on für das Gebiet der thetisch und
synthetisch objektivierenden und dabei Themata produzierenden Akte. Das
sind durchaus formale Bestimmungen, weil damit Erlebnisse nur nach ei-
nem formalen Aspekt, nur nach einer unselbständigen Seite bezeichnet
sind.
20 Eine rezeptive Objektivation ist ein Erlebnis, das so heißt, weil es ein
Erfassen ist, aber ein Erfassen ist Erfassen von etwas. Bloßes Erfassen unter
Abstraktion von dem Was ist ein Abstraktum. Also zur Konkretion gehört
eine Ergänzung: der phänomenologische Stoff der Objektivation (ontisch
heißt das, der Gegenstand wird in der und der Darstellungsweise etc. erfasst,
25 phänomenologisch, das Erfassen hat einen Stoff, durch welchen der Gegen-
stand in bestimmtem Sinn „vorstellig“ ist). Bei den Urteilen bestimmt sich
der Stoff durch die Termini und näher durch deren Kerne.2 Die Urteilsformen
sind zum Wesen der Urteilsobjektivation als solcher gehörige Formen, doch
heißt es hier vorsichtig sein. Es sind zw ei Au f fas s u n gen zu überlegen.
30 1) Sagt man, im Urteilen läge ein Zugewendetsein zum „Thema“, zum
„S ist p“, „Ein A, welches b ist, ist c“ etc., dann kann man doch versuchen

1 Anfang Oktober 1911. – Die vier folgenden Blätter haben zur unmittelbaren Folge

die Blätter Π = Husserliana XL, Text Nr. 14: Nominale Setzung im Verhältnis zu
hypothetischen und kausalen Urteilen. Urteilsthema (S. 272).
2 Erfassen ist zweideutig. Erfasst ist der Gegenstand (Richtung) – erfasst ist das

Thema.
234 explikative und prädikative synthesen

zu sagen: Diese Zuwendung ist wie jede Zuwendung (Erfassen ist Erfassen),
und Zuwendung als solche (Erfassen als solches) ist nicht zu differenzieren.
Sie scheidet sich nur nach dem Was. Im Fall eines sinnlich Vorgegebenen,
dem ich mich zuwende, gibt dieses mir das Was, und eventuell baut es sich als
5 ein Vorgang allmählich auf, und ich verfolge den Aufbau in der dauernden
Zuwendung. Andererseits: Im Fall des kategorial Sich-Erzeugenden ist zu
scheiden die Spontaneität der Subjektsetzung, die Daraufhinsetzung usw.
und andererseits die Zuwendung, die Erfassung. In stetiger Zuwendung bin
ich dem Sich-Erzeugenden zugewendet, nur dass beim sinnlichen Vorgang
10 etwas sich zuwege bringt, das ich nicht spontan erzeugt habe, während hier
das spontane Setzen, Daraufhinsetzen etc. es ist, das das Thema erzeugt.1 Ist
diese Ansicht richtig, da n n g e h ö re n al le lo g is c he n F o r m en z u r T h es is
u nd S yn t he s is und korrelativ die phansischen Formen zu den betreffenden
Aktformen, ha be n a b e r m i t d e r Z uw e ndu n g n ic h t z u t u n . S ie s e lb s t
15 h a t d a m it k e in e F o r m.
2) Die andere Ansicht ist die, dass Zuwendung und Thesis selbst wesent-
lich eins sind und dass nicht Zuwendung und Thesis zu trennen seien als zwei
unterscheidbare Sachen innerhalb der konkreten Synthesis.
Es ist hier aber Folgendes nicht zu übersehen. Zuwendung ist nicht bloß zu
20 verstehen als das Übergangsphänomen des „Sich-Zuwendens“, sondern es
kommt da an auf das Erfassen, das Erfassen von etwas ist. Und das Erfassen
wird zum Betrachten, zum Explizieren in seinen verschiedenen Modi. Aktuell
bin ich da dem erfassten Explikanden nach seinen explizierten Einzelheiten
zugewendet. Könnte man nicht auch da sagen: Immerfort bin ich zugewendet
25 und zu scheiden sei die Zuwendung und das Substrat der Zuwendung und
die Einzelheit, in der ich das Substrat mir verdeutliche etc.?
Nun hier ist es aber klar, dass in diesem Spiel der Erfassungen in ihrer
aktuellen Einheit alles, was wir da unterschieden haben als Explikand und
Explikat, als Explikat erster und höherer Stufe (herrschendes und dienen-
30 des), da s s d a s M od i d er „ Z uw e nd u n g “ , d er E r fa ss u n g si n d. Natür-
lich, überall verteilt sich eine gewisse „Materie“, aber als ein Ab s tr a k te s,
das diesem Formalen, das wir in jeder anderen Explikation ebenso finden
können, Gehalt gibt. Phänomenologisch habe ich nicht ein Zufassen und
daneben etwas, wonach ich fasse, sondern ich habe Erfassungsphänomene mit
35 verschiedener „Materie“ und mit verschiedenen formalen Abwandlungen.
Und die vollen Konkretionen, die verschiedenen Erfassungsmodi mit ihrem
Gehalt, sind es, die wir als Objektivationen bezeichnen.

1 Das ist aber falsch, weil nicht Rücksicht genommen ist auf den Unterschied zwi-

schen Thema und Gegenstand (Zielpunkt der Richtung-auf).


beilage xviii 235

Sollen wir nun damit die synthetischen Erfassungen, das Erfassen eines
„A ist b“, „A ist ρ B“, parallelisieren und sagen: Das synthetische Erfassen
bestehe nicht etwa aus Synthesis und Erfassen des in ihr Erzeugten, sondern
es handle sich um Modi des Erfassens mit einem gewissen Gehalt? Ich
5 habe die Neigung zu dieser Auffassung. Ich kann nicht zweierlei finden,
Subjektsetzung, Darauf-Setzung in Synthese und dann den Blick auf das
Subjekt, den Blick auf die Synthese und den Blick auf das Daraufgesetzte
als solches.1 Zwar im ersten Moment scheint es so: Ich habe ja zunächst die
Explikation und dann, könnte man sagen, blicke ich auf die Explikanden,
10 auf das Explikat und auf das „ist“: die synthetische Form. Aber auf den
Explikanden blickte ich und blicke ich ohnehin und ebenso auf das Explikat.
Und die Sachverhaltserfassung besteht nicht darin, dass ich nochmals diese
Zuwendung wiederhole und nur noch auf eine Form der Verbindung oder
Einheit beider hinsehe. Vielmehr habe ich jetzt erst das „A ist b“, und es
15 ist da A in dieser jetzigen synthetischen Form nicht einfach der Explikand,
sondern das A hat Subjektform, ebenso wie das b Prädikatform hat, und
korrelativ das A-Bewusstsein, die Art der A-Erfassung ist eine verschiedene
gegen früher. Es ist nicht wieder eine „schlichte“ Zuwendung und nur ein
geänderter Inhalt, sondern es ist der Modus der Zuwendung geändert, der
20 Modus der Erfassung. In diesem geänderten Erfassungsmodus erfasse ich
etwas (in jedem Erfassen ist das Allgemeine des Erfassens natürlich da),
aber das Etwas hat seine Form.
Vielleicht kann man sagen: Jeder Modus des Erfassens hat sein Korrelat
in einem Erfassten, das „in ei n em M o d us dast eh t“. Nicht ist jede Materie
25 mit jedem Erfassungsmodus zu kombinieren, sondern mit der Änderung des
Modus ändert sich auch etwas an der Materie: Sie erhält eine entsprechende
modale Form (z. B. Explikat, Explikat zweiter Stufe etc.).
Vielleicht ist am schädlichsten, verwirrendsten der Gebrauch des Wortes
„Zuwendung“, aber auch bei „Erfassung“ liegen im Wortsinn Versuchungen.
30 Es handelt sich immer um die vollen konkreten Phänomene, die nach einer
Seite den allgemeinen Charakter des Im-Blick-Habens, des Erfassens haben
(allerdings nach dieser Seite mit allgemeinen Modifikationen wie frisch im
Blick haben, noch festhalten) und andererseits ein Was, das im Blick ist mit
verschiedenen Formen.
35 Das alles müsste auch ausgedehnt werden auf die eigentlichen Erkennun-
gen, Prädikationen. Das Auf-Begriffe-Bringen, das ist nur ein weiterer, neuer
Modus des erfassenden Objektivierens. Jeder neue Modus des Erfassens
fasst in neuer Weise: Jeder ist Erfassen mit einem Was, aber mit jedem

1 Entscheidung für 2).


236 explikative und prädikative synthesen

erhält das Erfasste eine neue intellektive Gestalt, eine neue lo g is c h e F o r m.


