Sie sind auf Seite 1von 364

GE Medical Systems

Technical
Publications

Direction 46–019510
Revision 17

X–Ray Planned Maintenance

Copyrighte 1991, 1993, 1997, 1998, 1999, 2000, 2001, 2002, 2003 By General Electric Co.
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

D THIS SERVICE MANUAL IS AVAILABLE IN ENGLISH ONLY.


WARNING D IF A CUSTOMER’S SERVICE PROVIDER REQUIRES A LANGUAGE OTHER
THAN ENGLISH, IT IS THE CUSTOMER’S RESPONSIBILITY TO PROVIDE
TRANSLATION SERVICES.
D DO NOT ATTEMPT TO SERVICE THE EQUIPMENT UNLESS THIS SERVICE
MANUAL HAS BEEN CONSULTED AND IS UNDERSTOOD.
D FAILURE TO HEED THIS WARNING MAY RESULT IN INJURY TO THE SERVICE
PROVIDER, OPERATOR OR PATIENT FROM ELECTRIC SHOCK, MECHANICAL
OR OTHER HAZARDS.

D CE MANUEL DE MAINTENANCE N’EST DISPONIBLE QU’EN ANGLAIS.


AVERTISSEMENT D SI LE TECHNICIEN DU CLIENT A BESOIN DE CE MANUEL DANS UNE AUTRE
LANGUE QUE L’ANGLAIS, C’EST AU CLIENT QU’IL INCOMBE DE LE FAIRE
TRADUIRE.
D NE PAS TENTER D’INTERVENTION SUR LES ÉQUIPEMENTS TANT QUE LE
MANUEL SERVICE N’A PAS ÉTÉ CONSULTÉ ET COMPRIS.
D LE NON-RESPECT DE CET AVERTISSEMENT PEUT ENTRAÎNER CHEZ LE
TECHNICIEN, L’OPÉRATEUR OU LE PATIENT DES BLESSURES DUES À DES
DANGERS ÉLECTRIQUES, MÉCANIQUES OU AUTRES.

D DIESES KUNDENDIENST–HANDBUCH EXISTIERT NUR IN ENGLISCHER


SPRACHE.
WARNUNG
D FALLS EIN FREMDER KUNDENDIENST EINE ANDERE SPRACHE BENÖTIGT,
IST ES AUFGABE DES KUNDEN FÜR EINE ENTSPRECHENDE ÜBERSETZUNG
ZU SORGEN.
D VERSUCHEN SIE NICHT, DAS GERÄT ZU REPARIEREN, BEVOR DIESES
KUNDENDIENST–HANDBUCH NICHT ZU RATE GEZOGEN UND VERSTANDEN
WURDE.
D WIRD DIESE WARNUNG NICHT BEACHTET, SO KANN ES ZU VERLETZUNGEN
DES KUNDENDIENSTTECHNIKERS, DES BEDIENERS ODER DES PATIENTEN
DURCH ELEKTRISCHE SCHLÄGE, MECHANISCHE ODER SONSTIGE
GEFAHREN KOMMEN.

D ESTE MANUAL DE SERVICIO SÓLO EXISTE EN INGLÉS.


AVISO D SI ALGÚN PROVEEDOR DE SERVICIOS AJENO A GEMS SOLICITA UN IDIOMA
QUE NO SEA EL INGLÉS, ES RESPONSABILIDAD DEL CLIENTE OFRECER UN
SERVICIO DE TRADUCCIÓN.
D NO SE DEBERÁ DAR SERVICIO TÉCNICO AL EQUIPO, SIN HABER
CONSULTADO Y COMPRENDIDO ESTE MANUAL DE SERVICIO.
D LA NO OBSERVANCIA DEL PRESENTE AVISO PUEDE DAR LUGAR A QUE EL
PROVEEDOR DE SERVICIOS, EL OPERADOR O EL PACIENTE SUFRAN
LESIONES PROVOCADAS POR CAUSAS ELÉCTRICAS, MECÁNICAS O DE OTRA
NATURALEZA.

L
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

D ESTE MANUAL DE ASSISTÊNCIA TÉCNICA SÓ SE ENCONTRA DISPONÍVEL


EM INGLÊS.
ATENÇÃO
D SE QUALQUER OUTRO SERVIÇO DE ASSISTÊNCIA TÉCNICA, QUE NÃO A
GEMS, SOLICITAR ESTES MANUAIS NOUTRO IDIOMA, É DA
RESPONSABILIDADE DO CLIENTE FORNECER OS SERVIÇOS DE TRADUÇÃO.
D NÃO TENTE REPARAR O EQUIPAMENTO SEM TER CONSULTADO E
COMPREENDIDO ESTE MANUAL DE ASSISTÊNCIA TÉCNICA.
D O NÃO CUMPRIMENTO DESTE AVISO PODE POR EM PERIGO A SEGURANÇA
DO TÉCNICO, OPERADOR OU PACIENTE DEVIDO A‘ CHOQUES ELÉTRICOS,
MECÂNICOS OU OUTROS.

D IL PRESENTE MANUALE DI MANUTENZIONE È DISPONIBILE SOLTANTO IN


INGLESE.
AVVERTENZA
D SE UN ADDETTO ALLA MANUTENZIONE ESTERNO ALLA GEMS RICHIEDE IL
MANUALE IN UNA LINGUA DIVERSA, IL CLIENTE È TENUTO A PROVVEDERE
DIRETTAMENTE ALLA TRADUZIONE.
D SI PROCEDA ALLA MANUTENZIONE DELL’APPARECCHIATURA SOLO DOPO
AVER CONSULTATO IL PRESENTE MANUALE ED AVERNE COMPRESO IL
CONTENUTO.
D NON TENERE CONTO DELLA PRESENTE AVVERTENZA POTREBBE FAR
COMPIERE OPERAZIONI DA CUI DERIVINO LESIONI ALL’ADDETTO ALLA
MANUTENZIONE, ALL’UTILIZZATORE ED AL PAZIENTE PER
FOLGORAZIONE ELETTRICA, PER URTI MECCANICI OD ALTRI RISCHI.

LL
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

Direction 46–019510
Revision 7

X–Ray Planned Maintenance

IMPORTANT! . . . ;5$<3527(&7,21
X-ray equipment if not properly FRPSOHWH SURWHFWLRQ 1RU FDQ DQ\ RQ 5DGLDWLRQ 3URWHFWLRQ DQG WDNH
used may cause injury. SUDFWLFDO GHVLJQ FRPSHO WKH DGHTXDWH VWHSV WR SURWHFW DJDLQVW
Accordingly, the instructions RSHUDWRU WR WDNH DGHTXDWH LQMXU\
herein contained should be SUHFDXWLRQV WR SUHYHQW WKH
thoroughly read and understood SRVVLELOLW\RIDQ\SHUVRQVFDUHOHVVO\ 7KH HTXLSPHQW LV VROG ZLWK WKH
by everyone who will use the H[SRVLQJ WKHPVHOYHV RU RWKHUV WR XQGHUVWDQGLQJ WKDW WKH *HQHUDO
equipment before you attempt to UDGLDWLRQ (OHFWULF&RPSDQ\0HGLFDO6\VWHPV
place this equipment in *URXS LWV DJHQWV DQG
operation. The General Electric ,WLVLPSRUWDQWWKDWHYHU\RQHKDYLQJ UHSUHVHQWDWLYHV KDYH QR
Company, Medical Systems DQ\WKLQJ WR GR ZLWK [UDGLDWLRQ EH UHVSRQVLELOLW\ IRU LQMXU\ RU GDPDJH
Group, will be glad to assist and SURSHUO\WUDLQHGDQGIXOO\DFTXDLQWHG ZKLFKPD\UHVXOWIURPLPSURSHUXVH
cooperate in placing this ZLWK WKH UHFRPPHQGDWLRQV RI WKH RIWKHHTXLSPHQW
equipment in use. 1DWLRQDO &RXQFLO RQ 5DGLDWLRQ 9DULRXV SURWHFWLYH PDWHULDO DQG
3URWHFWLRQ DQG 0HDVXUHPHQWV DV GHYLFHVDUHDYDLODEOH,WLVXUJHGWKDW
$OWKRXJK WKLV DSSDUDWXV SXEOLVKHG LQ 1&53 5HSRUWV VXFKPDWHULDOVRUGHYLFHVEHXVHG
LQFRUSRUDWHV D KLJK GHJUHH RI DYDLODEOH IURP 1&53 3XEOLFDWLRQV
SURWHFWLRQDJDLQVW[UDGLDWLRQRWKHU  :RRGPRQW $YHQXH 5RRP CAUTION: 8QLWHG 6WDWHV )HGHUDO
WKDQ WKH XVHIXO EHDP QR SUDFWLFDO  %HWKHVGD 0DU\ODQG  ODZUHVWULFWVWKLVGHYLFHWRXVHE\RU
GHVLJQ RI HTXLSPHQW FDQ SURYLGH DQGRIWKH,QWHUQDWLRQDO&RPPLVVLRQ RQWKHRUGHURIDSK\VLFLDQ

LLL
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,I\RXKDYHDQ\FRPPHQWVVXJJHVWLRQVRUFRUUHFWLRQVWRWKHLQIRUPDWLRQLQWKLVGRFXPHQW
SOHDVHZULWHWKHPGRZQLQFOXGHWKHGRFXPHQWWLWOHDQGGRFXPHQWQXPEHUDQGVHQGWKHPWR

GENERAL ELECTRIC COMPANY MEDICAL SYSTEMS


0$1$*(5±,1)250$7,21,17(*5$7,21
$0(5,&$6:±
32%2;
0,/:$8.((:,±

CERTIFIED ELECTRICAL CONTRACTOR STATEMENT

$OO HOHFWULFDO LQVWDOODWLRQV WKDW DUH VKDOO EH SHUIRUPHG E\ TXDOLILHG *( UHTXLUHPHQWV RI WKH DSSOLFDEOH
SUHOLPLQDU\ WR SRVLWLRQLQJ RI WKH 0HGLFDO SHUVRQQHO 7KH SURGXFWV HOHFWULFDOFRGHV
HTXLSPHQWDWWKHVLWHSUHSDUHGIRUWKH LQYROYHG DQG WKH DFFRPSDQ\LQJ
HTXLSPHQW VKDOO EH SHUIRUPHG E\ HOHFWULFDO LQVWDOODWLRQV  DUH KLJKO\
OLFHQVHG HOHFWULFDO FRQWUDFWRUV ,Q VRSKLVWLFDWHG DQG VSHFLDO 7KHSXUFKDVHURI*(HTXLSPHQWVKDOO
DGGLWLRQ HOHFWULFDO IHHGV LQWR WKH HQJLQHHULQJFRPSHWHQFHLVUHTXLUHG RQO\ XWLOL]H TXDOLILHG SHUVRQQHO LH
3RZHU 'LVWULEXWLRQ 8QLW VKDOO EH ,Q SHUIRUPLQJ DOO HOHFWULFDO ZRUN RQ *(¶V ILHOG HQJLQHHUV SHUVRQQHO RI
SHUIRUPHG E\ OLFHQVHG HOHFWULFDO WKHVH SURGXFWV *( ZLOOXVHLWVRZQ WKLUGSDUW\ VHUYLFH FRPSDQLHV ZLWK
FRQWUDFWRUV 2WKHU FRQQHFWLRQV VSHFLDOO\WUDLQHGILHOGHQJLQHHUV$OORI HTXLYDOHQW WUDLQLQJ RU OLFHQVHG
EHWZHHQ SLHFHV RI HOHFWULFDO *(¶V HOHFWULFDO ZRUN RQ WKHVH HOHFWULFLDQV  WR SHUIRUP HOHFWULFDO
HTXLSPHQW FDOLEUDWLRQV DQG WHVWLQJ SURGXFWV ZLOO FRPSO\ ZLWK WKH VHUYLFLQJRQWKHHTXLSPHQW

DAMAGE IN TRANSPORTATION
$OO SDFNDJHV VKRXOG EH FORVHO\ XSRQ GLVFRYHU\ RU LQ DQ\ HYHQW  ± immediately DIWHU
H[DPLQHG DW WLPH RI GHOLYHU\ ,I ZLWKLQ14GD\VDIWHUUHFHLSWDQGWKH GDPDJH LV IRXQG $W WKLV WLPH EH
GDPDJHLVDSSDUHQWKDYHQRWDWLRQ FRQWHQWV DQG FRQWDLQHUV KHOG IRU UHDG\ WR VXSSO\ QDPH RI FDUULHU
³damage in shipment´ ZULWWHQ RQ LQVSHFWLRQ E\ WKH FDUULHU $ GHOLYHU\ GDWH FRQVLJQHH QDPH
allFRSLHVRIWKHIUHLJKWRUH[SUHVV WUDQVSRUWDWLRQFRPSDQ\ZLOOQRWSD\ IUHLJKWRUH[SUHVVELOOQXPEHULWHP
ELOO before GHOLYHU\ LV DFFHSWHG RU DFODLPIRUGDPDJHLIDQLQVSHFWLRQ GDPDJHGDQGH[WHQWRIGDPDJH
³VLJQHG IRU´ E\ D *HQHUDO (OHFWULF LV QRWUHTXHVWHGZLWKLQWKLV14GD\
UHSUHVHQWDWLYH RU D KRVSLWDO SHULRG &RPSOHWH LQVWUXFWLRQV UHJDUGLQJ
UHFHLYLQJ DJHQW :KHWKHU QRWHG RU FODLP SURFHGXUH DUH IRXQG LQ
FRQFHDOHG GDPDJH MUST EH &DOO 7UDIILF DQG 7UDQVSRUWDWLRQ 6HFWLRQ ³6´ RI WKH 3ROLF\
UHSRUWHGWRWKHFDUULHUimmediately 0LOZDXNHH :,   ±  3URFHGXUH%XOOHWLQV


LY
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

TABLE OF CONTENTS

TAB TITLE PAGE

5(9,6,21+,6725<  YLL

/(77(52),17(17  L[

5$' 5$')/2:',$*5$0  5$'±

5 ) 5 ))/2:',$*5$0  5 )±

63(&,$/6 63(&,$/6)/2:',$*5$0  63(&±

5$'3257 5$'3257$%/(6)/2:',$*5$0  5$'3257±

02%,/()/ 02%,/()/8252)/2:',$*5$0  02%)/±

0$002 0$002)/2:',$*5$0  0$002±

 ;30± *(1(5$/ 
;30± 6$)(7<$1')81&7,21$/  ±L

 5(6(59(')25)8785(86(

 ;30± *(1(5$7253(5)250$1&(  ±L

 ;30± *(1(5$7253(5)250$1&(  ±L

 ;30± ,0$*,1*3(5)250$1&(  ±L

 5(6(59(')25)8785(86(

 ;30± 0$002DQG5$'02%,/(6  ±L

 ;30± 5$',2*5$3+,&3257$%/(6  ±L

 ;30± 0,6&(//$1(286  ±L

 6(59,&(127(6  ±L

 5(6(59(')25)8785(86(

&+(&./,676$1''$7$6+((76±L

$''(1'803/$11('0$,172)(;32685(&21752/6±

Y
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

7+,63$*(,17(17,21$//</()7%/$1.