Das Eigentümliche ist, es sind Fassungen, Formerzeugungen und formende
Erzeugungen von Gegenständlichem. Aber es sind auch Erfassungen, sie
stehen im B l i ck, und sie sind nicht etwas neben dem Blick, als ob sie, als
5 was sie sind, auch sein könnten, ohne erfasst zu sein. Immerfort steht in
ihnen etwas vor Augen, aber in diesem schauenden oder fassenden Blicken,
das kein leeres Blicken, sondern objektivierendes Tun ist, erzeugt sich auch
etwas. Es ist nicht so wie beim Zusehen eines Erzeugens, beim Zusehen eines
Werdens, wo das Werden eins ist und was es ist, ob man zusieht oder nicht,
10 und das Zusehen ein anderes.
Vom schlichten Erfassen, dem die Materie durch eine Rezeptivität zu-
wächst, durch eine Sinnlichkeit, die etwas leistet, ein Bewusstsein, das kein
Erfassen, kein Objektivieren ist, das aber die eigentümliche Wandlung er-
fährt, die wir Zuwendung zu dem vor der Erfassung schon konstituierten
15 Objekt nennen, geht eine Stufenfolge von spontanen Objektivationen empor,
die immerfort ein Erfassen, ein spezifisches Bewussthaben oder Im-Blick-
Haben sind und dabei immer neue Materie mit neuen Formen sich prädikativ
zueignen, eventuell in einzelnen Schritten neue „ungeformte“ Materie durch
Rezeptivität sich heranziehend und dann „verwertend“.
20 Dabei ist aber zu betonen, dass alle die Ausdrücke, die da gebraucht wur-
den wie „Zuwendung“, „Im-Blick-Haben“, „Erfassen“, „Objektivation“,
ihre irrigen Versuchungen mit sich führen und nicht missdeutet werden dür-
fen, wenn der Sinn getroffen werden soll, den wir hier bestimmen müssen. Die
unterste Stufe war das schlichte Erfassen und Haben eines „Vorgegebenen“,
25 anderweitig schon „Objektivierten“. Im Fall der Sinnlichkeit haben wir
hier die Möglichkeit, dass die Objektivation eine solche war, die nichts
von „Erfassen“ in sich schloss. Das Wesen dieses sinnlichen Phänomens
fundiert die Möglichkeit, es in ein objektivierendes zu verwandeln und so
objektivierendes Bewusstsein von einem gewissen Gegenstand zu gewinnen.
30 Und diese Objektivation birgt in sich wieder die Wesensmöglichkeit einer Art
Objektivationen höherer Stufe von entsprechendem, durch jene bestimmten
Gehalt, etwa eine nominale Objektivation „dies, welches A ist“, die inner-
halb einer Urteilsobjektivation der oder jener Form fungiert usf. Das früher
schlicht Erfasste ist jetzt nominal gesetzt, Subjekt oder Objekt des Urteils
35 etc. Was auf der unteren Stufe schon in eventuell verschiedener Weise, etwa
als selbständiger Explikand oder als bloßes Explikat erfasst war, ist jetzt
Subjektgegenstand-worüber oder Objektgegenstand „in Bezug auf den“ und
dgl. Das sind neue Weisen der Objektivation, und es wäre verkehrt, weil alle
Objektivationen eben Objektivationen, Erfassungen und dgl. heißen, überall
40 das Erfassen vorauszusetzen, das wir auf unterster Stufe oder irgendeiner
Stufe finden.
beilage xviii 237

Im nominalen Objektivieren, im Objektivieren, das Voraussetzen heißt,


oder im Objektivieren, das (vollständiges) Urteil heißt, wird nicht etwas
betrachtet, ist nicht etwas objektiv in der Weise eines sinnlich-betrachtend
Erfassten usw. Es ist so, als wollte man, weil immerfort etwas „im Blick“ ist,
5 erfasst ist, überall von einer Wahrnehmung sprechen: Da wir doch gleichsam
etwas sehen!
Nun heißt es doch immer wieder: Im Erfassen ruhe der Blick auf dem
Gegenständlichen, es wird ein Gegenständliches erfasst. Jede Objektivation
hat ihr Was, das, was sie objektivierend erfasst, ein Gegenständliches. Und
10 so denkt man unwillkürlich: Es sei etwas Gegenstand in einem besonderen
Sinn, in dem ein Betrachtetes Gegenstand ist oder in dem ein Genanntes
Gegenstand ist (und eventuell in dem ein Sachverhalt im Urteil Gegenstand
ist).
Demgegenüber sagen wir aber: Das allgemeine Im-Blick-Haben, Erfas-
15 sen, Objektivierend-Haben ist nicht solch ein im besonderen Sinn Gegen-
ständlich-Haben, das nur einen Sonderfall davon ausmacht. Hierher ge-
hört insbesondere die fundamentale Tatsache, dass, während das unterste
Objektivieren seine Materie aus einer „blinden“ Rezeptivität her hat, im
höheren Objektivieren sich eine Materie neu erzeugt und damit eine Gegen-
20 ständlichkeit „konstituiert“, eine Gegenständlichkeit, die einerseits durchaus
objektivierte, also im Blick stehende ist (oder im Blick sich aufbauende), die
andererseits aber in derselben Art zum Zielobjekt, Objekt des abzielenden
Erfassens gemacht werden kann, wie es das Objekt einer sinnlichen Nennung
ist oder auch das Objekt einer sinnlichen, vorlogischen Zuwendung. Der
25 komplizierte kategoriale Gegenstand, der in seiner Weise objektiviert war in
der artikulierten Urteilssynthesis, wird in einem spezifischen Sinn nachher
zum Objekt, indem ein einheitlicher Richtungsstrahl auf ihn als Ganzes und
Einheitliches geht, ihn schlicht erfasst, und darauf gründet sich nun eventuell
eine Dies-Setzung, eine neue Urteilssetzung, welche von dem nominalen
30 Objekt, dem Satz, der vermeinten Wahrheit aussagt, er habe die und jene
Teile und Eigenschaften. Und in diesem Urteilen konstituiert sich abermals
ein Gegenständliches, ein neuer Sachverhalt usw.
238 explikative und prädikative synthesen

Beilage XIX
Sinnliche Erscheinungen vor und in der Zuwendung.
Die Spontaneität des Durchlaufens gegenüber der
schöpferischen Spontaneität des Denkens. Gibt
5 es analoge Unterschiede zwischen Zuwendung
und synthetischer Erzeugung im Gemüt?1

1) In gewissem Sinn konstituiert sich der empirische Gegenstand „ur-


sprünglich“ nur in einer Spontaneität des Durchlaufens; im „freien“ Ablauf
der „motivierenden Empfindungen“ müssen die motivierten Erscheinungen
10 in ihrer Zugehörigkeit bzw. in ihrer Zusammengehörigkeit ablaufen und
Einheit konstituieren. In gewisser Weise „erzeugt sich“ auch diese Einheit,
der empirische Gegenstand, in einer „Freiheit“ der Spontaneität, als Einheit
einer spontan verlaufenden Mannigfaltigkeit. Es genügt nicht überhaupt
„Erscheinung“ und Ablauf von Erscheinungen, nicht das bloße Hinnehmen
15 der Erscheinungen und eventuell ablaufenden Erscheinungen (etwa wenn
der Gegenstand sich dreht), vielmehr neben dieser Passivität muss freie
Aktivität da sein, eben das freie Durchlaufen, die freie Modifikation der
„Augenstellung“, der freie Ablauf der „tastenden Bewegungen“ und da-
durch die frei-abhängige Modifikation der Erscheinungsreihe, eine Freiheit
20 funktioneller Modifikationen.
Die schlichte Wahrnehmungserscheinung und der und der schlichte, rein
passive Verlauf von Erscheinungen vollziehen also noch keine „eigentliche
Konstitution“. Es muss das freie Umblicken, das freie Betrachten, das freie
Durchlaufen (und dabei Regieren) der Erscheinungsverläufe statthaben.
25 Nun ist hier einiges zu überlegen. Zunächst möchte ich fragen: Was ist
das für eine Spontaneität, für eine „Freiheit“? Müssen wir nicht unter dem
Titel „Freiheit“ sondern? Wenn ich nicht dem Gegenstand zugewendet bin
und die Augen „unwillkürlich“ bewege: Wie ist es da mit den zugehöri-
gen Erscheinungen? Gehen sie nicht zu Einheiten zusammen? Wenn ich
30 irgendeinem Gegenstand zugewendet bin, ihn betrachtend und ihn nach ver-
schiedenen Seiten durchlaufend, so durchlaufen auch die Erscheinungen der
Umgebung ihre „Mannigfaltigkeiten“. Und kommen sie nicht zur Einheit,
sofern, während mir der Gegenstand in der Zuwendung als der eine sich
nach den oder jenen Seiten eigentlich konstituierende dasteht, auch ein stetes
35 Einheitsbewusstsein der einen Umgebung statthat?
Muss man nicht vorerst für die „mitaufgefasste“ Umgebung das zuge-
stehen und ist nicht sicher eine Umgebung mitaufgefasst: Der Gegenstand

1 Wohl Oktober/November 1911. – Anm. der Hrsg.


beilage xix 239

erscheint im umfassenden Raum, in einer Umgebung anderer Dinge, obschon


ich nur ihm selbst (und diesen Seiten) zugewendet bin? Wie sollen wir uns
dann hinsichtlich des ferneren Quasi-Hintergrundes verhalten? Eventuell
„empfinde ich plötzlich“ den Druck der Kleider. Ich habe ihn immerfort
5 empfunden. Ist die Auffassung erst mit der Zuwendung da? Ist sie nicht
schon im voraus da, und bei den unbeachteten Stellungsänderungen mei-
nes Leibes: Gehen die Kleidererscheinungen nicht immerfort zu Einheiten
zusammen?
Es ist schwer, hier etwa zu sagen, dass nur für die nähere Umgebung, für
10 die Umgebung im aufweisbaren Bereich, von der wir doch sagen und sagen
müssen, dass innerhalb ihrer das Objekt der ausgezeichneten Erscheinung
erscheint, das Zusammengehen der Erscheinungen zur Einheit angenommen
werden muss. Ist das nun eine wirkliche Spontaneität? Wenn wir uns gedrängt
fühlen zuzugestehen, dass auch die unwillkürlichen Augenbewegungen, die
15 „motivierend“ sind für das Zusammengehen der Erscheinungen der un-
beachteten Gegenständlichkeiten, so etwas wie „Freiheit“ haben und dass
auch diese Erscheinungen als in Freiheit modifizierte ihrem Ablauf nach ihre
Freiheit haben, müssen wir dann nicht sagen, dass diese Freiheit etwa ganz
anderes ist als Spontaneität in dem Sinn, in dem wir diese den Akten des
20 Sachverhalt konstituierenden Meinens zuschreiben?
Halte ich die Augenstellung fest (ein freies Fixieren), so ist die motivierte
Erscheinung in ihrer Unveränderung oder in ihrem mannigfaltigen Wechsel
als bloße Passivität gegeben. Verändert sich die Augenstellung im freien
Durchlaufen der oder jener Richtungen, so ist mir zwar immer die motivierte
25 Erscheinung passiv gegeben, aber ich bewege mich frei in einer festen, vor-
gegebenen Ordnung mannigfaltiger Erscheinungen. Im freien und allseitigen
Durchlaufen der motivierenden „Umstände“ sind fest zugeordnete und in
ihrer Ordnung vorbestimmte Motivate bewusst, die Erscheinungen in ih-
rer geordneten Mannigfaltigkeit laufen motiviert ab, und darin konstituiert
30 sich ursprünglich-eigentlich die Einheit des Gegenstandes als Einheit seines
bestimmten gegenständlichen Inhalts.
Jede Erscheinung ist Erscheinung des Gegenstandes in einer bestimmten
(mehr oder minder bestimmten) Orientierung, und die freie Änderung ist
Änderung der Orientierung. Ich durchlaufe den Gegenstand, indem ich dem
35 in einer Orientierung erfassten immer neue Orientierung gebe, wobei er
eben als Identisches, das sich stetig in verschiedenen Orientierungen zeigt,
und als in Stetigkeit Identisches bewusst ist. Der Gegenstand ist das Iden-
tische der Mannigfaltigkeit seiner Erscheinungen = er ist das Identische der
Mannigfaltigkeit von Gegenstandsorientierungen, von Weisen der Orientie-
40 rungsphänomene des Gegenstandes in Bezug auf das Ich. Die Erscheinungen
sind nicht bloß überhaupt Erscheinungen, Darstellungen, Vorstellungen von
240 explikative und prädikative synthesen

dem Gegenstand. Sie sind immer Erscheinungen, die zugleich den Gegen-
stand als so und so orientierten bewusst haben. Insoweit konstituiert jede Er-
scheinung der Mannigfaltigkeit etwas Besonderes und Neues. Andererseits,
jede ist Erscheinung des Gegenstandes hinsichtlich seines Inhalts, hinsichtlich
5 seiner Farbe, Form etc.; und dieser selbe gegenständliche Inhalt ist Einheit
der kontinuierlich ineinander übergehenden Erscheinungen, sich in diesen
kontinuierlichen Übergängen in eigentlicher Weise „ursprünglich“ konstitu-
ierend. Die Orientierung ändert sich aber auch von Seiten des Gegenstandes,
der erscheint in seiner „Bewegung“. Sie ändert sich nämlich entweder durch
10 mein freies Durchlaufen, durch mein Sich-Bewegen (mein „Standpunkt“
ändert sich frei) oder durch das Sich-Bewegen des Gegenstandes. Dieselbe
Erscheinungsveränderung konstituiert je nach der Weise der Motivation
(Durchlaufen oder freies Festhalten des Standpunktes) den unbewegten
Gegenstand, zu dem ich mich anders stelle und der mir „daher“ anders
15 erscheint, oder den bewegten Gegenstand, der zu mir seinen Standpunkt
verändert usw.
Sagen wir nun, dass sich der Gegenstand „u r s p r ü n g l i c h“ im freien
Durchlaufen konstituiert, dass er doch hier zur Gegebenheit kommt, so ist
andererseits zu sagen, dass in gewisser, wenn auch unvollkommener Weise
20 der Gegenstand sich schon in einer einzelnen Erscheinung (und jede Phase
ist zu extendieren zeitlich zu einer konkreten Erscheinung) konstituiert. Jede
ist schon Erscheinung des Gegenstandes und Anschauung von ihm, gebendes
Bewusstsein von ihm, und Bestandstück einer möglichen vollkommeneren,
den Gegenstand inhaltlich vollkommen konstituierenden Erscheinungsreihe.
25 Jede Erscheinung konstituiert etwas vom Gegenstand ursprünglich, und
darum ist jede nötig für die volle Konstitution des Gegenstandes, keine ist
im Grunde zu entbehren. Und die Konstitution des gegenständlichen Inhalts
vollzieht sich immerfort durch diese Erscheinungen, die Zuständlichkeiten
sind und deren Folge nur einer spontanen Durchlaufung zugänglich ist. Der
30 Gegenstand ist immerfort bewusst von Anfang bis Ende seines Erscheinens,
immerfort erscheint er, er ist der Spontaneität vorgegeben. Dagegen ist der
Sachverhalt, ist der sich im Denken konstituierende Gegenstand erst durch
das spontane Denken gegeben, insofern nachgegeben.
Verstehen wir allgemein (in einem erweiterten Sinn) unter Erscheinungen
35 Gegenstände ursprünglich konstituierende Erlebnisse (gebende), so zerfal-
len die Erscheinungen: 1) in sinnliche Erscheinungen (rezeptive). Sie sind
dadurch charakterisiert, dass durch sie der Gegenstand schlicht gegeben, im
Erfassen immerfort vorgegeben ist, dass die Spontaneität des Erfassens selbst
vom Gegenstand nichts konstituiert, sondern ihn nur durchläuft, und dass das
40 Durchlaufen zwar eine Bedingung vollständiger, angemessener Gegebenheit
ist, aber nicht sie selbst konstituiert den Gegenstand, sondern die mit dem
beilage xix 241

Durchlaufen ineinander übergehenden und sich durch sich selbst verein-


heitlichenden Erscheinungen. Das Einheitsbewusstsein ist kein spontanes
Tun, sondern es ist die Deckung der Erscheinungen, und allenfalls richtet
sich ein Strahl der Zuwendung dieser Einheit zu. Er erfasst, er konstituiert
5 und erzeugt aber nicht.
2) Die Verstandeserscheinungen, die Erscheinungen, die spontane Er-
zeugnisse sind; die spontanen Setzungen sind selbst konstitutiv für Gegen-
ständlichkeit, so schon die Zusammenfassung etc.
Wir haben also zu scheiden:
10 1) Die Spontaneität eines phänomenologisch-psychischen Geschehens,
die Spontaneität der Hinwendung, der Durchlaufung, der Explikation und
Prädikation usw.
2) Das Sich-Zuwenden, die Verlebendigung der toten Auffassung, das
In-den-vorgegebenen-Gegenstand-Eindringen, ihn durchlaufen, das Expli-
15 zieren, die Bereicherung des Explikanden, das Beziehen, das Begreifen und
Urteilen: Das ist eine zusammenhängende Gruppe von spontanen Akten, die
der im weitesten Sinn vorstellenden (objektivierenden, verstandesmäßigen)
Akte. Darin scheiden wir gebende Akte, Ursprungsakte, und solche, die
es nicht sind. Und wieder in den gebenden, die aus den Quellen der Passi-
20 vität bloß nehmen, und die schöpferisch spontanen, die einen neuen Gehalt
ursprünglich erzeugen. „Ur s p r ü n gli c he E rwe r b un g“.
Es ist dann aber die Frage: Gibt es neben den schöpferischen Erzeu-
gungen der Urteilssphäre, der Verstandessphäre im weitesten Sinn, nicht
auch schöpferische Erzeugung des Gemüts, wodurch Gegenständlichkeiten
25 konstituiert werden, die zwar vorgegeben sind für den erfassenden und
denkenden Verstand, aber nicht passiv vorgegeben, sondern schöpferisch
erzeugt? Und haben wir wie Unterschiede der vorstellenden Zuwendung
und synthetischen Erzeugung im Verstandesgebiet auch Unterschiede zwi-
schen Gemütszuwendung und synthetischer Gemütserzeugung als Analoges?
30 Freilich, da sind die bekannten Schwierigkeiten (die in gewissem Sinn schon
zeigen, dass diese Analogie keine vollkommene sein kann). Das Verstan-
destun ist etwas Leeres, es formt eine vorgegebene Materie, die Form ist
„leere“ Form. Die Gemütsform ist nicht leer. Aber ist diese Rede nicht
nur statthaft vom Standpunkt des hinterher objektivierenden Verstandes,
35 demgegenüber natürlich alles, was nicht verstandesmäßige Form ist, „voll“,
eben Materie ist?
Nr. 13