YL
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

REVISION HISTORY

REV DATE REASON FOR CHANGE


 0D\ ,QLWLDOUHOHDVH
 1RY *HQHUDOXSGDWH
 $SU *HQHUDOXSGDWH
 -DQ 8SGDWHGIRUPDWWRFXUUHQWVWDQGDUGVFKDQJHVWR-RE&DUG;30±
 -XO\ 5HYLVHG(OHFWULFDO/HDNDJHVSHFLILFDWLRQVLQVHFWLRQ$GGHG1RWHWR5$'
3257SDJHV$GGHG;30±
 1RY 5HYLVHG;30±0DPPRJUDSK\IRFDOVSRWUHVROXWLRQOLPLWIRUP)DQG
WKHPDPPRIORZGLDJUDP5HYLVHG;30±
 'HF *HQHUDOXSGDWHV
 $SU 8SGDWHVWR;30
 -XO\ 8SGDWHG&KDSWHU)RUPV
 1RY 8SGDWHG;30±;30±;30±;30±;30±;30±
;30±;30±;30±
 -XQH 8SGDWHG;30±5);UHSODFHPHQWF\FOH
 -XQH 8SGDWHGSDJHL[5$'3257)ORZ'LDJUDPVDQG;30±WRLQFOXGH
$0;±DQG$0;±
 -DQ 8SGDWHG;30± &KDUW5); DQG;30±8SGDWHG;30±
;30±DQG;30± DGGHG1RWHUHJDUGLQJ30IUHTXHQF\ 
 0D\ 8SGDWHG0RELOH)OXRUR)ORZGLDJUDPVKHHWVWKURXJK
 0DUFK 8SGDWHGE\096GLYLVLRQIRUXVHDOVRRQQRQ*(06V\VWHPV$GGHG;30±

 0D\ *HQHUDOXSGDWHV
10$5$GGLWLRQRI$GGHQGXPIRU3ODQQHG0DLQWHQDQFHRI([SRVXUH&RQWUROV7DE
17 26FEB4 $GGed Prestige and Prestilix Planned Maintenance section7DE, Sec 13-3

YLL
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

LIST OF EFFECTIVE PAGES

PAGE REVISION PAGE REVISION PAGE REVISION


NUMBER NUMBER NUMBER NUMBER NUMBER NUMBER

7LWOH3DJH 7 TAB 2 TAB 9


±LDQG±LL 7
LWKUX[ 7 TAB 3 ±WKUX± 7
±LDQG±LL 7
TAB – RAD ±WKUX± 7 TAB 10
5$'±WKUX5$'± 7 ±LDQG±LL 7
TAB 4 ±WKUX± 7
TAB – R&F ±LDQG±LL 7
5 )±WKUX5 )± 7 ±WKUX± 7 TAB 11
TAB – SPECIALS TAB 5 TAB 12
63(&±WKUX63(&± 7 ±LDQG±LL 7 ±LDQG±LL 7
±WKUX± 7 ±WKUX± 7
TAB – RAD PORT
5$'3257±WKUX TAB 6 7$%7
5$'3257± 7
%DFN3DJH
TAB 7
TAB – MOBILE FL ±LDQG±LL 7
02%)/±WKUX ±WKUX± 7
02%)/± 7
TAB 8
TAB – MAMMO
0$002±WKUX ±LDQG±LL 7
0$002± 7 ±WKUX± 7

TAB 1
±LDQG±LL 7
±WKUX± 7

YLLL
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

STATEMENT OF INTENT AND USE

7KHJRDOLVWRSURYLGHDOLYLQJXSGDWDEOHSODQQHGPDLQWHQDQFHLQVSHFWLRQ
SURJUDP WKDW PHHWV RXU FRPPLWPHQWV WR RXU FXVWRPHUV ZLWKLQ WKH FRQ
VWUDLQWRQWRGD\¶VZRUNHQYLURQPHQW7KHPRVWFUXFLDORIWKHVHFRQVWUDLQWV
EHLQJWLPHDQGURRPDYDLODELOLW\

7KH LQVSHFWLRQV DUH LQWHQGHG WR EH GRQH VHPLDQQXDOO\ RU GLYLGHG LQWR
VPDOOHUEORFNVGHSHQGHQWRQ\RXUDJUHHPHQWZLWK\RXUFXVWRPHU$0;±
DQG6WHQRVFRSLQVSHFWLRQVVKRXOGEHGRQHDQQXDOO\)RU$0;±WKHILUVW
LQVSHFWLRQVKRXOGEHGRQHDIWHUPRQWKVDQQXDOO\WKHUHDIWHU

7KHWRWDOLQVSHFWLRQWLPHVZLOOEHWKHEDVHWLPHSOXVDQ\RSWLRQVRQ\RXUV\V
WHP7KHEDVLFWLPHVDUHDVIROORZV

5$' KRXUV
5 ) KRXUV
6SHFLDOV KRXUV
0RELOHV KRXUV KRXUVIRU$0;± $0;±
KRXUVIRU6WHQRVFRS
0DPPR KRXUV

3ULRUWRLPSOHPHQWLQJWKLVSURJUDPDFRQWUDFWUHYLHZVKRXOGEHGRQHZLWK
WKHDUHDVHUYLFHPDQDJHUDQGWKHFXVWRPHU$FRQWUDFWUHYLHZLVQHHGHGVR
WKHFXVWRPHUDQG*(ERWKKDYHDFOHDUXQGHUVWDQGLQJRIZKDWWKHFXVWRP
HU¶VH[SHFWDWLRQVDUHDQGZKDWDGYDQWDJHVWKHFXVWRPHUZLOOUHFHLYHIURP
WKLVSURJUDP

6FKHGXOLQJRIWKHLQVSHFWLRQVVKRXOGLQFOXGHDUHYLHZRIWKHURRPORJWRLQ
VXUHQRPDMRUSUREOHPVH[LVWWKDWZRXOGFRPSURPLVH\RXUDELOLW\WRGRWKH
LQVSHFWLRQ&RQVLGHUDWLRQVRIWKHFXVWRPHU¶VSDWLHQWFDUHVXFKDVFOHDQHU
RUSDLQWIXPHVQRLVHDQGKRXVHNHHSLQJDVVLVWDQFHVKRXOGEHDUUDQJHGDW
WKLVWLPH
7KHFKHFNOLVWZDVZULWWHQWRVXPPDUL]HWKHZRUNIRUWKHFXVWRPHUGHSDUW
PHQWKHDGDQGWKHUHIRUHGRHVQRWFRQWDLQWHFKQLFDOGHWDLOVRULWHPVWKDW
DUHPHDQLQJOHVVWRWKHP7KHFKHFNVJLYHWKHFXVWRPHUIHHGEDFNRQLWHPV
WKDWZHUHIRXQG2.LWHPVWKDW\RXKDGDFWLRQRQRULWHPVWKDWQHHGWREH
VFKHGXOHGIRUDGGLWLRQDOVHUYLFH
7KHLQWHQWRIWKHLQVSHFWLRQLVWREHonlyDQLQVSHFWLRQ,WHPVWKDWFDQEH
FRUUHFWHGZLWKYHU\OLWWOHWLPHUHTXLUHGFDQEHGRQH$Q\LWHPVIRXQGWKDW
ZLOODIIHFW\RXUDELOLW\WRFRPSOHWHWKHLQVSHFWLRQZLWKLQWKHDYDLODEOHWLPH
mustEHQRWHGLQWKHFRPPHQWVDQGWLPHVFKHGXOHGIRUDGGLWLRQDOVHUYLFH
7KHRULJLQDOFRS\RIWKHFKHFNOLVWLVIRUWKHFXVWRPHU7KHDGGLWLRQDOFDUERQ
OHVVFRSLHVDUHIRUWKH*(RIILFHILOHDQGDFRS\IRU\RXUXVH

7KHWHFKQLFDOGDWDVKHHWVVKRXOGEHNHSWLQWKHURRPIRUIXUWKHUUHIHUHQFH
GXULQJVHUYLFHDQGIXWXUHLQVSHFWLRQV7KHEHQFKPDUNQDWXUHRIWKHGDWDZLOO
EHDJRRGEDVHOLQHIRUVHUYLFHWURXEOHVKRRWLQJ$FRS\RIWKHGDWDFDQEH
JLYHQWRWKHFXVWRPHUXSRQUHTXHVWRUDW\RXUGLVFUHWLRQ

L[
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

7KHIORZGLDJUDPVIXQFWLRQDVDVWHHULQJJXLGHWRJHW\RXIURPWKHFKHFNOLVW
LWHPWRWKHDSSURSULDWHSURFHGXUHV6HH,OOXVWUDWLRQ7KHFKHFNVDUHLQDORJ
LFDOWRS±GRZQSURJUHVVLRQDWWKHOHIWRIWKHIORZGLDJUDPDVLQFKHFNLQJWKH
SURFHVVRUEHIRUHUXQQLQJWHVWILOPV7KHSURFHGXUHVRQWKHULJKWRIWKHIORZ
GLDJUDPDUHLQDEXLOGLQJEORFNSURFHVV)RUH[DPSOHRQDQ5 )URRPWKH
5$'WHVWVDUHILUVWDQGWKH5 )WHVWVDUHLQWKHDGGLWLRQVWRWKH5$'WHVWV
7KHLQWHQWRIWKLVVWUXFWXUHLVWRDOORZIOH[LELOLW\IRU\RXWRGLYLGHXSWKHWHVWVWR
ILW\RXUWLPHDYDLODELOLW\7KHIORZGLDJUDPVFDQEHIROGHGRXWWRHQDEOHUHIHU
ULQJWRWKHPZKLOHWKHPDQXDOLVRSHQWRDSURFHGXUH

7KHHVWLPDWHGWLPHIRUHDFKMREFDUGLVIRUWKDWWHVWRQO\6RPHWHVWWLPHVDUH
VKRUWEHFDXVHWKH\DUHLQWHQGHGWREHGRQHGXULQJRWKHUWHVWVVRXVH\RXU
WLPHHIILFLHQWO\

7KH ;±UD\ 3URGXFWV *XLGH IRU 3ODQQHG 0DLQWHQDQFH LQVSHFWLRQV LV LQ
WHQGHGWRJXLGH\RXLQVWDQGDUGL]LQJWKHWLPHDQGZRUNSHUIRUPHGZKLOHDO
ORZLQJIOH[LELOLW\WRPHHW\RXUFXVWRPHUQHHGV$GGLWLRQDOLQIRUPDWLRQFDQ
EHIRXQGLQWKHVHFWLRQRULQWKH;±UD\6WDQGDUGV+DQGERRN'LUHFWLRQ
± 3URFHGXUHVIRUFRUUHFWLQJSUREOHPVIRXQGGXULQJWKHLQVSHF
WLRQZLOOEHLQWKHVSHFLILFHTXLSPHQWPDQXDOIRUWKHLWHP\RXDUHLQVSHFWLQJ
5HIHUHQFHWKH6\VWHP)LHOG7HVWIRU++6'LUHFWLRQ±IRUOHJDOWRO
HUDQFHV

7KHORRVHOHDIIRUPDWRIWKHPDQXDODOORZVHDV\XSGDWLQJDQGDGGLWLRQVWKDW
PD\EHQHHGHGWRVXLW\RXUORFDODUHDRUVSHFLILFFXVWRPHU¶VUHTXLUHPHQWV,I
DQHUURURUPRUHHIILFLHQWSURFHGXUHLVIRXQGSOHDVHIRUZDUGLWWR)6'(DW
WHQWLRQ3ODQQHG0DLQWHQDQFH'RFXPHQWDWLRQVRHYHU\RQHFDQEHQHILW

)ROORZLQJ WKH LQVSHFWLRQ WKH FXVWRPHU VKRXOG EH FRQWDFWHG every time
7KHIROORZXSZLOOJLYH\RXIHHGEDFNRQWKHLQVSHFWLRQDQGWKHFXVWRPHUV
SHUFHSWLRQV6FKHGXOLQJRUUHSDLUVDQGIROORZXSZRUNFDQEHDJUHHGRQDW
WKLVWLPH

7KLV KDQGERRN GRHV QRW UHSODFH WKH FHUWLILHG VHWXS SURFHGXUHV LQ WKH
VHUYLFHPDQXDOVEXWLVDPRUHHIILFLHQWPHWKRGRIPHDVXULQJWKHV\VWHP
SHUIRUPDQFH7KLVEHQFKPDUNWHVWLQJDSSURDFKUHVXOWVLQLWVEHLQJFODVV
³&´SURSULHWDU\7KLVFODVVLILFDWLRQDOORZVIOH[LELOLW\IRUXVHLQFRRSHUDWLYH
FRQWUDFWV

Note addition of Planned Maintenance of Exposure Controls. Reference Tab 13.



FLOW DIAGRAMS

Safety

&KHFN/LVW -RE&DUG1DPH
,WHP 1XPEHU

1H[WRU2SWLRQDO-RE&DUG
1XPEHU
[
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY MAINTENANCE
REV 15
16
5(9 DIRECTION 46–019510
',5(&7,21±
REV 17 DIRECTION 46–019510

RAD FLOW DIAGRAM

'LVFXVV30ZLWK&XVWRPHU 'LVFXVV30
DQGUHYLHZORJERRN ;30±

Safety

&RXQWHUZHLJKW 6DIHW\±5$'±&ZW
&DEOH&KHFN ;30±

0HFKDQLFDO±5$'
;30±

6DIHW\±5$'±&ZW±&KDLQ'ULYHV
;30±

0RXQWLQJ%ROW 6DIHW\±5$'±0RXQWLQJ
,QVSHFWLRQ ;30±

$FFHVVRULHV 6DIHW\±$FFHVVRULHV
&KHFNHG ;30±

Functional

&RPSRQHQW 9LVXDO,QVSHFWLRQ±5$'
,QVSHFWLRQ ;30±

&OHDQDQG &OHDQDQG/XEH±5$'
/XEULFDWH ;30±

6\VWHP2SHUDWLRQ )XQFWLRQDO±5$'
&KHFN ;30±

'ULYHVDQG/RFNV )XQFWLRQDO±5$'
&KHFNHG ;30±

,QGLFDWRUDQG,QWHUORFN ,QGLFDWRU/DPSV±5$'
&KHFN ;30±

5$'±
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS P
REV 16
15 DIRECTION 46–019510
46–019510 5
REV 17 DIRECTION

RAD FLOW DIAGRAM (CONT.)