Z uw en d un g u nd D en ke n .
Di e F r age d es S u bs tr at s1

§ 1. Die formende Spontaneität des prädikativen


5 Meinens gegenüber dem bloßen Erscheinen und
Erfassen. Das Erkennen als Erscheinungscharakter

Jedes Meinen hat ein Substrat:


1) Das schlichte Meinen hat als Substrat eine Erscheinung, dessen
Erscheinendes es meint. Natürlich eine qualifizierte Erscheinung; das
10 Meinen bringt nicht die Qualität hinein, bringt keine neue Qualität
hinein.
2) Das synthetische Meinen hat Glieder, und jedes Glied hat sein
Substrat (wobei aber eventuell in mehreren Gliedern dasselbe Sub-
strat auftreten kann?).2
15 Wie ist es nun? Wir schreiben der gesamten Synthese eine Qualität
und eine Materie zu. Ist das Verhältnis dieser Gesamtqualität zur
Gesamtmaterie das gleiche wie bei den schlichten Akten bzw. bei
den bloß qualifizierten sinnlichen Erscheinungen?
Eine einheitlich qualifizierte Erscheinung ist eine Apparenz, die
20 durch und durch von der Qualität durchtränkt ist; jeder mögliche Teil
der Apparenz hat denselben qualitativen Charakter, jedes Moment.
Muss man das Gegenteil von den synthetischen Akten sagen? Und
muss man andererseits nicht doch sagen, dass sich im synthetischen
Akt eine Materie, ein „Sachverhalt“ mit einer Gesamtqualität kon-
25 stituiert, also das Ganze doch eine „Erscheinung“ mit einer Qualifi-
zierung auszumachen scheint?
Versuchen wir, die Sachlage so zu beschreiben: Nehmen wir eine
einfache prädikative Synthese, ob eine eigenschaftliche oder relatio-
nelle. Wir haben dann eine Untersetzung, eine schlichte Zuwendung
30 zum und Erfassung des Subjektgegenstandes und eine Formung,

1Oktober/November 1911. – Anm. der Hrsg.


2Das kann doch nur sagen, jedes intuitive, jedes in voller Ursprünglichkeit vollzo-
gene? Also auf dem Grund schlichter Perzeptionen.
text nr. 13 243

die das Subjekt als solches auszeichnet. Die bloße Zuwendung zum
erscheinenden Gegenstand, wodurch die Erscheinung zur Substrat-
Erscheinung wird für die bloße Explikation, ist noch nicht die Sub-
jektion und die durch sie hereingebrachte Formung. Genauer müssen
5 wir sagen: Zunächst haben wir die Veränderung, die eintritt dadurch,
dass die Erscheinung (die qualifizierte immer) zur Unterlage der
Hinwendung wird, dann die weitere Modifikation, die eintritt, wenn
die Erscheinung zum Explikationssubstrat insofern wird, als ja durch
den Übergang zum Explikat die Form des Explikanden erwächst.
10 Das ändert im Wesen nicht die Erscheinung selbst. Es ändert sich
die Funktion, und die Erscheinung nur insofern, als diese die neue
Funktion mit sich bringt. Und dann weiter das Neue der eigentlich
prädikativen Synthese.
Hier tritt also das Eigentümliche der M ei n ung i m Si nn de s
15 „ p r ä di k a ti v e n U r te il s “ auf mit all ihren syntaktischen Formen;
die Meinung, das ist nicht b lo ßes Z ug ew end e ts ei n, bloßes Erfas-
sen aufgrund eines Erscheinens, sondern hier haben wir gegenüber
dem bloßen Erscheinen eine eigentümliche Formung, die eine völlig
neue Dimension ausmacht. Und dieses Neuformen hat nicht etwa
20 den Charakter einer Qualifizierung, ist also nichts spezifisch zum
„Glauben“ Gehöriges, als einer Qualität, die schon in der Schicht der
bloßen Erscheinung auftritt. Wir prädizieren aufgrund von Erschei-
nungen, die damit einerseits als Substraterscheinungen für ein Sich-
Hinwenden fungieren und andererseits als Substraterscheinungen für
25 die formende Spontaneität des prädikativen „Meinens“.1
Aber wie steht da nun Erfassung, Zuwendung und dieses prädika-
tive Meinen? Kann man zunächst das Z uw e nd e n und Er f as se n
als etwas Verschiedenes ansehen? Es scheint nicht. Es sind zwei
Worte für dasselbe. Im Zuwenden erfasse ich ein Erscheinendes, ein
30 „Vorstelliges“, und dieses Erfassen ist nicht als wirklich nehmen oder
als Wirkliches nehmen; was da erfasst ist, hat seinen Charakter
schon, bringt ihn durch die „Erscheinung“, die ihre Qualifizierung
hat, mit sich.
Kann man dann weiter das Zuwenden oder Erfassen schon als
35 primitivste Art des urteilenden Meinens ansehen, als schlichtes „Set-

1 Bedeutet dabei aber Substrat beiderseits noch dasselbe?


244 explikative und prädikative synthesen

zen“, derart wie im Urteil ein Setzen statthat, in der prädikativen


Synthese? Ist es nicht richtiger, diese Frage zu verneinen und zu sagen,
bloßes Erfassen sei zwar eventuell Unterlage eines prädizierenden
Verhaltens, aber mit diesem trete etwas völlig Neues ein, eben das
5 Prädizieren, das Bestimmen als so-seiend, das Behaupten, wodurch
das einfach Erfasste alsbald seine prädikative Form erhält und sich in
Sachverhalt-Gegenständliches verwandelt.
Schwierigkeit macht hier allenfalls das mit dem Prädizieren Hand
in Hand gehende „Erkennen“. Ich erfasse nicht nur die Person, die
10 jetzt auf der Straße sichtbar ist, ich erkenne sie als „Hans“. Ich meine
natürlich nicht prädikativ: „Das ist Hans.“ Das ist freilich etwas Ei-
genartiges und für sich zu Beschreibendes. Wir werden auch wohl
sagen müssen, dass es ein Vorkommnis ist, das nicht wesentlich gehö-
ren muss zur Sphäre der Meinungen. Ich blicke in eine Landschaft und
15 erkenne ein Haus wieder, und ich erkenne nun die ganze Landschaft
wieder: Der Hintergrund, noch ehe ich mich ihm zuwende, noch ehe
ich die gesamte Landschaft zum Objekt der Zuwendung mache, wird
erkannt. Das Erkennen breitet sich sofort über den Hintergrund aus
und seine Erscheinungen bzw. über die Erscheinungseinheit.
20 A uc h d a s Er k e nn e n i s t e i n C ha rak te r, de r di e E r sc he i -
n u ng c h a r a k te r i s i e r t, mag dazu „Identifizieren“ gehören oder
nicht. Man wird ja sagen: Wenn ich wiedererkenne und ein Erinne-
rungsbild des früher gesehenen Hauses auftaucht, so steht das ja auch
schon als „bekannt“, nicht neu da, und das jetzt neu Erfasste identifi-
25 ziert sich in einer vereinheitlichenden Deckung, nicht in eigentlicher
synthetischer prädikativer Deckung, mit dem „Bekannten“. Jedes
Erinnerte hat den Charakter „bekannt“. Und heißt hier bekannt
anderes als Charakter der Erinnerung? Aber auch Gesehenes, Per-
zipiertes hat den Charakter „bekannt“, es hat den Erinnerungscha-
30 rakter, den Charakter: „Das habe ich schon gesehen“. Das weist
auf eine „verborgene Deckungseinheit“ zwischen der perzeptiven
Erscheinung und dunklen Erinnerungserscheinungen hin.
Freilich, Erkennen ist noch nicht Eigennennen, und überhaupt
Nennen. Aber bringt der Eigenname schon eine Form der spezifisch
35 doxischen Meinung, eine Urteilsform, Denkform mit sich? Erhält
der Name, erhält das Nominale, und zwar das durch den Eigenna-
men Genannte, nicht erst in der Prädikation eben prädikative Form?
„Der“ Hans, „den“ Hans etc.
text nr. 13 245

Das Erkennen, soweit es allgemein zum Ausdrücken gehört, schei-


den wir also aus und fassen es nicht als wesentlich zum prädikativen
Meinen gehörig und nicht als dessen Formen irgend fordernd; ob-
schon natürlich fähig, jede dieser Formen auszudrücken.

5 § 2. Im anschaulichen Urteil „erscheint“ ein


Sachverhalt. Ein Sachverhalt kann in verschiedener
Weise bewusst und Gegenstand der Zuwendung sein

G e hö ren n un ab er n i c h t gl e ic hw oh l E rf a ss en u n d P räd i -
z i e r e n z u sa m m en? Kann ich Prädizieren, ohne mich dem Subjekt,
10 Prädikat etc. zuzuwenden? Ohne es zu fassen? Andererseits, regt sich
nicht oft „im Hintergrund“ ein Gedanke, dem ich mich nachträglich
zuwende, den ich nicht nur zum Ausspruch, sondern zur artikulierten
Meinung bringe? Aber ist nicht schon vorher die „Meinung“ da, die
Prädikation also quasi-vollzogen, vollzogen und doch nicht in der
15 Zuwendung vollzogen, nicht eigentlich vollzogen?
Und in Zusammenhang damit steht die Frage: Prädizierend bin
ich doch dem Sachverhalt zugewendet (oder wenn nicht zugerichtet:
prädizierend bin ich mir doch eines Sachverhalts bewusst)? So wie
ich mir in einer sinnlichen Erscheinung eines Gegenständlichen be-
20 wusst bin, aber nur ausnahmsweise ihm zugewendet, so bin ich mir
im Prädizieren eines Gegenständlichen höherer Ordnung, eben des
Sachverhalts bewusst, aber nicht immer ihm zugewendet. Und weiter:
Im anschaulichen Urteilen „erscheint“ auch etwas, es erscheint ein
„So ist es!“ Erscheint in der sinnlichen Erscheinung ein Dingliches
25 oder ein Vorgang, so „erscheint“ es im anschaulichen Urteil, dass
das Ding so und so beschaffen ist.1 (Und das überträgt sich auf alle
Sätze, Wahrscheinlichkeitssätze etc.) Also scheint doch die prä-
dikative Synthese eine eigenartige Verknüpfung von qualifizierten
Apparenzen zu neuen Apparenzen, von Erscheinungen zu neuen

1 Ja, im Wahrnehmungsurteil, im sehenden Urteil. Das Zu-sein-Scheinen im bloß

vermeinenden Urteilen ist kein Erscheinen des Sachverhalts, und nur der erscheinende
Sachverhalt ist im Sachverhaltserscheinen, im sehenden Urteilen gegeben und ähnlich
bewusst wie der gegebene Gegenstand in der sinnlichen Erscheinung; aber mit dem
Unterschied, dass er nicht Zielpunkt einer Richtung-auf ist.
246 explikative und prädikative synthesen

Erscheinungen zu sein, mögen wir auch Grund finden, zu sagen, diese


höheren „Erscheinungen“ seien keine sinnlichen.
Es ist hier Folgendes zu überlegen: Ein bloßes Sich-Zuwenden
zu etwas „V o rge geb en em“ ist also das denkende, prädizierende
5 Meinen nicht; zu etwas Vorgegebenem, das im Wesen in derselben Art
„erscheinen“, „konstituiert“ sein kann wie in der Zuwendung, so vor
und nach ihr. A b e r e i n Z uw e n den li eg t d o ch v or. Das denkende
Meinen ist ein spontaner Akt, ei n e S p on t a ne itä t , d ie or ig in är
kon st it u ier t, die erzeugend konstituiert, w a s o ri gi nä r n u r i n
10 d i e s er E r z e ugu ng ge gebe n i st. Und das Ich kann nichts spontan
erzeugen, ohne dabei zuzu„sehen“ (nicht seinem Erzeugen, sondern
dem Erzeugten), das heißt, ohne im Stufenbau der Erzeugungen der
Erstehung des Erzeugten zugewendet zu sein. Das Zugewendetsein,
das Erfassen ist dem Allgemeinsten nach hier kein anderes als da, wo
15 wir, statt denkend zu „meinen“, in der Passivität eines Erscheinens
leben; und Ähnliches wäre schon vorher zu sagen für die explikativen
Übergänge, die noch unter der prädikativen Synthese liegen.
Da ist aber die Rede von „originärer Gegebenheit“. Das Wort
Gegebenheit kann hier irreführen. Es kommt zunächst darauf an,
20 zu beachten, d a s s e i n U r t ei l s v er m ei nt es , e i n Sa ch ve r ha lt
in v e rs ch i e de n e r W e i s e b e w us s t un d d abe i „ G e g en st a nd “
d e r Zu w e n du n g s e i n k a n n (wobei die Frage sein wird, ob dieser
Unterschied eigentümlich zu den spontan konstituierten Gegenständ-
lichkeiten gehört oder nicht).
25 1) Fürs Erste kann die S p o n t a ne i t ä t d e r E r ze ug ung stattha-
ben, und im Fortgang der spontanen Akte und ihrer inneren Einheit
konstituiert sich schrittweise der Sachverhalt, der aber fertig konsti-
tuiert erst ist, wenn das Erzeugen vorüber ist. Und wie schon gesagt:
In diesem Fortgang des spontanen Setzens ist der betrachtende oder
30 erfassende Blick zugewendet dem Sich-Konstituierenden.
2) Fürs Zweite kann der fertig konstituierte Gegenstand festge-
halten werden, sozusagen als U r t e i l s e r g e b n i s, und nun erhält er
etwa die Form des Dies, des Subjekts für eine neue Prädikation. Die
originär konstituierende Prädikation ist abgelaufen und nachdem sie
35 es ist, bin ich mir des Sachverhalts „noch“ bewusst. Die Intention
ist nicht die fortdauernde „Erscheinung“ des Sachverhalts (etwa wie
man die Erscheinung eines Gegenstandes dauernd haben kann, frei-
lich nicht des Gegenstandes in seiner bestimmten Dauer: in der Dauer
text nr. 13 247

der Erscheinung erscheint derselbe Gegenstand, aber nach einer an-


deren Zeitstelle), sondern eben Retention, Noch-Bewusstsein. Und
nun kann auch Festhaltung und neue Formung eintreten, nämlich die
Formung als „dies“, als Subjekt einer neuen Prädikation und dgl.
5 3) Ich kann mich auch einem anderen zuwenden, während ich
n o c h Fe st ha lt un g übe, oder vielleicht nachdem ich sie nicht mehr
übe, und dann auf das Festgehaltene mich mit einem Strahl der Auf-
merksamkeit zurückwenden, und bei dieser Zurückwendung habe
ich ein Wi eder er f a sse n, bei dem eine „verworrene“ Sachverhalts-
10 vorstellung, ein „verworrenes“ Bewusstsein des „S ist p!“, aber kei-
neswegs ein wiederholendes, den Sachverhalt artikuliert konstitu-
ierendes Bewusstsein vollzogen ist. Hier haben wir einen Strahl der
„Aufmerksamkeit“, einen Strahl der Zuwendung auf die „Meinung“,
auf den komplizierten beweisenden Zusammenhang und dgl. Es ist
15 nicht ein synthetischer Zusammenhang vollzogen mit all den Unter-
setzungen und Daraufsetzungen, mit all den einzelnen Strahlen der
Zuwendung, die in den Gliedern walten und doch wieder ihre Ein-
heit haben in einer durchgehend einheitlichen Zuwendung. Vielmehr
haben wir einen einfachen Strahl, der hindurchgeht durch eine gar
20 nicht artikulierte, verworren einheitliche „Vorstellung“, in der das
Gegenständliche (das gar sehr kompliziert und in sich gegliedert ist)
in einem verworrenen Eins erfasst und nach keinem Glied besonders
gefasst ist.
4) Es kann auch sein, dass ein „Gedanke“, genauer eine Urteils-
25 meinung auftaucht, im Hintergrund sich regt, vorschwebt, noch ehe
ich auf sie hinsehe, noch ehe irgendein Strahl der Zuwendung ihr
und ihrem Inhalt gilt. Es braucht sich um gar keine Wiederverge-
genwärtigung zu handeln; es soll natürlich hier nicht eine Retention
sein einer eben gewesenen artikulierten Prädikation, die mit ihren
30 Zuwendungsstrahlen herabgesunken ist usw. Diesem verworrenen
Urteilsgebilde, wir pflegen hier von einem dunklen Gedanken, ei-
nem Einfall etc. zu sprechen, wenden wir uns nun zu: Ein Strahl
der „Aufmerksamkeit“ geht durch diese Verworrenheit hindurch auf
den betreffenden verworren bewussten Sachverhalt, und eventuell
35 bringen wir uns diesen „näher“, machen ihn uns deutlich und klar;
eventuell gestaltet er sich dabei bei Erhaltung eines gegenständlichen
Hauptgehaltes etwas um, und nun „urteilen wir wirklich“, vollziehen
wir wirklich das Urteil „S ist p!“ Sprechen wir schlechthin davon,
248 explikative und prädikative synthesen

dass wir urteilen, so haben wir diese Art des Vollzugs in der Regel im
Auge. (Sprechen wir von einer Meinung, dann wohl nicht: Wir sagen
zum Beispiel, meine Meinung kann ich so ausdrücken …) Ebenso
wenn wir von dem Führen eines Beweises sprechen. Der Beweis kann
5 aber auch vorschweben, es kann eine verworrene „Beweisidee“ sein
etc.1

§ 3. Die stetige Konstitution der dinglichen Einheit im


Fortgang des Erscheinungsabflusses. Die dem Abfluss einer
Erscheinungsreihe einwohnende Zuwendung gegenüber
10 dem retrospektiven Blick auf die herabgesunkene
Erscheinungsreihe und die durch sie konstituierte Einheit