Performance

9HULI\*HQHUDWRU 5$'7LPHU
&DOLEUDWLRQ ;30±

5$'N9S
;30±

5$'P$
;30±

3URWHFWLRQ&LUFXLWV 7XEH3URWHFWRU
&RQILUPHG ;30±

5RWRU&RQWUROOHU
;30±

0HPRU\'DWDDQG%DWWHU\
;30±

&ROOLPDWLRQ &ROOLPDWLRQDQG3KRWRWLPLQJ
9HULILHG ;30±

0DQXDO&ROOLPDWRU
;30±

3KRWRWLPHU &ROOLPDWLRQDQG3KRWRWLPLQJ
&KHFNHG ;30±

7RPR )XQFWLRQDO±'HGLFDWHG7RPR
&KHFNHG ;30±

)XQFWLRQDO±7RPR2SWLRQ
;30±

5HYLHZ3UHYLRXV
3HUIRUPDQFH

5HVWRUH1RUPDO )LQDO&KHFNRXW
2SHUDWLRQ ;30±

5HYLHZ5HVXOWV
ZLWK&XVWRPHU
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY MAINTENANCE
REV 15
16
5(9 DIRECTION 46–019510
',5(&7,21±
REV 17 DIRECTION 46–019510

R&F FLOW DIAGRAM

'LVFXVV30ZLWK&XVWRPHU 'LVFXVV30
DQGUHYLHZORJERRN ;30±

Safety

&RXQWHUZHLJKW 6DIHW\±5$'±&ZW
&DEOH&KHFN ;30±

6DIHW\±5 )±&ZW
;30±

0HFKDQLFDO±5$'
;30±

6DIHW\±5$'±&ZW±&KDLQ'ULYHV
;30±

0RXQWLQJ%ROW 6DIHW\±5$'±0RXQWLQJ
,QVSHFWLRQ ;30±

6DIHW\±5 )±0RXQWLQJ
;30±

*URXQG/HDNDJH *URXQG/HDNDJH6XUYH\
6XUYH\ ;30±

$FFHVVRULHV 6DIHW\±$FFHVVRULHV
&KHFNHG ;30±

Functional

&RPSRQHQW 9LVXDO,QVSHFWLRQ±5$'
,QVSHFWLRQ ;30±

9LVXDO,QVSHFWLRQ±5 )
;30±

&OHDQDQG &OHDQDQG/XEULFDWH±5$'
/XEULFDWH ;30±

&OHDQDQG/XEULFDWH±5 )
;30±

5 )±
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS P
REV 16
15 DIRECTION 46–019510
46–019510 5
REV 17 DIRECTION

R&F FLOW DIAGRAM (CONT.)

6\VWHP2SHUDWLRQ )XQFWLRQDO&KHFN±5$'
&KHFN ;30±

)XQFWLRQDO&KHFN±5 )
;30±

3KRWRVSRW&DPHUD
;30±

)XQFWLRQDO&KHFN±5HPRWH
;30±

'ULYHVDQG/RFNV )XQFWLRQDO&KHFN±5$'
&KHFNHG ;30±

)XQFWLRQDO&KHFN±5 )
;30±

)XQFWLRQDO&KHFN±5HPRWH
;30±

,QGLFDWRUDQG,QWHUORFN ,QGLFDWRU/DPSV±5$'
&KHFN ;30±

,QGLFDWRU/DPSV±5 )
;30±

)LOP&KDQJHU6WHSSHU )XQFWLRQDO&KHFN±)&6
&KHFN ;30±
Performance
9HULI\*HQHUDWRU 5$'7LPHU
&DOLEUDWLRQ ;30±

5$'N9S
;30±

5$'P$
;30±

)OXRUR7LPHU
;30±

)OXRURN9S
;30±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY MAINTENANCE
REV 15
16
5(9 DIRECTION 46–019510
',5(&7,21±
REV 17 DIRECTION 46–019510

R&F FLOW DIAGRAM (CONT.)

3URWHFWLRQ&LUFXLWV 7XEH3URWHFWRU
&RQILUPHG ;30±

5RWRU&RQWUROOHU
;30±

0HPRU\'DWD %DWWHU\
;30±

&ROOLPDWLRQ
9HULILHG
&ROOLPDWRUDQG3KRWR±5$'
;30±
3KRWRWLPHU
&KHFNHG

7RPR )XQFWLRQDO'HGLFDWHG7RPR
&KHFNHG ;30±

)XQFWLRQDO7RPR2SWLRQ
;30±

0D[µ5¶2XWSXW )OXRURP$
&KHFNHG ;30±

'RVH ,QSXW'RVH
9HULILFDWLRQ ;30±

,PDJH4XDOLW\ ,PDJH4XDOLW\
(YDOXDWLRQ ;30±

5HVROXWLRQ
;30±

3URFHVVRU 3URFHVVRU±6KHHW)LOP
&KHFN ;30±

6SRW±)LOP$OLJQPHQW &ROOLPDWRUDQG3KRWR±5 )
&KHFN ;30±

3KRWRVSRW&DPHUD 3KRWRVSRW5HYLHZ
&KHFNHG ;30±

'5,PDJH5HYLHZ
;30±

5 )±
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS P
REV 16
15 DIRECTION 46–019510
46–019510 5
REV 17 DIRECTION

R&F FLOW DIAGRAM (CONT.)

'LJLWDO,PDJH ')9DVFXODU,PDJH4XDOLW\
(YDOXDWLRQ ;30±

'*';9DVFXODU,PDJH4XDOLW\
;30±

0DJ7DSH'ULYH
;30±

)LOP)RUPDWWHU *()RUPDWWHU
&KHFNHG ;30±

0,±)RUPDWWHU
;30±

0/DVHU&DPHUD
;30±

5HYLHZ3UHYLRXV
3HUIRUPDQFH

5HWXUQ6\VWHPWR )LQDO&KHFNRXW
1RUPDO2SHUDWLRQ ;30±

5HYLHZ5HVXOWV
ZLWK&XVWRPHU
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY MAINTENANCE
REV 15
16
5(9 DIRECTION 46–019510
',5(&7,21±
REV 17 DIRECTION 46–019510

SPECIALS FLOW DIAGRAM

'LVFXVV30ZLWK&XVWRPHU 'LVFXVV30
DQGUHYLHZORJERRN ;30±

Safety

&RXQWHUZHLJKW 6DIHW\±5$'±&ZW
&DEOH&KHFN ;30±

6DIHW\±5 )±&ZW
;30±

6DIHW\±9DVFXODU±&ZW
;30±

0HFKDQLFDO±5$'
;30±

6DIHW\±5$'±&ZW±&KDLQ'ULYHV
;30±

0RXQWLQJ%ROW 6DIHW\±5$'±0RXQWLQJ
,QVSHFWLRQ ;30±

6DIHW\±5 )±0RXQWLQJ
;30±

6DIHW\±9DVFXODU±0RXQWLQJ
;30±

*URXQG/HDNDJH *URXQG/HDNDJH6XUYH\
6XUYH\ ;30±

$FFHVVRULHV 6DIHW\±$FFHVVRULHV
&KHFNHG ;30±

Functional

&RPSRQHQW 9LVXDO,QVSHFWLRQ±5$'
,QVSHFWLRQ ;30±

9LVXDO,QVSHFWLRQ±5 )
;30±

9LVXDO,QVSHFWLRQ±9DVFXODU
;30±

63(&±
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS P
REV 16
15 DIRECTION 46–019510
46–019510 5
REV 17 DIRECTION

SPECIALS FLOW DIAGRAM (CONT.)

&OHDQDQG &OHDQDQG/XEULFDWH±5$'
/XEULFDWH ;30±

&OHDQDQG/XEULFDWH±5 )
;30±

&OHDQDQG/XEULFDWH±9DVFXODU
;30±

3KRWRVSRW&DPHUD
;30±

&LQH&DPHUD
;30±

6\VWHP2SHUDWLRQ )XQFWLRQDO&KHFN±5$'
&KHFNV ;30±

)XQFWLRQDO&KHFN±5 )
;30±

)XQFWLRQDO&KHFN±9DVFXODU
;30±

'ULYHVDQG/RFNV )XQFWLRQDO&KHFN±5$'
&KHFNHG ;30±

)XQFWLRQDO&KHFN±5 )
;30±

)XQFWLRQDO&KHFN±9DVFXODU
;30±

,QGLFDWRUDQG,QWHUORFN ,QGLFDWRU/DPSV±5$'
&KHFN ;30±

,QGLFDWRU/DPSV±5 )
;30±

,QGLFDWRU/DPSV±9DVFXODU
;30±

)LOP&KDQJHU6WHSSHU )XQFWLRQDO&KHFN±)&6
&KHFN ;30±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY MAINTENANCE
REV 15
16
5(9 DIRECTION 46–019510
',5(&7,21±
REV 17 DIRECTION 46–019510

SPECIALS FLOW DIAGRAM (CONT.)


Performance

9HULI\*HQHUDWRU 5$'7LPHU
&DOLEUDWLRQ ;30±

5$'N9S
;30±

5$'P$
;30±

)OXRUR7LPHU
;30±

)OXRURN9S
;30±

&LQH0D[3:
;30±

&LQH0D[N9 P$
;30±

3URWHFWLRQ&LUFXLWV 7XEH3URWHFWRU
&RQILUPHG ;30±

5RWRU&RQWUROOHU
;30±

0HPRU\'DWD %DWWHU\
;30±

&ROOLPDWLRQ &ROOLPDWLRQ0DQXDO
9HULILHG ;30±

0D[µ5¶2XWSXW )OXRURP$
&KHFNHG ;30±

'RVH ,QSXW'RVH
9HULILFDWLRQ ;30±

,PDJH4XDOLW\ ,PDJH4XDOLW\
(YDOXDWLRQ ;30±

5HVROXWLRQ
;30±

3URFHVVRU 3URFHVVRU±6KHHW)LOP
&KHFN ;30±

3URFHVVRU±&LQH
;30±

63(&±
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS P
REV 16
15 DIRECTION 46–019510
46–019510 5
REV 17 DIRECTION

SPECIALS FLOW DIAGRAM (CONT.)


3KRWRVSRW&DPHUD 3KRWRVSRW5HYLHZ
&KHFNHG ;30±

'5,PDJH5HYLHZ
;30±

&LQH&DPHUD &LQH)LOP5HYLHZ
&KHFNHG ;30±

&LQH3URMHFWRU &LQH3URMHFWRU
&KHFNHG ;30±

'LJLWDO,PDJH ')9DVFXODU,PDJH
(YDOXDWLRQ ;30±

')&DUGLDF,PDJH
;30±

'*';9DVFXODU,PDJH
;30±

'*';&DUGLDF,PDJH
;30±

0DJ7DSH'ULYH
;30±

)LOP)RUPDWWHU *()RUPDWWHU
&KHFNHG ;30±

0,±)RUPDWWHU
;30±

0/DVHU&DPHUD
;30±

5HYLHZ3UHYLRXV
3HUIRUPDQFH

5HWXUQ6\VWHPWR )LQDO&KHFNRXW
1RUPDO2SHUDWLRQ ;30±

'LVFXVV5HVXOWV
ZLWK&XVWRPHU
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY MAINTENANCE
REV 15
16
5(9 DIRECTION 46–019510
',5(&7,21±
REV 17 DIRECTION 46–019510

RAD PORTABLES FLOW DIAGRAM

NOTE: )RU$0;±DQG$0;±UHIHUWRWKH)ORZ'LDJUDPDWWKHHQGRIWKLVVHFWLRQ

Safety and Functional

&KHFN 5$'3RUWDEOH
%UDNH ;30±DQG;30 

&KHFN 5$'3RUWDEOH
%XPSHUV ;30±DQG;30± 

6DIHW\ 5$'3RUWDEOHV
,QVSHFWLRQ ;30±DQG;30± 

6DIHW\±5$'±&ZW±&KDLQ'ULYHV
;30±

,QVSHFW(OHFWULFDO 9LVXDO,QVSHFWLRQ±5$'
&DEOHV ;30±

&OHDQDQG &OHDQDQG/XEULFDWH±5$'
/XEULFDWH ;30±

&KHFN'UDZHU 5$'3RUWDEOH
0RXQW ;30±DQG;30± 

9HULI\0RWRU 5$'3RUWDEOH
'ULYH ;30±DQG;30± 

,QVSHFW:KHHOVDQG 5$'3RUWDEOH
&DVWHUV ;30±DQG;30± 

,QVSHFW 5$'3RUWDEOH
+DQGVZLWFK ;30±DQG;30± 

5$'3257±
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS P
REV 16
15 DIRECTION 46–019510
46–019510 5
REV 17 DIRECTION

RAD PORTABLES FLOW DIAGRAM (CONT.)