Wir haben also mannigfache Art, in der uns eine prädikative


Gemeintheit, ein Sachverhalt bewusst werden kann, gewissermaßen
„erscheinen“ kann, und e s f ra g t si c h, w ie si ch di e s e „ E rs c hei -
15 n un g e n “ v o n S a c hv e r h a l te n, di ese B e w us s t se i ns w e is en ,
i n d e n e n u n s „ Sa c h v er h a lt e “ z u m B ew u s st se i n k om m e n,
c ha r a k t e r i si e r e n s ol l e n g e ge n ü b er d en E r s ch ei nu ng en i m
g e wö h n l i c h e n Si nn , d e m B e w uss t sei n, i n de m u ns e i n e
„ s i n n l i ch e “ Ge g e ns tä n dl i c h k e i t z u B ew uss t s ei n ko m mt.
20 Man könnte zunächst Gewicht darauf legen, dass ein sinnlicher
Gegenstand, ein Ton, ein Ding, uns schlicht, in einem punktuellen
Hinblicken zum Bewusstsein kommt, sofern er in der ihn konstitu-
ierenden Erscheinung sozusagen mit einem Schlag konstituiert ist.
Der Gegenstand mag unverändert andauern oder sich verändern,
25 demgemäß wird die Erscheinung, ob sie von einem hinwendenden
Blick durchstrahlt ist oder nicht, bald unverändert andauern (oder
unverändert dauernd sein können), bald sich notwendig verändern,
wofern eben der unveränderte oder veränderte Gegenstand sich in
ihr konstituieren, in ihr als solcher erscheinen soll. Aber sowie die

1 Gerade der wichtige Unterschied zwischen artikuliert Urteilen und explizierend,

aufgrund einer Gegebenheit Urteilen ist nicht erörtert. Nur in diesem Fall des in-
tuitiven, sehenden Urteilens ist aber von Erscheinung des Sachverhalts wirklich die
Rede.
text nr. 13 249

Erscheinung anhebt und bewusst ist, ist schon die Einheit des Ge-
genstandes erscheinend und so kann sich ihr das Erfassen schlicht
„zuwenden“.
Aber da ist zu beachten, dass jede sinnliche Erscheinung in gewis-
5 ser Weise Erscheinung von dem einen Dauernden oder sich Verän-
dernden ist, ebenso aber auch Erscheinung von dem dauernden Ding,
von der Dauererstreckung der Unveränderung, oder im anderen Fall
von der durch eine Dauer sich hindurch erstreckenden Veränderung:
Kurzum, im weiteren Sinn ist Erscheinung einerseits Erscheinung
10 von dinglich-substanzialen Einheiten, andererseits Erscheinung von
dinglichen Vorgängen (im weiteren Sinn). Dieselben Erscheinungen
können für den erfassenden Blick das eine und das andere darbieten,
er „richtet sich“ bald auf die Dingeinheit, bald auf den Vorgang (der
in einem anderen Sinn Einheit ist).
15 Natürlich kann der erfassende Blick auch immer, aufgrund der-
selben Erscheinungen, auf „Eigenschaften“ gehen, nämlich auf Ei-
genschaftsmomente, auf unselbständige innere Momente, Formen,
auf Stücke, Glieder, auf Verbindungsformen „verschiedener“ Ge-
genstände miteinander, auf Veränderungen, auf Vorgänge, an denen
20 verschiedene Gegenstände beteiligt sind (dann aufgrund der erschei-
nungsmäßigen Einheit mehrerer Erscheinungen) usw.
Man wird nun sagen müssen: Erscheinungen, die Einheit einer
Erscheinung aufbauen, haben ihre Zeiterstreckung (nämlich ihre
Ausbreitung im phänomenologischen Ablauf des inneren Bewusst-
25 seins), und in dieser Erstreckung sind sie unermüdlich konstituierend
beschäftigt. Was sich in einer Strecke konstituiert, konstituiert sich
in dieser Vollständigkeit nie in einem Teil der Strecke; es ist ein
stetiges Konstituieren, immer weiter fortschreitend. Im Ablauf der
Erscheinung schreitet auch der „erscheinende Gegenstand“ fort, im-
30 mer neuen Inhalt annehmend. Die im ersten Moment konstituierte
Einheit ist ja freilich schon die Dingeinheit, aber dass diese Einheit
die eine und selbe ist im ganzen und weiteren Verlauf des Erscheinens,
das sagt, dass eben ein durchgehendes Einheitsbewusstsein einigend
vorhanden ist, im Wesen der Erscheinungsphasen gründend; und es
35 sagt nicht, dass die Einheit ein leerer Punkt ist, dem weiter nichts
hinzugefügt wird, vielmehr ist es ja immer die sich bald so, bald so
darstellende und inhaltlich ausgestaltende Einheit, demnach bald so,
bald so in Explikation und Prädikation zu bestimmen.
250 explikative und prädikative synthesen

Der inhaltlich bestimmte Gegenstand, genauer das Erscheinende


als solches in seinem Gehalt, „baut sich“, konstituiert sich mit Fort-
gang des Erscheinungsabflusses stetig auf, und erst wenn wir am Ende
sind, hat sich das Ganze konstituiert. Richtet sich der aufmerkende
5 Blick auf den Vorgang, so ist es auch klar, dass dieser Blick stetig
erfasst und dass der Vorgang als einheitlicher Gegenstand erst fertig
erfasst ist, nachdem die stetigen Erfassungen, die „von ihm“ Phase
für Phase fassen, zum Endpunkt des Vorganges gediehen sind.
Wir überlegen nun, dass die Zuwendung zu einem Vorgang in
10 sehr verschiedener Weise „erscheinungsmäßig“ fundiert sein kann.
1) Einmal können wir die Erscheinungsreihe, die ihn konstituiert,
sei es in Wahrnehmung oder Erinnerung, jedenfalls in verlaufender
Anschauung erleben, und zwar so, dass diesem Anschauungsverlauf
stetig der zuwendende Blick einwohnt.
15 2) Fürs Zweite kann es sein, dass wir, nachdem der Vorgang
in dieser Weise erscheinungsmäßig im Aufmerken (= im zuwen-
denden Erfassen) abgelaufen ist, wir uns nun ihm als Ganzem re-
trospektiv zuwenden, in einem Überschlag, während sich in diesem
„Überschlag“ nicht etwa die Anschauung des Vorganges, sei es auch
20 als „wiederholende Vergegenwärtigung“ erneuert, also sich der Vor-
gang von neuem anschaulich konstituiert.
Es ist, als ob das Konstituierte anstatt in lebendig-beweglichem
Abfluss einer Erscheinungsreihe in einer unlebendig erstarrten Er-
scheinung erschiene, als ob in der Retention, die an die lebendig
25 abfließende Erscheinungsreihe angeschlossen ist, von ihr eine Er-
starrungsmodifikation zurückgeblieben wäre, als wäre der Vorgang
nun etwas in dem jetzigen Bewusstsein so Erscheinendes wie ein
unverändertes Ding, auf das wir wiederholt hinsehen können in einem
schlichten Blick. Aber freilich, diese Beschreibungen sind gefährlich
30 und bedenklich.
Jedenfalls, in dem jetzigen retrospektiven Blick haben wir nicht,
oder im Allgemeinen nicht, einen sich durch eine Anschauungsreihe
hindurch stetig verschiebenden Blick der Erfassung. Die ins Dunkel
herabsinkende oder herabgesunkene Erscheinungsreihe bildet eine
35 starre Strecke, auf die ein Blick sich richten kann und ebenso ein
Blick in die kontinuierliche Einheit des Vorganges, die durch sie
konstituiert ist. Öfters beobachten wir auch, dass der Blick in einem
schnellen Zug durch diese starre Strecke von Anfangs- zu Endpunkt
text nr. 13 251

durchgeht, so wie er etwa über eine starre Gerade hinläuft; wobei der
Unterschied evident ist, ob wir die Gerade lebendig beschreiben, von
Anfangspunkt zu Endpunkt durch erzeugendes Beschreiben, durch
das Linieziehen fortschreitend, oder ob wir nach dem Beschreiben
5 auf das Ganze hinsehen und eventuell es sogar durchlaufen.
In dem neuen Durchlaufen, in dem der Retrospektion, steht ein
starres, wenn auch dunkles „Bild“ des Abflusses da; im originären
Erfassen des Vorganges oder Anschauen desselben haben wir das
stetige Erzeugen, Beschreiben, vor dem noch nichts Fertiges liegt.
10 Und da ist ein erfassender Blick der Retrospektion auch möglich,
der gar nicht durchlaufend ist und das starre Bild wie eine ruhende
Erscheinung behandelt (freilich nicht wie eine dauernde Erscheinung
eines dinglichen Seins, in dem sich etwa eine Dauer konstituiert,
während hier sich in der „Ruhe“ nichts konstituiert).
15 Natürlich kann auch eine Wiedererinnerung an einen Vorgang
auftauchen als solch ein „starres Bild“, und es kann sich ein er-
fassender Blick dem Vorgang zuwenden als ein Momentanerfassen,
eventuell an ihm entlang durchlaufen, ohne dass im mindesten eine
wiederholende anschauliche Vergegenwärtigung des Vorganges statt
20 hätte, dessen erzeugendem Konstituieren der immanente Strahl der
Aufmerksamkeit, der Zuwendung folgte. Ebenso in der „Phantasie“
(in einer uneigentlichen Phantasie), in einer vorblickenden Erwar-
tung eines Vorganges.
Wir müssen offenbar sagen: Zum Wesen jedes Vorganges, jeder
25 zeitlichen Gegenständlichkeit überhaupt gehört es, dass ihr ursprüng-
liches Erscheinen die Form eines phänomenologischen Werdens hat,
eines Erscheinungsabflusses im inneren Bewusstsein, worin das Er-
scheinende als solches sich werdend erzeugt.
Es ist nun aber klar, dass es auch zum Wesen eines Sachverhalts
30 überhaupt gehört, dass sein „ursprüngliches Erscheinen“ sich in ei-
nem phänomenologischen Verlauf vollziehen muss, in dem das hier
Erscheinende als solches, nämlich der vermeinte Sachverhalt, all-
mählich, schrittweise sich konstituiert und allmählich im erfassenden
Blick erfasst wird.
35 Ich sprach vom „u r sp rü n g li c h e n Er s ch e i ne n“. Es gehört zum
Wesen des Gegenstandsbewusstseins, dass es in verschiedener Weise
phänomenologisch statthaben kann, in sehr verschiedenen Phäno-
menen bestehend, und dass dabei eine Weise charakterisiert ist als
252 explikative und prädikative synthesen