NOTE: )RU$0;±DQG$0;±UHIHUWRWKH)ORZ'LDJUDPDWWKHHQGRIWKLVVHFWLRQ

Performance

9HULI\,QGLFDWRUV ,QGLFDWRU/DPSV±5$'
DQG,QWHUORFNV ;30±

&KHFN&ROOLPDWLRQ 0DQXDO&ROOLPDWRUV
DQG/LJKW ;30±

&KHFN 5$'3RUWDEOH
%DWWHULHV ;30±DQG;30± 

&KHFN 5$'3RUWDEOH
*HQHUDWRU ;30±DQG;30± 

.HLWKOH\
;30±

&KHFN 5$'3RUWDEOH
3KRWRWLPHU ;30±DQG;30± 

&RPSDUH'DWD
WR3UHYLRXV'DWD

5HWXUQ6\VWHP )LQDO&KHFNRXW
WR1RUPDO2SHUDWLRQ ;30±

'LVFXVV30
ZLWK&XVWRPHU
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY MAINTENANCE
REV 15
16
5(9 DIRECTION 46–019510
',5(&7,21±
REV 17 DIRECTION 46–019510

RAD PORTABLES AMX–4/AMX–4+ FLOW DIAGRAM

Customer Interview – 5 min 'LVFXVV30


5HFHQWSK\VLFLVWUHSRUWDQGDQ\ ;30±
SUREOHPV

Drive Checkout – 5 min 5$'3RUWDEOH


&KHFNEUDNHVEXPSHUVDQGYHULI\ ;30± 
PRWRUGULYH

Mechanical/Safety – 20 min 9LVXDO,QVSHFWLRQ±5$'


&KHFNHOHFWULFDOFDEOHV ;30±
PHFKDQLFDOFDEOHVZKHHOVFDVWHUV
DQGGUDZPRXQW
5$'3RUWDEOH
;30± 

Battery Checkout – 25 min 5$'3RUWDEOH


&KHFNFRQGLWLRQVRIEDWWHULHV ;30± 
FRQQHFWLRQVIRUWLJKWQHVV
FRUURVLRQDQGZLULQJ

System Checkout – 40 min 5$'3RUWDEOH


&KHFNJHQHUDWRUKDQGVZLWFK ;30± 
FROOLPDWRUOLJKWOLJKWILHOGWR[±UD\
DQGYHULI\LQGLFDWRUVLQWHUORFNV
0DQXDO&ROOLPDWRUV
;30±

,QGLFDWRU/DPSV±5$'
;30±

.HLWKOH\
;30±

Mobile–Aid AEC Test – 5 min 3KRWRWLPHU


;30± 

Restore System –15 min &OHDQDQGOXEULFDWH±5$'


5HLQVWDOOFRYHUVDGMXVWFDEOH ;30±
GUDSHDQGFOHDQOXEULFDWHDV
QHHGHG

Wrap–up – 10 min )LQDO&KHFNRXW


6FKHGXOHUHSDLUWLPHRUGHUSDUWV ;30±
DQGFXVWRPHUVWDWXVUHSRUW

5$'3257±
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS P
REV 16
15 DIRECTION 46–019510
46–019510 5
REV 17 DIRECTION

7+,63$*(,17(17,21$//</()7%/$1.
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY MAINTENANCE
REV 15
16
5(9 DIRECTION 46–019510
',5(&7,21±
REV 17 DIRECTION 46–019510

MOBILE FLUORO FLOW DIAGRAM

Safety and Functional

)XQFWLRQ )OXRUR3RUWDEOH
&KHFN±PLQ ;30± 

6DIHW\±5$'±&ZW±&KDLQ'ULYHV
;30±

9HULI\6NLQ )OXRUR3RUWDEOH
*XDUG±PLQ ;30± 

&KHFN(OHFWULF 9LVXDO,QVSHFWLRQ±5$'
&DEOLQJ±PLQ ;30±

9HULI\*URXQG )OXRUR3RUWDEOH
)DXOW±3RODUL[2QO\ ;30± 

&OHDQDQG &OHDQDQG/XEULFDWH±5$'
/XEULFDWH±PLQ ;30±

Performance

&KHFN,QGLFDWRUV ,QGLFDWRU/DPSV±5$'
DQG,QWHUORFNV±PLQ ;30±

,QGLFDWRU/DPS±5 )
;30±

&KHFN )OXRUR3RUWDEOHV
&ROOLPDWRU±PLQ ;30± 

02%)/±
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS P
REV 16
15 DIRECTION 46–019510
46–019510 5
REV 17 DIRECTION

MOBILE FLUORO FLOW DIAGRAM (CONT.)

&KHFN*HQHUDWRU .HLWKOH\
&DOLEUDWLRQ±PLQ ;30±

)OXRUR3RUWDEOH
;30± 

&KHFN )OXRUR3RUWDEOH
6SRW±)LOP±PLQ ;30± 

&KHFNµ5¶ )OXRURP$
/LPLW±PLQ ;30±

&KHFN)OXRUR ,PDJH4XDOLW\
,PDJLQJ±PLQ ;30±

9HULI\9LGHR )OXRUR3RUWDEOH
6WRUDJH±PLQ ;30± 

&RPSDUH'DWD
WR3UHYLRXV'DWD±PLQ

5HWXUQ6\VWHP )LQDO&KHFNRXW
WR1RUPDO2SHUDWLRQ±PLQ ;30±

'LVFXVV30
ZLWK&XVWRPHU±PLQ
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY MAINTENANCE
REV 15
16
5(9 DIRECTION 46–019510
',5(&7,21±
REV 17 DIRECTION 46–019510

MAMMOGRAPHY FLOW DIAGRAM

Safety/Functional

9HULI\&RXQWHUEDODQFH 6DIHW\±5$'±&ZW
&RQGLWLRQ ;30±

0DPPR
;30± 

6DIHW\±5$'±&ZW±&KDLQ'ULYHV
;30±

&OHDQ &OHDQ /XEULFDWH


/XEULFDWH ;30±

9HULI\6DIHW\DQG 0DPPR
,QWHUORFN6ZLWFKHV ;30± 

,QVSHFW(OHFWULFDO 0DPPR
&DEOHV ;30± 

9HULI\&XUUHQW *URXQG/HDNDJH6XUYH\
/HDNDJH ;30±

9HULI\/HDG*ODVV6KLHOG 0DPPR
&RQGLWLRQ ;30± 

&KHFN7UDQVSRUW0RGLILFDWLRQ 0DPPR
9DQV2QO\ ;30± 

9HULI\/RFN 0DPPR
2SHUDWLRQ ;30± 

&KHFN&ROXPQ 0DPPR
'ULYH ;30± 

9HULI\&RPSUHVVLRQ 0DPPR
2SHUDWLRQ &RQGLWLRQ ;30±  

0$002±
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS P
REV 16
15 DIRECTION 46–019510
46–019510 5
REV 17 DIRECTION

MAMMOGRAPHY FLOW DIAGRAM (CONT.)

&KHFN2SHUDWRU/DPSV 0DPPR
&RQWUROVDQG,QGLFDWRUV ;30± 

&KHFN 0DPPR
%XFN\ ;30± 

Performance

9HULI\&ROOLPDWRU 0DPPR
$OLJQPHQW ;30± 

9HULI\*HQHUDWRU *HQHUDWRU&DOLEUDWLRQ
&DOLEUDWLRQ ;30±

µ5¶2XWSXW
;30±

&KHFN&38195$0%DWWHU\
;30±

9HULI\$(&3HUIRUPDQFH 0DPPR
50,3KDQWRP9LVXDOL]DWLRQ ;30± 

&DOFXODWH$YHUDJH *ODQGXODU'RVH
*ODQGXODU'RVH ;30±

&KHFN)RFDO6SRW6L]H )RFDO6SRW'LPHQVLRQ
RU/LPLWLQJ6SDWLDO5HVROXWLRQ ;30±

9HULI\ 3URFHVVRU±6KHHW)LOP
3URFHVVRU ;30±

)LQDO&KHFN )LQDO&KHFNRXW
'DWDEDVH%DFNXS ;30±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

6$)(7< -RE&DUG;30± RI

MREFDUG VASC SAFETY – COUNTERWEIGHT CABLES – CHAIN DRIVES – ETC.


VXEDVVHPEO\ 9$6&8/$5326,7,21(569$6&8/$5
GDWH
7$%/(6,0$*,1*6863(16,216
SXUSRVH 7RFKHFNFRQGLWLRQDQGDJHRIDOOFRXQWHUZHLJKW
WLPHPLQ
FDEOHV7RFKHFNWHQVLRQRIFKDLQGULYHVDQG
RSHUDWLRQRIDOOVDIHW\GRJVDQGRWKHUFDEOHV

PREREQUISITES
7RROVUHTXLUHG 6RIWFORWK
673RUVLPLODUZHLJKWRLO
7RRONLW

SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRGERUQHSDWKRJHQVSURWHFWLRQZKHQ
LQVSHFWLQJRUUHSDLULQJWKHV\VWHP
TASK DESCRIPTION
%HIRUHVWDUWLQJWKLVMREFDUGPDNHVXUHWKDWDOO30KDVEHHQGRQH
RQWKHSUHYLRXVMREFDUGV7KLVMREFDUGDGGVWR;30±DQG;30±DQGGRHV
QRWUHSODFHWKHP

Procedure:
UHIHUWR;30±IRUGHWDLOVLIQHHGHG 
&KHFNWKHFRXQWHUZHLJKWFDEOHVLQWKHSRVLWLRQHUV/8$/8&
;±UD\7XEH
,PDJH,QWHQVLILHU
)LOP&KDQJHU
&KHFNDOOFKDLQVDQGGULYHEHOWV

±
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

GENERAL, SAFETY AND FUNCTIONAL


TABLE OF CONTENTS

JOB CARD TITLE PAGE

;30± 5(9,(:6,7(/2*',6&86630:,7+&86720(5  ±


6,7(/2*  ±
6(59,&(/2*  ±
;30± 5(7851$1'5(9,(:  ±
;30± 5$'6$)(7<±&2817(5:(,*+7&$%/(6±
&+$,1'5,9(6±(7&  ±
;30± 5 )6$)(7<±&2817(5:(,*+7&$%/(6±
&+$,1'5,9(6±(7&  ±
;30± 9$6&6$)(7<±&2817(5:(,*+7&$%/(6±
&+$,1'5,9(6±(7&  ±
;30± 0(&+$1,&$/  ±
;30± 6$)(7<±*$66+2&.6  ±
;30± 5$'02817,1*%2/76  ±
;30± 5 )02817,1*%2/76  ±
;30± 9$6&02817,1*%2/76  ±
;30± 6$)(7<±$&&(6625,(6  ±
;30± 5$'9,68$/,163(&7,21  ±
;30± 5 )9,68$/,163(&7,21  ±
;30± 9$6&9,68$/,163(&7,21  ±
;30± 5$'&/($1$1'/8%5,&$7(  ±
;30± 5 )&/($1$1'/8%5,&$7(  ±
;30± 9$6&&/($1$1'/8%5,&$7(  ±
;30± 5$')81&7,21$/&+(&.  ±
;30± 5 ))81&7,21$/&+(&.  ±
;30± 5 ))81&7,21$/&+(&.6±5(027(7$%/(6  ±
;30± 9$6&8/$5)81&7,21$/&+(&.  ±

±L
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

GENERAL, SAFETY AND FUNCTIONAL


TABLE OF CONTENTS (CONT.)

JOB CARD TITLE PAGE

;30± '(',&$7('72027$%/(6  ±


;30± 7202237,21  ±
;30± )81&7,21$/&+(&.  ±
;30± 5$',1',&$725/$036$1',17(5/2&.6  ±
;30± 5 ),1',&$725/$036$1',17(5/2&.6  ±
;30± 9$6&,1',&$725/$036$1',17(5/2&.6  ±

±LL
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

6,7(/2*',6&86630 -RE&DUG;30± RI

MREFDUG REVIEW SITE LOG/DISCUSS PM WITH CUSTOMER

VXEDVVHPEO\ GDWH

SXUSRVH 5HYLHZ6LWH/RJ'LVFXVV30ZLWKFXVWRPHU WLPH


5HFRUGLQLWLDOVHWWLQJV

PREREQUISITES

TASK DESCRIPTION

7KHSXUSRVHRIWKHVLWHORJLVWRSURYLGHDQDFWLYHKLVWRU\RIWKHURRP¶VSHUIRUPDQFH7KLVZLOO
EHHVSHFLDOO\HIIHFWLYHZKHQDQHQJLQHHURWKHUWKDQWKHVLWHHQJLQHHUZRUNVRQWKH
HTXLSPHQW,WLVDOVRDQDLGIRUWKHVLWHHQJLQHHUWRGHWHFWLQWHUPLWWHQWSUREOHPV7KLV
ZLOODLGLQFRPPXQLFDWLRQEHWZHHQWKHHQJLQHHUDQGWKHFXVWRPHU

5HYLHZWKHSHUIRUPDQFHRIWKHURRP,IWKHUHDUHPDMRUSUREOHPVZLWKWKHURRPWKH30PD\
KDYHWREHSRVWSRQHGXQWLOWKHURRPLVLQJRRGIXQFWLRQDOFRQGLWLRQ'LVFXVVZLWKWKH
FXVWRPHUVFKHGXOLQJRIWKHURRPIRUWKH30DQGLIDQ\VSHFLDOFRQVLGHUDWLRQVIRU
SDWLHQWQHHGVDQGRUKRXVHNHHSLQJQHHGWREHWDNHQ

'LVFXVVWKHREMHFWLYHVRIWKH30ZLWKWKHFXVWRPHU5HVWDWHLIQHFHVVDU\WKDWZHDUHLQ
VSHFWLQJQRWIL[LQJWKHHTXLSPHQWDWWKLVWLPH

5HFRUGLQLWLDOVHWWLQJVRIWKHHTXLSPHQWRQWKHGDWDVKHHW7KLVZLOOEHXVHIXOIRUWKHHQJLQHHU
WRUHWXUQWKHHTXLSPHQWWRWKHFXVWRPHU¶VQRUPDORSHUDWLQJPRGH

&KHFNODVW30QRWHVIRUGDWHRIWKHODVW307KLVZLOOEHKHOSIXOLQGHWHUPLQLQJZKLFK
VFKHGXOHVZLOOEHXVHGIRUWKHFXUUHQW30

(VWDEOLVKHGVDIHW\SURFHGXUHVVXFKDVSUHFDXWLRQVIRU%ORRGERUQH3DWKRJHQV(OHFWULFDO
DQG0HFKDQLFDO(QHUJ\/RFNRXWDQGOLIWLQJVDIHW\MUSTEHIROORZHGZKHQ
SHUIRUPLQJ30V

±
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

SITE LOG

+263,7$/1$0(

5220180%(5

6<67(0,'180%(5

&2175$&7 -<(6 -12


&29(5$*(7<3( BBBBB/$%25 BBBBB3$576 BBBBB*/$66
+2856

6<67(0'(6&5,37,21

±
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

SERVICE LOG

6<67(0,'

CUSTOMER NOTES SERVICE NOTES


DATE: TIME: DATE: TIME:
TECH: SERVICE ENG:
ERROR CODE:

DATE: TIME: DATE: TIME:


TECH: SERVICE ENG:
ERROR CODE:

DATE: TIME: DATE: TIME:


TECH: SERVICE ENG:
ERROR CODE:

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

),1$/&+(&. -RE&DUG;30± RI

MREFDUG RETURN AND REVIEW

VXEDVVHPEO\ ),1$/&+(&.287 GDWH

SXUSRVH &RPSDUHGDWDWR30GDWD5HWXUQV\VWHPWR WLPH


RSHUDWLRQDOPRGH'LVFXVV30ZLWKWKHFXVWRPHU

PREREQUISITES

TASK DESCRIPTION

&RPSDUHWKHGDWDFRPSLOHGZLWKWKHSUHYLRXV30GDWD,IDQ\GLVFUHSDQFLHVDUHQRWHG
FKHFNWKHDSSURSULDWHER[IRUZRUNWREHVFKHGXOHGDWDODWHUGDWH0DNHDQRWHRI
SDUWVWREHRUGHUHG

&KHFNWKHHUURUORJVLQWKHV\VWHPIRULQGLFDWLRQRISUREOHPVDQGFKHFNIRUWXEHZDUPXS
E\SDVVHV'LVFXVVDQ\LVVXHVZLWKWKHFXVWRPHUWKDWPD\LPSDFWV\VWHP
SHUIRUPDQFH

3HUIRUPDGDWDEDVHEDFNXS LIDSSOLFDEOH 

5HWXUQWKHV\VWHPWRLWVRULJLQDORSHUDWLQJPRGH

'LVFXVVVFKHGXOLQJRIZRUNUHTXLUHGZLWKWKHFXVWRPHU'LVFXVVSHUWLQHQWSUREOHPVZKLFK
PD\UHTXLUHLPPHGLDWHVHUYLFHDQGWKRVHZKLFKFDQEHVFKHGXOHGODWHU/HDYHWKH
FXVWRPHUFRS\RIWKHFKHFNOLVWZLWKKLPDQGDFRS\RIWKHFKHFNOLVWZLWKWKHVLWHORJ
8SGDWHWKHVLWHORJLQIRUPDWLRQUHODWLQJWRWKH30

$FRPSOHWHGQHZFHUWLILFDWHRILQVSHFWLRQPD\EHGHOLYHUHGWRWKHFXVWRPHU7KLVQHZ
FHUWLILFDWHFDQEHRUGHUHGE\)RUP1XPEHU); LIUHTXLUHG 

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION


6$)(7< -RE&DUG;30± RI

MREFDUG RAD SAFETY – COUNTERWEIGHT – DRIVES – ETC.