„ursprüngliche“; wir werden hier bei der Sinnlichkeit sogleich sa-


gen können: als Anschauung, die, wenn sie impressional ist, per-
zeptive Anschauung ist, und wenn nicht den Charakter der Quasi-
Anschauung, der Quasi-Perzeption hat. So bei den sinnlichen Ge-
5 genständlichkeiten. Jeder anderen schlichten Bewusstseinsweise des
Gegenstandes entspricht eine mögliche „Anschauung“, ein mögli-
ches originäres Sich-Konstituieren des Gegenständlichen (bzw. quasi-
originär), demgegenüber jene Bewusstseinsweise den Charakter des
Verworrenen, Un-explizierten, Uneigentlichen, Suggestiven hat, wie
10 immer man es nennen mag.

§ 4. Beim Sachverhaltsbewusstsein gibt es keine


vorgebenden Erscheinungen. Vergegenwärtigung
und Vorschweben als wesensverschiedene Arten von
Nicht-Ursprünglichkeit. Verworrenes Urteilen
15 gegenüber Verworrenheit in der Wahrnehmung

Wie ist es im Fall des Sa c h ver h al t ko ns ti t ui e re n de n B e -


w u ss t se i ns? Auch hier haben wir U n t e rsch ie d e de r U r sp rü ng -
l i c h ke i t un d N i c ht -U r s p r ün g l i chk eit, de r E i ge nt l i chk ei t,
in der das Urteilsvermeinte „expliziert“ gemeint ist, und derjenigen,
20 in der es nur im Überschlag, verworren gemeint ist.
Aber freilich, hier sondern sich die Begriffe „a n sc ha ul i ch es“
und e ige nt l i c h e s Erfassen.1 Das e i g e n tl ic he U r t ei l en besteht
hier im wirklichen artikulierten Vollzug (der erzeugende) der ver-
schiedenen Meinungsformen, die die Gesamtform des Urteilsver-
25 meinten wirklich aufbauen, während das anschauliche Urteilen, das
Bewusstsein, in dem der Sachverhalt anschaulich klar bewusst ist,
Forderungen an die Anschauung der hier unterliegenden „Substrate“
stellt, an die Anschaulichkeit hinsichtlich der Subjekte der Sachver-
halte, Objekte etc. stellt. Jedes anschauende Sachverhaltsbewusstsein
30 (anschaulich konstituierend) ist eigentlich, aber nicht jedes eigentli-
che (nämlich „eigentlich“ urteilende) anschaulich. (Das hängt damit

1 Demnach doppelte Ursprünglichkeit und auch doppelter Sinn von Zuwendung

und von Richtung-auf.


text nr. 13 253

zusammen, dass das Urteilsbewusstsein fundiert ist und dass zur vol-
len Anschaulichkeit eben gehört „Eigentlichkeit“ in der Ober- und
auch Unterschicht. Und wieder damit hängt zusammen, dass auch
die unvollkommene Eigentlichkeit, die der oberen Schicht, ihren
5 Charakter von „Anschauung“ hat, dass hier allerlei einsichtig zu
entnehmen ist, zu erschauen ist: nämlich alles rein Logische.)
Gehen wir nun weiter dem Ve rg lei ch z wi sch en Sa ch ve r -
h al t s er sc h ei nu ng u nd s in nl ic he r E rsch ei nu ng nach, so wer-
den wir zu sagen haben: B ei de k on sti tui er en si ch i n ei ne m
10 E r s c he i n un gs ve rl auf. Aber natürlich ist der Sachverhalt (möge er
auch auf Zeitliches Beziehung haben) kein Zeitliches, kein Vorgang,
nichts selbst im Werden Stehendes, Vorgehendes, und nichts, mit dem
etwas vorgeht.
Und damit hängt Folgendes zusammen: Alle zeitliche Gegen-
15 ständlichkeit ist sinnlich, ist in bloßer Rezeptivität erscheinend; seine
Erscheinungen sind Passivitäten. Sie laufen passiv ab, und der erfas-
sende Blick ist ein bloßer Strahl des Aufmerkens, der ein Vorgege-
benes, vor ihm Konstituiertes erfasst, der das sich Konstituierende
begleitet; er rezipiert nur oder akzepiert. Ich setze hier voraus, dass
20 dieser rezipierende Blick anschauender ist.
Die Anschauung im eigentlichen Sinn ist wohl nichts anders als
das schlichte Erfassen, das schlichte Zugewendetsein einem sich ur-
sprünglich erscheinungsmäßig Konstituierenden. Es ist wohl korrekt,
wenn wir noch scheiden zwischen u rs p r üng l i c he r E r sc hei nu n g
25 (wir könnten auch sagen, intuitiver Erscheinung, eigentlicher Er-
scheinung) und A n s c h a u u ng, deren Neues also besteht in dem
Strahl der „Aufmerksamkeit“, der erfassenden Zuwendung zum ei-
gentlich, ursprünglich Erscheinenden.
Es ist auch unbehaglich von „Rezipieren“ zu sprechen. Dabei
30 leitet uns die k an tische Rede von Rezeptivität. Aber es handelt
sich nicht um ein Wiedererfassen, sondern um ein ursprüngliches
Erfassen und eines in seiner Selbstheit Vorgegebenen. Eines Gege-
benen, aber dem Erfassen Vorgegebenen. Wir könnten besser von
„Akzipieren“ sprechen, und dem steht gegenüber das W i e de r e r -
35 fa s s e n oder Wi e d e r- z ur ü ck k om m e n- a uf - Et w a s, das nun nicht
mehr gegeben, nicht mehr eigentlich erscheinend ist, sondern in einer
„v er w orr e n e n V o r st e l lu ng“ bewusst ist, einer v e r wo rr e ne n
M o di fi k a t i on d e r A n s ch a u u ng.
254 explikative und prädikative synthesen

Beides fasst sich zusammen als Aufmerken auf ein, sei es „Vorge-
gebenes“, sei es im Voraus Vorgestelltes oder Vorzustellendes, um
ein Zugewendetsein, das einmal ein eigentliches Erfassen, das an-
dere Mal ein uneigentliches Erfassen, also dann ein Zugewendetsein
5 aufgrund eines verworren Vorschwebenden ist.
Gehen wir nun zu dem S a ch ve r hal t sb ew us sts e in, zum urtei-
lenden über, so haben wir hier das radikal Neue und Eigenartige,
dass wir hier den Sachverhalt (das „Erscheinende“ – ursprünglich
= anschaulich!) nicht „gegeben“ haben durch eine Passivität, dass
10 wir ihn nicht „vorgegeben“ haben und haben können, nämlich dem
erfassenden Blick gegenüber, sondern dass er nur gegeben sein kann
als Meinen, und Meinen notwendig Erfassen ist.
Man darf sich hier nicht täuschen lassen durch jene sich erge-
benden, auftauchenden Ideen, Meinungen, denen wir uns in einem
15 Blick zuwenden können, und nun denken, da sei ja eine vorgebende
Erscheinung des Sachverhalts (der Gemeintheit). Verstehen wir unter
einer „Erscheinung“ ein ursprünglich konstituierendes Bewusstsein,
ein solches, das im Fall eines hineingesandten Strahls der Zuwendung
eine „Anschauung“ oder einen „eigentlich“ gebenden Akt herstellt,
20 dann ist jenes Erlebnis des Vorschwebens keine „Erscheinung“, kein
„gebendes“ Erlebnis.1 Es heben sich da also wichtige Unterschiede
heraus.
Es scheiden sich die e i g e nt l i c h ko ns t it ui er e nd en E r le bn is -
s e (Gegenständlichkeit konstituierend) und die uneigentlich kon-
25 stituierenden, eigentlich nicht konstituierenden, die b l o ße n V or -
sc hw eb un g en. In der sinnlichen Sphäre sind diese retentionale
oder im weitesten Sinn vergegenwärtigende (Nachgegenwärtigungen,
Wiedervergegenwärtigungen, Vorvergegenwärtigungen), und ihre
Korrelate sind Zeitlichkeiten (das Soeben-Gewesen, das wiederver-
30 gegenwärtigte Gewesen, das Soeben-Sein-Werden und das wieder-
vergegenwärtigende, das „bildlich“ repräsentierte Sein-Werden).
In der Urteilssphäre finden wir bei den Vorschwebungen wohl
analoge Modifikationen; wir finden ja da auch das Soeben-geurteilt-
Haben, das Urteilen-Werden, die Erinnerung an Urteile, wobei jede
35 Eigentlichkeit ausgeschlossen sein soll. Aber wir finden freilich auch

1 Die Artikulation macht es nicht. Es muss kategoriale Anschauung sein.


text nr. 13 255

ein Vorschweben, das nicht Zeitlichkeit in diesem Sinn in sich birgt. Es


könnte übrigens hier hingewiesen werden auf das „vergegenwärtig-
te“ Jetzt in der sinnlichen Sphäre. Aber das klar vorgestellte Jetzt,
aber in Erinnerungsweise vorstellige, hat kein Analogon in der Ur-
5 teilssphäre, insofern als das verworren Vorschwebende, ein Gedanke,
der mir (als neuer) einfällt, in Eigentlichkeit nur möglich ist als
spontanes, also zuwendendes Urteilen, die Jetztvergegenwärtigung
aber nicht mit Zuwendung verbunden sein muss. Dagegen besteht
wohl Analogie, insofern als jede dieser und aller wirklichen Verge-
10 genwärtigungen Qualität des „belief“ hat und ebenso die verworrene
Vorschwebung einer Urteilsmeinung.
Sollen wir nun sagen, dass eine vorschwebende Meinung phäno-
menologisch den Charakter einer Vergegenwärtigungsmodifikation
habe?
15 Urteile, und zwar Urteile als verworren-einheitliche Meinungen,
haben oft den Charakter der retentionalen oder erinnernden Ver-
gegenwärtigung. Mögen sie ihn aber auch haben, niemals ist der
vermeinte Sachverhalt im eigentlichen Sinn etwas Zeitliches, etwas
„Gewesenes“ oder „Künftiges“. Ebenso wie ja auch das originäre
20 (artikulierte) Urteilen den Charakter einer Impression hat (insofern
einer Gegenwärtigung), darum aber nicht gegenständlich ein Jetzt
im zeitlichen Sinn bewusst hat. Würden wir das verworren vorschwe-
bende Urteil als eine Art Vergegenwärtigungsmodifikation auffassen,
so würde es darum also nicht das Korrelat zeitlich erscheinen lassen.
25 Nun möchte man aber einwenden: Wenn ich eine Urteilserinne-
rung habe, so hat das Urteilen (und das Urteil, sofern es dem Urteilen
immanentes ist) den Charakter des Gewesenseins und insofern belief-
Charakter. Aber das gilt dem Urteilen nur als Inhalt des inneren
Bewusstseins bzw. der inneren Reproduktion.
30 Es kann nun sein, dass ich jetzt noch ebenso urteile, dass ich
das Urteil „mitmache“, dass ich dem früheren Urteil zustimme. Es
deckt sich dann vollkommen das (von einem Strahl der Zuwendung
durchstrahlte) Erinnerungsphänomen, das Phänomen der Urteilsre-
produktion, und das jetzige Urteilen. Das braucht nicht zu sein: Ich
35 brauche „jetzt“ gar nicht zu urteilen, kann auch dagegen urteilen,
nicht zustimmend, sondern ablehnend. Es ist hierbei einerlei, ob die
Reproduktion eine eigentliche, die eigentliche Konstitution reprodu-
zierende ist, oder eine verworrene.
256 explikative und prädikative synthesen

Nehmen wir nun eine beliebig auftauchende Meinung: Können


wir noch annehmen, dass das eine Vergegenwärtigungsmodifikation
sei? Sie ist doch jetzt und wirklich meine Meinung, und nicht voll-
ziehe ich eine Vergegenwärtigung einer Meinung und Zustimmung.
5 Handelt es sich um eine Vergegenwärtigung, so bedürfe es aber, wie
im Fall einer Vergegenwärtigung der Erinnerung, so in jedem Fall
einer Zustimmung.
Man wird sagen können, dass die Versuchung, die verworren auf-
tauchende Meinung für eine Vergegenwärtigung zu halten, aus einer
10 Verwechslung der b ei den w e se nt li c h v e rs ch ie de ne n Art en
de r Ni c ht - Urs p r ün g li c h k ei t entsteht, die hier vorkommen kön-
nen. J e d e V e r g e g e n w ä r t i g u n g h a t e t w a s U n o r i g i n ä r e s, so-
fern sie eben vergegenwärtigt. Das Erscheinende gibt sich nicht als
„Selbst“, als eigenpersönliche „Wirklichkeit“, sondern nur als verge-
15 genwärtigtes Selbst. Andererseits hat j ed e ve r w or re n v or s c hw e-
be n d e V e r g e g e nw ä rt i gun g noch dazu e i nen a n de re n C ha -
r a k t e r d e s „ N i c ht - S e l bst “, eben das Vor s c hw e be n. Das Vor-
schwebende kann ich mir näher bringen, so dass ich es nun selbst,
nun eigentlich und wirklich fasse, es geht aus der Verworrenheit in
20 die Deutlichkeit, eventuell Klarheit über. Im Fall der Vergegenwärti-
gung: wenn ich sie klar vollziehe. Andererseits, di es e n C h ar ak te r
d e s Ni cht - S e lb s t ha t j e d e v e r w o r ren e „ Vor s c hw e bun g “,
auch die vorschwebende Meinung, die ich mir „näher bringe“ in
der Form des eigentlichen, artikuliert vollzogenen Urteils (bzw. des
25 Quasi-Urteils der Phantasie etc.).
Freilich, eine Schwierigkeit liegt noch vor. Sollen wir dann sagen,
die Urteilserscheinungen (die Erscheinungen der höheren, syntheti-
schen Stufe überhaupt) besitzen eine verworrene Modifikation, die
bei den sinnlichen Erscheinungen fehlt, oder sollen wir so paralle-
30 lisieren: D as v e rw o r r e n e Ur t e i l e n i s t U r te i l e n und ke i n e
„ V e r ge ge n w ä rt i g u ng “, keine Reproduktion, also als Impression
anzusprechen und demnach mit den Wahrnehmungen gleichzustel-
len? Nun sei aber auch zu scheiden zwischen Verworrenem und
Eigentlichem, Ursprünglichem in der Wahrnehmungssphäre selbst,
35 nämlich bei den apprehendierenden Wahrnehmungen. Je d e a pp r e -
he n di e r en d e W a h rn e h m ung s e i v e r w or r e n und wird zur fort-
schreitenden Eigentlichkeit, zur Stufe der „Ursprünglichkeit“ ge-
bracht im Durchlaufen der Erscheinungen der Wahrnehmungsman-
text nr. 13 257

nigfaltigkeit, in denen sich die Einheit des Gegenstandes nach seiner


Inhaltlichkeit zu eigentlicher Gegebenheit bringe. Freilich sei das ein
grenzenloser Prozess, weil jede neue Wahrnehmung neue Uneigent-
lichkeiten hereinbringe und der Gegenstand ein Unendliches sei.
5 Aber freilich haben wir da einen kardinalen Unterschied zwischen
der Verworrenheit der sinnlichen, apprehendierenden Impressionen
und der Urteilsimpressionen, dass in die sinnliche Verworrenheit
immerfort und mit Notwendigkeit auch Klarheit und Eigentlichkeit
eingeht und umgekehrt in die Klarheit auch Verworrenheit, während
10 das beim Urteil nicht der Fall ist.
Im Übrigen ist es wiederholt zu überlegen, ob das Mit-Apprehen-
dieren (der Rückseite und dgl.) und das verworrene Meinen wesent-
lich gleichartig sind. Natürlich darf man das Mit-Apprehendieren
nicht verwechseln mit dem Auftauchen dunkler Erscheinungen aus
15 der Erscheinungsmannigfaltigkeit.

§ 5. Sinnliche gegenüber kategorialer Erfassung. Der


auf das verworren Gemeinte gerichtete Blick
der Zuwendung gegenüber dem im eigentlichen
Urteilen lebenden Blick. Das verworrene
20 Denken gehört in die Sphäre der Passivität

Nach all diesen Untersuchungen können wir zur Frage des Sub-
strats sagen:
1) Jede Zuwendung, Erfassung (jedes Aufmerken-auf) hat ein
Zuwendungssubstrat, eine „Erscheinung“, in der das „erscheint“,
25 dem sich die Zuwendung zuwendet.1 In der Zuwendung wird im
weitesten Sinn etwas erfasst, aber die Erfassung ist eine ursprüngliche,
„eigentliche“ oder uneigentliche, je nachdem es die „Erscheinung“
ist.
2) Beschränken wir uns auf eigentliche, ursprüngliche Erfassung
30 (sei es auch unvollkommene), so kann sie entweder eine unmittelbare,
eine schlichte sein oder eine mittelbare, synthetisch fundierte.

1 Erfassen heißt hier überall nicht so viel wie „einstrahlig gerichtet sein auf etwas
als gegenständlicher Zielpunkt“, und hat nicht den engeren Sinn von perzeptiv
Erfassen. Im Denken ist etwas denkend erfasst, im Urteilen ist der Sachverhalt erfasst.
258 explikative und präd