VXEDVVHPEO\ 7$%/(6, &+(6767$1'678%(67$1'6
GDWH
+$1*(5672026<60$0026<6
SXUSRVH 7RFKHFNFRQGLWLRQDQGDJHRIDOOFRXQWHUZHLJKW WLPHKRXU
FDEOHVEHOWVDQGJDVSLVWRQV7RFKHFNWHQVLRQRI
FKDLQGULYHVDQGRSHUDWLRQRIDOOVDIHW\GRJVDQG
RWKHUFDEOHV

PREREQUISITES
7RROVUHTXLUHG 6RIWFORWK
673RUVLPLODUZHLJKWRLO
7RRONLW
SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRG±ERUQSDWKRJHQVSURWHFWLRQZKHQLQVSHFWLQJ
RUUHSDLULQJWKHV\VWHP
TASK DESCRIPTION
Procedure:
&KHFNFRQGLWLRQRIDOOFRXQWHUSRLVHDQGFRXQWHUZHLJKWFDEOHVDQGEHOWV
9LVXDOO\LQVSHFWFDEOHVDQGEHOWVIRUVLJQVRIGHWHULRUDWLRQ LHNLQNLQJIUD\LQJ
FUDFNLQJZRUQRUPLVVLQJWHHWKHWF
5XQVRIWFORWKDORQJOHQJWKRIFDEOHVWRGHWHFWDQ\EURNHQZLUHV
NOTE: )RUPRUHLQIRUPDWLRQUHJDUGLQJWKHFKHFNLQJRIFRXQWHUZHLJKWFDEOHVVHH6HUYLFH
1RWH
CAUTION: At the first signs of deterioration, replacement of counterweight and/or
safety cables should be scheduled.
&KHFNWLPHLQWHUYDOVIRUPDQGDWRU\UHSODFHPHQWRIFRXQWHUSRLVHFRPSRQHQWVIRU\RXU
VSHFLILF HTXLSPHQW

)RUD6FKHGXOHRI0DQGDWRU\5HSODFHPHQWUHIHUWR&KDUW RUWR2(0VHUYLFH
GRFXPHQWDWLRQLIDSSOLFDEOH 
NOTE: ,IFDEOHUHSODFHPHQWLVUHTXLUHGVFKHGXOHWLPHIRULWWREHGRQHDWDODWHUGDWH$OVR
FKHFNWLPHLQWHUYDOVIRU\RXUVSHFLILFHTXLSPHQW6RPHVHUYLFHQRWHVZLWKUHSODFHPHQW
SURFHGXUHVDUHFRQWDLQHGLQFKDSWHURIWKLVPDQXDO

7KHSDUWQXPEHUIRUWKHVWLFNHURQWKHEDFNRIWKHKDQJHUVLVDVIROORZV
+DQJHUV ±3
;7+DQGHUV ±3
,IFXVWRPHUUHIXVHVUHSODFHPHQWRIWKHFDEOHVRUVSULQJDVVHPEO\GRFXPHQWRQDGLVSDWFK
DQGQRWLI\\RXU$UHD6HUYLFH0DQDJHUDVVRRQDVSRVVLEOH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD SAFETY – COUNTERWEIGHT –


DRIVES – ETC.
-RE&DUG;30± RI

Chart 1
Part Replacement Cycle
Number (years)
AMX–110
&RXQWHUZHLJKW&DEOH ±3 
&RXQWHUZHLJKW&DEOH ±3 

AMX–2
&RXQWHUZHLJKW&DEOH ±3 
&RXQWHUZHLJKW&DEOH ±3 

AMX–3
&RXQWHUZHLJKW&DEOH ±3 
&RXQWHUZHLJKW&DEOH ±3 

AMX–4
&RXQWHUZHLJKW&DEOH ±3 
&RXQWHUZHLJKW&DEOH ±3 

Compax I–I/T and 40E


1RUHTXLUHPHQWV

Diamentor
,RQFKDPEHUPDWFKLQJFDO UHIHUWRPDQXDO±-RE&DUG&$/ 

DLX (no required replacement)


%DWWHU\NLW  ([SHFWHGOLIH\HDUV
UHIHUHQFH30GRFXPHQW

DRI
0HPRU\EDWWHU\ ± RU7$',5$17 

Fuji FCR AC–3 (reader)


6XFWLRQ&XS   
6XFWLRQ3XPS  
(UDVXUH/DPSV   
&OHDQLQJ5ROOHU  

Fuji FCR 9000/C (reader)


6XFWLRQ&XSV   
6XFWLRQ3XPS  
(UDVXUH/DPS   
%UXVK5ROOHU  
%UXVK5ROOHU  
,I0$)LVXVHG
6XFWLRQ&XSV   
6XFWLRQ&XSV  1 

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD SAFETY – COUNTERWEIGHT –


DRIVES – ETC.
-RE&DUG;30± RI

Chart 1 (Cont.)
Part Replacement Cycle
Number (years)
Fuji CR–LP D/FL–IMD (Laser Imager)
6XFWLRQ&XSV  ) 
6XFWLRQ3XPS < 

Program X
%DWWHU\  
RUUHSODFHLIYROWDJHIDOOVEHORZ9

Senographe500T/TS/CPM and 600T/TS


6XVSHQVLRQ&DEOH & 
6KDIW  
3XOOH\ & 
&LUFOLSV PPH[W'LD  
&DVLQJ  
6FUHZ 670[  
5HOHDVH5ROOHUV XVHG  
6SULQJ  

Senographe DMR
&RPSUHVVLRQ0RWRU%HOW 
&RPSUHVVLRQ$UP'ULYH%HOW 
&ROXPQ(OHYDWRU*DV3LVWRQ 
'LDJQRVWLF±\HDUVRUH[SRVXUHV6FUHHQLQJ±PRQWKVRUH[SRVXUHV

Senographe 700T/800T
&RPSUHVVLRQ$UP'ULYH%HOW  

Senix HF 500T/TS and 600T/FD


6XVSHQVLRQ&DEOH XVHG  
5HOHDVH5ROOHUV XVHG  
)LOWHU & 
%DWWHU\  
&HQWHULQJ/LJKW  
&DEOH$VVHPEO\ & 
'LRGHV IRUWULSK±XVHG  
5HOD\3ODWH  

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD SAFETY – COUNTERWEIGHT –


DRIVES – ETC.
-RE&DUG;30± RI

Chart 1 (Cont.)
Part Replacement Cycle
Number (years)
Senix 500T ET and 600T Triphase
6XVSHQVLRQ&DEOH & 
6KDIW  
3XOOH\ & 
)ODW:DVKHU  
&LUFOLS PPH[WQGLD  
+RXVLQJ  
+HDGOHVV6FUHZ P[  
5HOHDVH5ROOHUV XVHG  
5HVVRUW  
)LOWHU & 
%DWWHU\  
&HQWHULQJ/LJKW  
&DEOH$VVHPEO\ & 
'LRGHV IRUWULSK±XVHG  
5HOD\3ODWH  

SenoVision
1R5HTXLUHPHQWV

Silhouette 20S
&RXQWHUZHLJKWFDEOHNLW ±± 
UHIHUHQFHVHUYLFHPDQXDO±

Silhouette HF
1R5HTXLUHPHQWV UHIHUHQFHVHUYLFHPDQXDO±

Stenoscop 6000 & 9000


%DWWHU\  

StereoTix
1R5HTXLUHPHQWV

TomoLink
1R5HTXLUHPHQWV

48–4 Hangers
6SULQJDQG'UXP$VP ±$ ±* 
6SULQJDQG'UXP$VP ±% & ±* 
6DIHW\$VP ±* 
,GOHU$VP ±* 
&RXQWHUZHLJKW&DEOH ±3 
&RXQWHUZHLJKW&DEOH ±3 
&RXQWHUZHLJKW&DEOH ±3 

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD SAFETY – COUNTERWEIGHT –


DRIVES – ETC.
-RE&DUG;30± RI

Chart 1 (Cont.)
Part Replacement Cycle
Number (years)
48–5 Hanger
6SULQJDQG'UXP$VP 7& 
6DIHW\'HYLFH6SULQJ ±3 
0DLQ&RXQWHUZHLJKW&DEOH ±3 
6DIHW\&RXQWHUZHLJKW&DEOH ±3 

XT RAD and Fluoro Suspension

6SULQJDQG'UXP$VP 7' 
6DIHW\$VP ROGVW\OH ±* 
6DIHW\$VP QHZVW\OH ±* 
0DLQ&DEOH.LW ±3 

XT Vascular Suspension
6SULQJDQG'UXP$VP 7' 
6DIHW\$VP ±* 
0DLQ&DEOH.LW ±3 

CGR Suspension 3  61$


&DEOH)LWWLQJV XVHG & 
&LUFOLSVH[W'7\SH XVHG  
9[&RWWHU3LQ XVHG  
)KF6FUHZ0[ XVHG  
Column Cables 2160537 9
Drum Tensioner (8kg spool ass.) C165780 3
Drum Tensioner (3kg spool ass.) C166241 3
Reference Maintainence ASM # 2164694-100 and PM Supplement # 2201990-100

CGR Suspension 6
*DV6SULQJV 61  
&RXQWHUZHLJKW&DEOHV.LW 61  

65 Tube Stand
&DEOHV XVHG 3 

80 Tube Stand
%DODQFH6SULQJ$VP ±* 

S1U Tube Stand (Compact 500)


&DEOHDQG3XOOH\V  

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD SAFETY – COUNTERWEIGHT –


DRIVES – ETC.
-RE&DUG;30± RI

Chart 1 (Cont.)
Part Replacement Cycle
Number (years)
Telegem 90 QRUHTXLUHGUHSODFHPHQW
0DLQ&RXQWHUZHLJKW&DEOH ±3
0DLQ&RXQWHUZHLJKW&DEOH ±3
,,&RXQWHUZHLJKW&DEOH ±3
,,&RXQWHUZHLJKW&DEOH ±3

Televix 2 (serial no. 11700/1 thru 11710/3) and


Televix 3 (10170/1 thru 11003 manuf Apr.18,74 thru Jan.76) 6HH61
$QJXODWLRQ&KDLQ PPSLWFK 3 
&ORVLQJOLQN 3 
3LQLRQ LIUHTXLUHG 3

Tilt–C

1RPDQGDWRU\FRPSRQHQWUHSODFHPHQWEXWDGGLWLRQDOPHFKDQLFDOFKHFNVDUH
UHTXLUHGDGGLQJDERXWKRXUVWRWKH30HYHU\\HDUV 
5HIHUWRGLUHFWLRQ±

EP Table
1RUHTXLUHPHQWV

Televix 2 (serial no. 1170/4 manuf on or after Jan.23,76)


Televix 3 (serial no. 11004/1 manuf. on or after Jan.26,76) 6HH61
$QJXODWLRQ&KDLQ PPSLWFK 3 
&ORVLQJ/LQN 3 
3LQLRQ LIUHTXLUHG 3

Futuralix 10/11/12
7LOW&KDLQ & 
7LOW4XLFN±UHOHDVH/LQN  
7LOW%HOW XVHG & 
&DUULDJH%HOW & 
&ROXPQ%HOW XVHG & 
/RQJ7DEOHWRS'RXEOH&KDLQ & 
/RQJ7DEOHWRS7HQVLRQ3LQLRQ & 
/RQJ7DEOHWRS5HGXFWLRQ3LQLRQ & 
/RQJ7DEOHWRS4XLFN±UHOHDVH/LQN XVHG  

Futuralix 20
7LOW%HOW SDLU & 
7LOW&KDLQ & 
7LOW4XLFN±UHOHDVH/LQN  
&DUULDJH%HOW XVHG & 
&ROXPQ%HOW SDLU & 

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD SAFETY – COUNTERWEIGHT –


DRIVES – ETC.
-RE&DUG;30± RI

Chart 1 (Cont.)
Part Replacement Cycle
Number (years)
Futuralix 20 (cont.)
/RQJ7DEOHWRS'RXEOH&KDLQ & 
/RQJ7DEOHWRS7HQVLRQ3LQLRQ & 
/RQJ7DEOHWRS5HGXFWLRQ3LQLRQ & 
/RQJ7DEOHWRS4XLFN±UHOHDVH/LQN XVHG  
/RQJ7DEOHWRS%HOW XVHG & 

Futuralix 90
7LOW%HOW SDLU & 
&DUULDJH%HOW & 
&ROXPQ%HOW SDLU & 
/RQJ7DEOHWRS'RXEOH&KDLQ & 
/RQJ7DEOHWRS7HQVLRQ3LQLRQ & 
/RQJ7DEOHWRS5HGXFWLRQ3LQLRQ & 
/RQJ7DEOHWRS4XLFN±UHOHDVH/LQN XVHG  
/RQJ7DEOHWRS%HOW XVHG & 

Futuralix 1500
7LOW%UDNH±WHQVLRQHU & 
7LOWHU 6HHQRWH  
&DUULDJH%HOW & 
&DUULDJH&KDLQ & 
&DUULDJHTXLFN±UHOHDVH/LQN XVHG & 
&ROXPQ%HOW XVHG & 
6,'0RWRU%HOW  
/RQJ7DEOHWRS%UDNH  
/RQJ7DEOHWRS5ROOHU & 
/RQJ7DEOHWRS5LQJ  
/RQJ7DEOHWRS%XVK  
/RQJ7DEOHWRS'RXEOH&KDLQ OLQNV & 
/RQJ7DEOHWRS'RXEOH&KDLQ OLQNV & 
/RQJ7DEOHWRS4XLFN±UHOHDVH/LQN XVHG  
NOTE: )RUV\VWHPVWKDWKDYH127EHHQXSJUDGHGWRWKHFRUUHFWHGWRRWKLQJWLOWHUWKHIROORZLQJ
LWHPVZLOOEHQHHGHG VHH61 
6HUYR3RW*HDU &
5HVLVWRU 5RQ%RDUG6±NRKPLQVWHDGRINRKP 
5HVLVWRU 5RQ%RDUG6±RKPLQVWHDGRIRKP 
5HVLVWRU 5RQ%RDUG6±NRKPLQVWHDGRINRKP 
&KHFN5HVLVWRU5LVNRKP %RDUG6±
7RRO.LW H[WHQGHUEGDQGPPIODWZUHQFK 
7ZRIODWPPZUHQFKHV &
7ZRPPKLJKVWDQGV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD SAFETY – COUNTERWEIGHT –


DRIVES – ETC.
-RE&DUG;30± RI

Chart 1 (Cont.)
Part Replacement Cycle
Number (years)
Power Pax
1RUHTXLUHPHQWV

Prestilix 110/150/150ANGIO
7LOW4XLFN±UHOHDVH/LQN XVHG & 
7LOW&KDLQ & 
7LOW5ROOHU XVHG & 
7LOW$QWLIULFWLRQULQJIRUUROOHU XVHG & 
7LOW%HOW & 
&DUULDJH%HOW & 
6,'%HOW H[FHSW37;  XVHG & 
)XOFUXP%HOW  
/RQJ7DEOHWRS%HOW  
/RQJ7DEOHWRSFKDLQ & 
/RQJ7DEOHWRS4XLFN±UHOHDVH/LQN XVHG & 

Prestilix 1690/1690S/1694
7LOW%HOW SDLU 3 
&DUULDJH%HOW VHWRI 3 
&ROXPQ%HOW 3 

Prestilix 1600/Televix 1600/Futuralix 1600 (Counterweight) (see SN 4336)


7LOW'RXEOH/LQN&KDLQ XVHG 3 
7LOW&XUYHG/LQN&KDLQ 3 
7LOW'RXEOH5ROOHU&KDLQ 3 
7LOW%HOW XVHGZLWKFRXQWHUZHLJKWFDEOHV 3 
7LOW%HOW XVHGZLWKRXWFRXQWHUZHLJKWFDEOHV 3 
6HOHFWRU&KDLQ 6SDQLVKWDEOHV 3 
6HOHFWRU&KDLQ %HOJLDQWDEOHV 3 
6HOHFWRU4XLFN±UHOHDVH XVHG  
&DUULDJH%HOW 3 
&ROXPQ%HOW OHQJWK  3 
&ROXPQ%HOW OHQJWK± 3 
&ROXPQ%HOW OHQJWK± 3 
3RZHU5HOD\ . 3 
3RZHU5HOD\ . 3 
3RZHU$X[%ORFN 3 
)RRWUHVW  
)RRWUHVWFRQWUROWRRO  
&RXQWHUZHLJKWUROOHUV  

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD SAFETY – COUNTERWEIGHT –


DRIVES – ETC.
-RE&DUG;30± RI

Chart 1 (Cont.)
Part Replacement Cycle
Number (years)
Prestilix 1600 AV
7LOW'RXEOH/LQN&KDLQ XVHG 3 
7LOW&XUYHG/LQN&KDLQ 3 
7LOW'RXEOH5ROOHU&KDLQ 3 
7LOW%HOW XVHG 3 
6HOHFWRU%HOW 3 
&ROXPQ%HOW 3 
3RZHU5HOD\ . 3 
3RZHU$X[%ORFN 3 
)RRWUHVWNLW  

Prestilix 1600 X–E


7LOW%HOW XVHG 3 
6HOHFWRU%HOW 3 
&ROXPQ%HOW 3 
3RZHU5HOD\ N 3 
3RZHU$X[%ORFN 3 
)RRWUHVWNLW  

Prestige SI
,QWHJUDWHGFRQVROHEDWWHU\ " 

Prestige VH
,QWHJUDWHGFRQVROHEDWWHU\ " 

Monitrol 15
&RXQWHUZHLJKW&DEOH 3 
&RXQWHUZHLJKW&DEOH 3 
&RXQWHUZHLJKW&DEOH 3 
&RXQWHUZHLJKW&DEOH 3 
&RXQWHUZHLJKW&DEOH 3 
&RXQWHUZHLJKW&DEOH 3 
&RXQWHUZHLJKW&DEOH $3 

Monitrol 90
&RXQWHUZHLJKW&DEOH XVHG $3 
&RXQWHUZHLJKW&DEOH XVHG 3 
&RXQWHUZHLJKW&DEOH ±3 
&RXQWHUZHLJKW&DEOH $3 
&RXQWHUZHLJKW&DEOH 3 
&RXQWHUZHLJKW&DEOH 3 
&RXQWHUZHLJKW&DEOH 3 
&RXQWHUZHLJKW&DEOH 3 

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD SAFETY – COUNTERWEIGHT –


DRIVES – ETC.
-RE&DUG;30± RI

Chart 1 (Cont.)
Part Replacement Cycle
Number (years)
MPG (console)
%DWWHU\  
RUUHSODFHLIYROWDJHIDOOVEHORZY

MPH (console)
%DWWHU\  
RUUHSODFHLIYROWDJHIDOOVEHORZY

RFX
&DUULDJH&RXQWHUZHLJKW&DEOH ±3 
&DUULDJH&RXQWHUZHLJKW&DEOHV XVHG  
0DLQ&RXQWHUZHLJKW&DEOH ±3 
0DLQ&RXQWHUZHLJKW&DEOH  
0DLQ&RXQWHUZHLJKW&DEOH ±3 
0DLQ&RXQWHUZHLJKW&DEOH ±3 
6)'0DLQ&DEOH ± 
UHIHUHQFH30PDQXDO±

M–200 Table
%HOWV XVHG  
*DV6SULQJ  
3RO\XUHWKDQH%HDULQJV XVHG  
3RO\XUHWKDQH5ROOHUV XVHG & 
3RO\XUHWKDQH5ROOHUV XVHG & 
3URWHFWLRQ6WULSV XVHG & 
3URWHFWLRQ3LQV XVHG & 

M–200 Table (cont.)


3URWHFWLRQ6SULQJV XVHG & 
3URWHFWLRQ5ROOHUV XVHG & 
(OHFWULF-DFN  

AFM
(OHYDWRU%HOW  

L/U–A, L/U–C, LC, LC/LP


1R5HTXLUHPHQWV

LCA, LCV+, LCN+


&±$5&JHDUER[  
,,(OHYDWRUJHDUER[ FP  7) 
,,(OHYDWRUJHDUER[ FP  

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD SAFETY – COUNTERWEIGHT –


DRIVES – ETC.
-RE&DUG;30± RI

Chart 1 (Cont.)
Part Replacement Cycle
Number (years)
Legacy
&DUULDJH&RXQWHUZHLJKW&DEOH ±3 
&DUULDJH&RXQWHUZHLJKW&DEOHV XVHG  
0DLQ&RXQWHUZHLJKW&DEOH ±3 
0DLQ&RXQWHUZHLJKW&DEOH  
0DLQ&RXQWHUZHLJKW&DEOH ±3 
0DLQ&RXQWHUZHLJKW&DEOH ±3 
6)'0DLQ&DEOH ± 
UHIHUHQFH30PDQXDO±

LP3
1R5HTXLUHPHQWV

Omega Tables
1R5HTXLUHPHQWV

VMX DQGVMX+
%DWWHU\ &38  
*DV6SULQJV.LW VHWRI  
&DSDFLWRU7DQN  
%RRVWHU7DQN  
5HOD\;  
5HOD\;  
5HOD\; ;  
5HOD\;  
5HOD\;  

Monitrol Booms QRUHTXLUHGUHSODFHPHQW


9HULI\&ODP6KHOOLVSUHVHQW

SEP–90
%DWWHU\ (6 

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD SAFETY – COUNTERWEIGHT –


DRIVES – ETC.
-RE&DUG;30± RI

All Systems
&KHFNWKHQHJDWRURQV\VWHPVLISUHVHQW
&KHFNDOOVDIHW\GHYLFHVDVVRFLDWHGZLWKWKHFDEOHV
VDIHW\RQKDQJHU
VDIHW\GRJRQWDEOH
P\HORJUDSKLFVWRSV
&KHFNDOLJQPHQWRIWKHSXOOH\VDQGIRUZHDUDQGWHDU
0DNHVXUHFDEOHVFDQQRWHVFDSHSXOOH\JXDUGVDQGGRQRWUXEDVWKHFDEOHVOHDYH
WKHSXOOH\
&KHFNIRUH[FHVVLYHZHDURQFRXQWHUSRLVHWDNH±XSGUXPV 6RPHROGHUV\VWHPVVXFKDV
± 6±KDYHSRRUIOHHWDQJOHVE\GHVLJQDQGUXE1RDGMXVWPHQWLVSRVVLEOH
&KHFNIRU±IFOHDUDQFHEHWZHHQWKHGUXPFDEOHJXDUGDQGWKHFDEOHVRQWKH
VWUDLJKWGUXP5HDGMXVWWKHJXDUGLIQHFHVVDU\
&KHFNFDEOHWHUPLQDWLRQSRLQWVIRUUXVWDQGWLJKWQHVV5HSODFHLIUXVWLVIRXQG
&KHFNEHOWWHUPLQDWLRQLQWHJULW\
&KHFNFKDLQGULYHVRQWDEOHVJHQHUDWRUV &*5N9SGULYHRQFSJDQGFRPSUHVVLRQFKDLQV
RQ,ELVWDEOHV 
&KHFNFKDLQWHQVLRQV±LISURSHUFKDLQWHQVLRQLVTXHVWLRQDEOHUHIHUWRVHUYLFHPDQXDOIRU
VSHFLILFHTXLSPHQWDQGRUGHIHUVHUYLFHWRODWHUGDWH 6HH6HUYLFH1RWHIRU
5);6);6HFWLRQ
9LVXDOO\LQVSHFWJDVFRXQWHUEDODQFHSLVWRQVIRUVLJQVRIOHDNDJH
&KHFNLQWHJULW\RIPDVWHUOLQNVDQGDWWDFKPHQWOLQNV
&KHFNWRUTXHZDVKHUVRQ&*5WDEOHVDOVR
&KHFNVDIHW\GHYLFHRQYHUWLFDOEXFN\VWDQGDQGFKDQJH[
&KHFNDGMXVWPHQWRIVDIHW\PHFKDQLVPRQ±KDQJHUVZLWKIROORZLQJDFWXDWLRQWHVW
D %RXQFHRIIERWWRPHQGVWRS±VDIHW\VKRXOGHQJDJHDQGUDWFKHW LI
DSSOLFDEOH 
E 5HOHDVHVDIHW\ LIDSSOLFDEOH 
F %RXQFHRIIWRSHQGVWRS±VDIHW\VKRXOG127HQJDJH LIDSSOLFDEOH 
,QVSHFWFRQGLWLRQRIWDEOHWRSDQGDQJXODWLRQGULYHEHOWV
&KHFNIRU6,'SRWJHDUPHVKDQGEHOWFRQGLWLRQRQDOOKDQJHUV LIDSSOLFDEOH 

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

6$)(7< -RE&DUG;30± RI

MREFDUG R&F SAFETY – COUNTERWEIGHT CABLES – CHAIN DRIVES – ETC.

VXEDVVHPEO\ 5 )6<67(06 GDWH

SXUSRVH 7RFKHFNFRQGLWLRQDQGDJHRIDOOFRXQWHUZHLJKW
WLPHPLQ
FDEOHV7RFKHFNWHQVLRQRIFKDLQGULYHVDQG
RSHUDWLRQRIDOOVDIHW\GRJVDQGRWKHUFDEOHV

PREREQUISITES
7RROVUHTXLUHG 6RIWFORWK
673RUVLPLODUZHLJKWRLO
7RRONLW

SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRGERUQHSDWKRJHQVSURWHFWLRQZKHQ
LQVSHFWLQJRUUHSDLULQJWKHV\VWHP
TASK DESCRIPTION
%HIRUHVWDUWLQJWKLVMREFDUGPDNHVXUHWKDWDOO30KDVEHHQGRQHRQWKHSUHYLRXVMREFDUG
7KLVMREFDUGDGGVWR;30±DQGGRHVQRWUHSODFHLW

Procedure:
&KHFNWKHFRQGLWLRQRIWKHFRXQWHUZHLJKWFDEOHV UHIHUWR;30±IRUGHWDLOVLIQHHGHG 
&KHFNDQ\VDIHW\GHYLFHVFRQQHFWHGZLWKWKHIOXRURKDQJHULIDSSOLFDEOH
&KHFNDOLJQPHQWRIWKHSXOOH\VIRUZHDUDQGWHDU
&KHFNFDEOHWHUPLQDWLRQSRLQWVIRUUXVWDQGWLJKWQHVV
5HSODFHLIUXVWLVIRXQG
&KHFNFKDLQGULYHWHQVLRQIRUSRZHUDVVLVW
&KHFNFRQGLWLRQRIEHOWVDQGRUVSULQJVLQWKHVSRW±ILOPGHYLFH
&KHFNFRQGLWLRQRIJHDUVDVVRFLDWHGZLWKWKHVHEHOWVDOVR
&KHFN79PRQLWRUDQGFRQVROHFDUWVLISUHVHQW

±
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

HV CABLE BRAID 1/1 XPM-106


job card: MECHANICAL
subassembly: HV Cables date: 05/01/95
purpose: Verify continuity of HV cable braid time: 15 min.
PREREQUISITES
7RROVUHTXLUHG 0XOWLPHWHU
7RRONLW

SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRGERUQHSDWKRJHQVSURWHFWLRQZKHQ
LQVSHFWLQJRUUHSDLULQJWKHV\VWHP

TASK DESCRIPTION
NOTE:7KLVWHVWLVUHTXLUHGIRUDOOQRQ±OLQHIUHTXHQF\V\VWHPV

7XUQRIIDOOSRZHUDQGORFNRXWV\VWHP
5HPRYHDKLJKYROWDJHFDEOHDWWKHWXEHHQGDQGGLVFKDUJHFDEOHSLQVWRJURXQG
&RQHFWWKHPXOWLPHWHUIURPWKHFDEOHVKLHOGWRDFRPPRQJURXQGSRLRQW
7KHUHVLVWDQFHVKRXOGEHOHVVWKDQRKPV
,IWKHUHVLVWDQFHLVWRRKLJKYHULI\\RXUJURXQGSRLQWDQGWKDWWKH+9WUDQVIRUPHULV
JURXQGHG,IWKHUHVLVWDQFHLVVWLOOWRRKLJKYHULI\WKDWWKHSUREOHPLVWKH+9FDEOH
5HSODFHPHQWRIWKH+9FDEOHZLOOEHQHHGHG

1-18
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

SAFETY 1/1 XPM-108


job card: SAFETY - GAS SHOCKS
subassembly: POSITIONER WITH GAS SHOCKS date: 11/98
purpose: To check condition or gas shocks. time: 15 min.
PREREQUISITES
7RROVUHTXLUHG 6RIWFORWK
7RRONLW

SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRGERUQHSDWKRJHQVSURWHFWLRQZKHQ
LQVSHFWLQJRUUHSDLULQJWKHV\VWHP
*DVVKRFNVDUHXQGHUSUHVVXUHDQGFDQEH9(5<GDQJHURXVZKHQGLVFRQQHFWHG8VH
SURSHUSURFHGXUHVLIUHSODFLQJDQGXVHFDXWLRQGXULQJLQVSHFWLRQV
TASK DESCRIPTION
&KHFNWUDYHORIPRYHPHQWLQYROYLQJWKHFRXQWHUZHLJKWLQJE\JDVVKRFNV(DVHRI
PRYHPHQWDQGVSHHGRIWUDYHOVKRXOGEHHTXDOLQERWKGLUHFWLRQV
6\VWHPVFRQWDLQLQJJDVVKRFNVLQFOXGHWKHIROORZLQJ
6WHQRVFRS
0WDEOH
90;
3UHVWLOH[V\VWHPV
6XVSHQVLRQKDQJHUV

1-19
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

SAFETY RAD 1/1 XPM-110


job card: RAD MOUNTING BOLTS
subassembly: RAILS date: 11/99
HANGERS
TABLES
CHEST STANDS/CHANGEX
COLLIMATORS
TUBES
TOMO SYSTEMS
purpose: Tightness of mounting bolts time: 10 min.
NOTE: The frequency for checking mounting bolts is once every 12 months.
PREREQUISITES
7RROVUHTXLUHG 7RRONLW

SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRGERUQHSDWKRJHQVSURWHFWLRQZKHQ
LQVSHFWLQJRUUHSDLULQJWKHV\VWHP
TASK DESCRIPTION
Procedure:
&KHFNWLJKWQHVVRIDOOPRXQWLQJEROWV
6RPHRIWKLVFDQEHDFFRPSOLVKHGE\JRRGREVHUYDWLRQGXULQJRSHUDWLRQRIWKH
HTXLSPHQW
&KHFNWKHRYHUKHDGVXVSHQVLRQE\PRYLQJLWDURXQGZKLOHUXQQLQJWKHFROXPQXSDQG
GRZQZLWKWKH/DWDQG/RQJORFNVHQJDJHG
([WHQGWKHWDEOHWRSRXWDQGWKHQDWWHPSWWRPRYHWKHWDEOHE\SXVKLQJWKHWRSDURXQG,W
VKRXOGEHVROLG
0RXQWLQJEROWVRQUDLOV
(QGFDSVJRRVHQHFNRQKDQJHUV
%ROWVPRXQWHGWRFDUULDJHRQKDQJHU
7DEOHEDVHDQFKRUVWDEOHWXEERWWRPVFUHZVEXFN\VFUHZVSDWLHQWVWHSDQGOHDGZHLJKWV
7XEHPRXQWLQJEROWV
&ROOLPDWRUEDVHSODWHEROWVWRWXEH RU PRXQWLQJVFUHZVWREDVHSODWH
&KHVWVWDQGPRXQWLQJDQFKRUV
2UGRJUDSKPRXQWLQJEROWV
7RPRWXEHVWDQGDQFKRUV
,QVSHFWUDGLDWLRQVKLHOGIRUFUDFNVRUORRVHPRXQWVSLYRWSLQVDQGMRLQWV LISUHVHQW 
,QVSHFWFHLOLQJPRXQWHGLQMHFWRUVDQGVXUJHU\OLJKWVIRUFUDFNVRUORRVHPRXQWVSLYRWSLQV
DQGMRLQWV LISUHVHQW 

1-20
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

SAFETY 1/1 XPM-112


job card: R&F MOUNTING BOLTS
subassembly: SPOT-FILM DEVICE date: 11/99
TABLES
purpose: Tightness of mounting bolts time: 5 min.
NOTE: The frequency for checking mounting bolts is once every 12 months.
PREREQUISITES
7RROVUHTXLUHG 7RRONLW

SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRGERUQHSDWKRJHQVSURWHFWLRQZKHQ
LQVSHFWLQJRUUHSDLULQJWKHV\VWHP
TASK DESCRIPTION
%HIRUHVWDUWLQJWKLVMREFDUGPDNHVXUHWKDWDOO30KDVEHHQGRQHRQWKHSUHYLRXV
MREFDUG7KLVMREFDUGDGGVWR;30±DQGGRHVQRWUHSODFHLW

Procedure:
&KHFNWLJKWQHVVRIDOOPRXQWLQJEROWV
6RPHRIWKLVFDQEHDFFRPSOLVKHGE\JRRGREVHUYDWLRQGXULQJRSHUDWLRQRIWKH
HTXLSPHQW
&KHFNWKHVSRW±ILOPGHYLFHFDUULDJH
&KHFNDOOPRXQWLQJEROWV
7XUQRQDOOORFNVDQGWU\WRVKDNHWKH6)',WVKRXOGEHVHFXUH
&KHFNWKH79PRQLWRUFDUW
&KHFNWKHPRQLWRUVXVSHQVLRQDQG\RNHLIDSSOLFDEOH
7LOW±&V\VWHPUHTXLUHVDOOJHDUER[PRXQWLQJEROWVEHUHWRUTXHGHYHU\\HDUV5HIHUWR
GLUHFWLRQ ±

1-21
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

SAFETY 1/1 XPM-114


job card: VAS MOUNTING BOLTS
subassembly: VASCULAR TABLES date: 11/99
VASCULAR POSITIONERS
XRT AND MONITOR SUSPENSIONS
purpose: Tightness of mounting bolts time: 5 min.
NOTE: The frequency for checking mounting bolts is once every 12 months.
PREREQUISITES
7RROVUHTXLUHG 7RRONLW

SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRGERUQHSDWKRJHQVSURWHFWLRQZKHQ
LQVSHFWLQJRUUHSDLULQJWKHV\VWHP
TASK DESCRIPTION
%HIRUHVWDUWLQJWKLVMREFDUGPDNHVXUHWKDWDOO30KDVEHHQGRQHRQWKHSUHYLRXV
MREFDUGV7KLVMREFDUGDGGVWR;30±DQG;30±DQGGRHVQRWUHSODFH
WKHP

Procedure:
&KHFNWLJKWQHVVRIDOOPRXQWLQJEROWV
6RPHRIWKLVFDQEHDFFRPSOLVKHGE\JRRGREVHUYDWLRQGXULQJRSHUDWLRQRIWKH
HTXLSPHQW
)RUH[DPSOHWKH/8W\SHV\VWHPVFDQEHWHVWHGE\URWDWLQJWKH³/´DUPDQGREVHUYLQJWKH
EDVHIRUDEQRUPDOLWLHVVXFKDVJDSVRUVKLIWLQJDQGSUREOHPVLQPRYHPHQW
([WHQGWKHWDEOHWRSDQGORFNDOOWKHORFNV7U\WRPRYHWKHHQGRIWKHWDEOHWRSPDJQHWLF
ORFNVVKRXOGWDNHDUHDVRQDEOHIRUFHWRRYHUULGH
&KHFNWKHRYHUKHDGSRVLWLRQHUVLQWKHVDPHZD\

1-22
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

SAFETY 1/1 XPM-118


job card: SAFETY - ACCESSORIES
subassembly: ROOM ACCESSORIES date: 11/98
purpose: Verify the safety and mechanical integrity of the time: 5 min.
system accessories
PREREQUISITES
7RROVUHTXLUHG 1RUPDOKDQGWRROV
&XUUHQWFODPS±RQPHWHU IRUV\VWHPVZLWK3RZHUWHFK)LOWHU
SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRGERUQHSDWKRJHQVSURWHFWLRQZKHQ
LQVSHFWLQJRUUHSDLULQJWKHV\VWHP
TASK DESCRIPTION
Procedure:
&KHFNDOOV\VWHPDFFHVVRULHVIRUVDIHRSHUDWLRQ
)RRW5HVW±9HULI\WKHIRRWUHVWFDQEHVHFXUHO\IDVWHQHGWRWKHIRRWHQGDQGWKH
KHDGHQGRIWKHWDEOH,QVSHFWWKHWDEOHWRSPRXQWLQJKROHVIRUZHDU&KHFNWRPDNH
VXUHWKHVDIHW\SLQODWFKHVLQWKHKROHDQGWKDWWKHUHLVQRZD\LWFDQFRPHRXW
H[FHSWE\OLIWLQJWKHODWFK9HULI\WKDWZDUQLQJODEHOVRSHUDWLRQLQVWUXFWLRQVDUHLQ
SODFH
6KRXOGHU5HVW±9HULI\WKDWWKHVKRXOGHUUHVWDWWDFKHVVHFXUHO\DQGZLOOQRWFRPH
ORRVHRURIIZLWKQRUPDOPRYHPHQW
+DQGOHV±7DEOHDQG&KHVW%RDUG±&KHFNWRVHHWKDWWKHKDQGOHVFDQEHDWWDFKHG
VHFXUHO\DQGZLOOQRWFRPHRIIH[FHSWE\WKHSURSHUPHWKRG
&ROOLPDWRU&\OLQGHU([WHQVLRQ±&KHFNWRVHHWKDWWKHFROOLPDWRUF\OLQGHUH[WHQVLRQ
ZLOOQRWFRPHRIIWKHF\OLQGHUZKHQH[WHQGHGDOOWKHZD\RXW$OVRYHULI\WKDWLWILWV
VHFXUHO\LQWKHFROOLPDWRUWUDFNVDQGODWFKHVLQSODFH&KHFNWKDWWKHWHOHVFRSLQJ
FROXPQGRHVQRWGULIWGRZQZKHQF\OLQGHULVDWWDFKHG
6KLHOGV±&KHFNWKDWVKLHOGVLISUHVHQWRSHUDWHFRUUHFWO\,QVSHFWOHDGDSURQVRQ
VSRW±ILOPGHYLFHDQGUDGLDWLRQVKLHOG LISUHVHQW IRUWHDUVRUGDPDJH
+DQG6ZLWFK±9HULI\WKDWWKHKDQGVZLWFKKDQJHULVLQJRRGFRQGLWLRQDQGLV
SRVLWLRQHGVRWKDWWKH[±UD\PDFKLQHFDQQRWEHRSHUDWHGLQDQXQVDIHPDQQHU
3RVLWLRQLQJ 5HVWUDLQWV±9HULI\WKDWWKHUHVWUDLQWVFDQEHSURSHUO\PRXQWHGWRWKH
WDEOH
&KHFNRWKHUDFFHVVRULHVWKDWPD\EHLQWKHURRPIRUVDIHRSHUDWLRQ

For Systems with Powertech Suppressor/Filter


8VLQJDFODPS±RQFXUUHQWPHWHUYHULI\WKDWWKHFXUUHQWLQWKHFXUUHQWORRSIRUHDFKSRZHU
SKDVHLVVWLOOZLWKLQWKHUDQJHDVLQGLFDWHGRQWKHIDFWRU\WDJRQHDFKORRS
CAUTION: Doing this test requires power on, therefore, use proper safety
precautions.

1-23
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

VISUAL INSPECTION RAD 1/2 XPM-120


job card: RAD VISUAL INSPECTION
subassembly: GENERATORS, TABLES, HANGERS, date: 11/98
TUBE SUPPORTS, CHEST STANDS
purpose: To perform a visual inspection of various compoĆ time: 10 min.
nents including important contactors in the generator, cirĆ
cuit boards, regulator motors, cables, covers, etc.
PREREQUISITES
7RROVUHTXLUHG 7RRONLWZLWKIODVKOLJKW
'RWKLVMREFDUGLQFRQMXQFWLRQZLWKMREFDUGV;30±;30±DQG;30±&OHDQLQJ
DQG /XEULFDWLQJ
SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRGERUQHSDWKRJHQVSURWHFWLRQZKHQ
LQVSHFWLQJRUUHSDLULQJWKHV\VWHP

1-24
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

VISUAL INSPECTION RAD 2/2 XPM-120


job card: RAD VISUAL INSPECTION
subassembly: GENERATORS, TABLES, HANGERS, date: 11/98
TUBE SUPPORTS, CHEST STANDS
purpose: To perform a visual inspection of various compoĆ time: 10 min.
nents including important contactors in the generator, cirĆ
cuit boards, regulator motors, cables, covers, etc.
TASK DESCRIPTION
Remove all power from equipment and lockout energy source before
proceeding!
Procedure:
:KLOHFOHDQLQJDQGOXEULFDWLQJV\VWHPFKHFNIRUREYLRXVVLJQVRIKHDWRQFLUFXLWERDUGV
OHDN\FDSVDQGORRVHFRQQHFWLRQV-867.((3<285(<(623(1
&KHFNFDEOHGUDSHFRQFHDOPHQWVDQGKDUQHVVHVIRUVWUDLQUHOLHIFXWFDEOHVDQGSURSHU
URXWLQJRIFDEOHV
&KHFNVSDUNJDSVRQ+9WUDQVIRUPHUVIRUSURSHUJDSLISUHVHQW²VKRXOGEHDEXVLQHVV
FDUGZLGWK WRI 
&KHFNFRQGLWLRQRI029¶VRUVLPLODUGHYLFHVLISUHVHQWRQ+9WUDQVIRUPHU
&KHFNIRUH[FHVVLYHRLOOHDNDJHIURP+9WUDQVIRUPHUV
&KHFNDOOPDMRUFRQWDFWRUVIRUIUHHQRQ±ELQGLQJRSHUDWLRQ
&KHFNWKHFRQWDFWVIRUVLJQVRISLWWLQJRUHURVLRQ
,QFOXGHWKHOLQHVDIHW\IOXRURDQGFKDUJHUFRQWDFWRUV
6FKHGXOHUHSODFHPHQWLIQHFHVVDU\
&KHFNDQGLIQHFHVVDU\WLJKWHQDOOSRZHUFRQQHFWLRQVLQWKHSRZHUFDELQHWV
,QFOXGHWKHYROW±SDFDOOFDSDFLWRUVFRQWDFWRUV6&5¶VDQGHWF
(QVXUHWKDWDOOFLUFXLWERDUGVSOXJVMDFNVDQGSXVK±RQFRQQHFWRUVDUHILUPO\VHDWHG
9HULI\WKDWUHJXODWRUPRWRUVDUHQRWVHL]HG
&KHFNWKHYROW±SDFEUXVKHVIRUH[FHVVLYHRUXQHYHQZHDUDQGYROW±SDFVXUIDFHIRUSLWWLQJ
RUEXUQPDUNV
9HULI\FROOLPDWRUWDSHPHDVXUHLVLQJRRGFRQGLWLRQ
&KHFNJHDUUHGXFHUVIRUOHDNDJH,IOHDNLQJFKHFNOHYHORIOXEULFDQW
NOTE:,IV\VWHPLVQHZYHULI\WKHJHDUER[KDVVKLSSHGZLWKRLO
/RRNIRUGDPDJHGRUPLVVLQJFRPSRQHQWVDQGKDUGZDUHUHSODFHLIIRXQG
6QDSULQJVFRWWHUSLQVPRXQWLQJVFUHZVHWF
7ULPFRYHUVHVSHFLDOO\LQSDWLHQWDUHDV
:HOGPHQWVDQGFDVWLQJVIRUVLJQVRIFUDFNVDQGZHDU
&KDLQPDVWHUOLQNVDQGPDVWHUOLQNNHHSHUV
9HULI\ZDUQLQJODEHOVDUHSUHVHQWDQGOHJLEOH

1-25
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

VISUAL INSPECTION R&F 1/1 XPM-122


job card: R&F VISUAL INSPECTION
subassembly: MONITOR CART date: 05/01/95
MONITOR SUSPENSION
FREE SUSPENSION
SFD
IMAGE SYSTEM
purpose: Visual inspection of various system components time: 5 min.
to insure the integrity of the system.
PREREQUISITES
7RROVUHTXLUHG 7RRONLWZLWKIODVKOLJKW
'RWKLVMREFDUGLQFRQMXQFWLRQZLWKMREFDUGV;30±;30±DQG;30±&OHDQLQJ
DQG /XEULFDWLQJ
SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRGERUQHSDWKRJHQVSURWHFWLRQZKHQ
LQVSHFWLQJRUUHSDLULQJWKHV\VWHP

TASK DESCRIPTION
Remove power from equipment and lockout energy source before proceeding!
Procedure:
'RDOODSSOLFDEOHSURFHGXUHVLQMREFDUG;30±EHIRUHSHUIRUPLQJ;30±
5HPHPEHUWR-867.((3<285(<(623(1
,PDJH6\VWHP
&KHFNFLUFXLWERDUGVDQGFRQQHFWRUV
&KHFNDOOFDPHUDPRXQWVRQLQWHQVLILHUIRUSURSHUVHWWLQJDQGEHVXUHFDPHUD¶VDUH
PRXQWHGVHFXUHO\
&KHFNWKHLPDJHJDWHGULYHEHOWIRUFRQGLWLRQ
,IQHFHVVDU\VFKHGXOHLWVUHSODFHPHQW
&KHFNWKHPRQLWRUFDUW
&KHFNWKHPRQLWRUVXVSHQVLRQ0DNHVXUHWKHVDIHW\SLQLVVHFXUH
9LVXDOO\LQVSHFWWKHVSRW±ILOPGHYLFH
&KHFNWKHP\HORJUDSKLFFRQHDQGJULGV
&KHFNWKHFRQWUROSDQHO
&KHFNFDEOHVDQGFDEOHURXWLQJ
&KHFNDQ\LQWHQVLILHUIUHHVXVSHQVLRQVSUHVHQW

1-26
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

VISUAL INSPECTION VASC 1/1 XPM-124


job card: VASC VISUAL INSPECTION
subassembly: VASCULAR POSITIONERS date: 05/01/95
VASCULAR TABLES
IMAGE SYSTEMS
MONITOR SUSPENSIONS
purpose: Visual inspection of various system components time: 5 min.
to insure the integrity of the system.
PREREQUISITES
7RROVUHTXLUHG 7RRONLWZLWKIODVKOLJKW
'RWKLVMREFDUGLQFRQMXQFWLRQZLWKMREFDUGV;30±;30±DQG;30±&OHDQLQJ
DQG /XEULFDWLQJ
SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRGERUQHSDWKRJHQVSURWHFWLRQZKHQ
LQVSHFWLQJRUUHSDLULQJWKHV\VWHP

TASK DESCRIPTION
Remove power from equipment and lock out energy source before
proceeding!
NOTE:)RU/&DQG/&/3V\VWHPVUHIHUWRGLUHFWLRQ±IRUDGGLWLRLQDO
LQIRUPDWLRQRQPDLQWHQDQFHSUHFHGXUHV
Procedure:
'RDOODSSOLFDEOHSURFHGXUHVLQMREFDUG;30±$1';30±EHIRUHSHUIRUPLQJ
;30±
$QRWKHUIULHQGO\UHPLQGHUWR.((3<285(<(623(1
&KHFNDOOFDEOHVDQGFRQQHFWLRQVDWWKHSXOVHELDVWDQNDQGIRFXVELDVWDQNV
&KHFNIRUH[FHVVLYHRLOOHDNDJH
&KHFNWKHLQWHQVLILHUDQGUHODWHGFDEOHVDQGFDPHUDV
&KHFNWKHSRVLWLRQHUV
&DEOHVFDEOHGUDSHVDQGFDEOHURXWLQJ
$Q\SRVVLEOHLQWHUIHUHQFHRISRVLWLRQHUZLWKFDEOLQJFDPHUDVDQGDQ\WKLQJHOVHRQ
WKH
V\VWHPRULQWKHURRP
&KHFNWKHWDEOHV
&KHFNFDEOHVDQGFDEOHGUDSHV
&KHFNDFFHVVRULHVRQWKHWDEOH
&KHFNWKHWDEOHWRSDQGUDLOVIRUVLJQVRIZHDU
&KHFNWKDWWDEOHDFFHVVRU\UDLOVDUHWLJKW

1-27
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

CLEAN and LUBRICATE RAD 1/2 XPM-130


job card: RAD CLEAN AND LUBRICATE
subassembly: ALL EQUIPMENT date: 05/01/95
purpose: To clean all necessary equipment and to lubricate time: 2 hours
moving parts and bearing surfaces.

PREREQUISITES
7RROVUHTXLUHG 7RRONLW
5DJV
/36RU673 OXEULFDQW RUHTXLYDOHQW
)RUPXOD FOHDQLQJVROXWLRQ RUHTXLYDOHQW
9DFXXP
6LOLFRQHJUHDVH
/XEULFDQWV
'HVLJQDWLRQ 7\SH 7UDGH1DPH &RGH1XPEHU
* *UHDVH 6KHOO$OYDQLD 3
* *UHDVH :KLWH5RFRO 3
2 2LO &DVWURO5XVLOR 3
2 2LO -ZO6693.RPEL 3
2 2LO 0RO\NRWH2PQLJODVV 3
8VH*IRUEHDULQJVDQGUROOHUV
8VH*IRUJHDUVVOLGHVDQGMDZV
8VH2IRUVKDIWVERUHVDQGUDLOVQRWWUHDWHGIRUDQWL±UXVW
8VH2IRUFKDLQVDQGSLQLRQV
8VH2IRUDOOMRLQWV
SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRGERUQHSDWKRJHQVSURWHFWLRQZKHQ
LQVSHFWLQJRUUHSDLULQJWKHV\VWHP

1-28
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

CLEAN and LUBRICATE RAD 2/2 XPM-130


job card: RAD CLEAN AND LUBRICATE
subassembly: ALL EQUIPMENT date: 05/01/95
purpose: To clean all necessary equipment and to lubricate time: 2 hours
moving parts and bearing surfaces.
TASK DESCRIPTION
7KLVMREFDUGVKRXOGEHGRQHDORQJZLWK;30±;30±DQG;30±9LVXDO
,QVSHFWLRQ
CAUTION: Check with the customer for housekeeping assistance for proper disposal
of needles, etc. Make sure all power is off for safety reasons.
Procedure:
&OHDQDOOILOWHUVIDQVDQGLQWHULRUVRIFDELQHWVZLWKDYDFXXP
&KHFNDOOIDQVIRUURWDWLRQZKHQSRZHULVWXUQHGRQ
5HPHPEHUWKHIDQVEHORZWKHLQYHUWHUVDQGFDUGUDFNV
&OHDQDOOEHDULQJWUDFNVZLWKRLO8VHVSDULQJO\DVH[FHVVLYHRLOZLOOFROOHFWGLUWDQGRUFDXVH
PRYHPHQWSUREOHPV
2Q;7KDQJHUUDLOVFKHFNIRUIJDSEHWZHHQWKHWRSRIWKHEHDULQJVDQGWKHERWWRPRI
WKHUDLO
0DNHVXUH\RXFRYHUUDLOVKDQJHUVWXEHVWDQGVWDEOHVDQGFKHVWVWDQGV
5HJUHDVHKLJKYROWDJHFDEOHVLIQHHGHG7KLVVKRXOGEHGRQHDWOHDVWRQFHD\HDU
9HULI\SLQVSUHDGIRUJRRGFRQWDFW HVSHFLDOO\&$7+FDEOHV 
&KHFNWKHRLOLQZHOOVDWWKHKLJKYROWDJHWUDQVIRUPHU
0DNHVXUHWKDWDOOKLJKYROWDJHFDEOHVDUHWLJKWZKHQILQLVKHGFKHFNLQJRLOJUHDVH
&OHDQDQGSROLVKDOOH[SRVHGVXUIDFHV
,ISDLQWWRXFKXSLVUHTXLUHGVFKHGXOHZLWKFXVWRPHUWRUHGXFHSDWLHQWGLVFRPIRUW

1-29
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

CLEAN and LUBRICATE R&F 1/2 XPM-132


job card: R&F CLEAN AND LUBRICATE
subassembly: GENERATORS date: 11/98
SFD DRIVES
IMAGE GATE
MONITORS
CAMERA and INTENSIFIER LENSES
purpose: To clean all necessary equipment and to lubricate time: 30 min.
moving parts and bearing surfaces.

PREREQUISITES
7RROVUHTXLUHG 7RRONLW
5DJV
/36RU673 OXEULFDQW RUHTXLYDOHQW
)RUPXOD FOHDQLQJVROXWLRQ RUHTXLYDOHQW
9DFXXP
6LOLFRQHJUHDVH
/HQVHFOHDQLQJNLW
SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRGERUQHSDWKRJHQVSURWHFWLRQZKHQ
LQVSHFWLQJRUUHSDLULQJWKHV\VWHP

TASK DESCRIPTION
7KLVMREFDUGVKRXOGEHGRQHDORQJZLWK;30±;30±DQG;30±9LVXDO
,QVSHFWLRQ
CAUTION: Check with customer for housekeeping assistance for proper disposal of
needles, etc. Make sure all power is off for safety reasons.

1-30
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

CLEAN and LUBRICATE R&F 2/2 XPM-132


job card: R&F CLEAN AND LUBRICATE
subassembly: GENERATORS, SFD DRIVES, IMAGE date: 11/98
GATE, MONITORS,
CAMERA and INTENSIFIER LENSES
purpose: To clean all necessary equipment and to lubricate time: 30 min.
moving parts and bearing surfaces.
Procedure:
&OHDQDQGOXEHWKH6)'GULYHVDQGFDEOHV
,QFOXGHWKHILOPFDUULDJHJULGGULYHPDVNGULYHVDQGP\HORJUDSKLFFRQHGULYH
&OHDQDQGOXEHWKHLPDJHJDWHLQWKHLQWHQVLILHUKRXVLQJ
:KHQGRQHFOHDQWKHLPDJHJDWHPLUURUDQGWKH,,OHQVH
&OHDQDFFHVVLEOHOHQVVXUIDFHV
,ILQDFFHVVLEOHVXUIDFHVQHHGFOHDQLQJVFKHGXOHDGGLWLRQDOWLPHIRUVHUYLFH
&OHDQWKHPRQLWRU±FDVHDQGIDFHSODWH
3KRWRVSRWFDPHUD±VHHMREFDUG;30±
&OHDQDQGLQVSHFWDOOQ\ORQJXLGHVDQGUROOHUV
6PRRWKQHVVRIPRYHPHQWRQUHPRWHV\VWHPVLVYHU\GHSHQGHQWRQFOHDQEHDULQJVDQG
EHDULQJWUDFNV7KHUHIRUHFOHDQDOOVXUIDFHVDQGEHDULQJUDFHVWKRURXJKO\
&KHFNILOWHUDQGZDWHUOHYHOLQWDQNIRUWXEHZDWHUFKLOOHU
&KHFNDQGYDFXXPFRQGHQVHUILQVDVQHHGHG
&KLOOHUPRWRUEHDULQJOXEULFDWLRQ$GGWRGURSVRI6$(RLO

FRQWLQXRXVXVHRQFHSHU\HDU
,QWHUPLWWHQWXVHRQFHHYHU\\HDUV
2FFDVLRQDOXVHRQFHHYHU\\HDUV
9HULI\ZDWHUIORZIRUV\VWHPVXVLQJIDFLOLW\ZDWHUFRROLQJ QRFKLOOHU 
9HULI\FKLOOHURSHUDWLRQ
Prestilex 110/150/150 Angio
&OHDQWKHHQGOHVVVFUHZRQWKHFDUULDJHEXW'2127/8%5,&$7(
Prestilex 1600
&OHDQUDLOVIRUIRRWUHVWRQHYHU\LQVSHFWLRQ
)RRWUHVWPXVWEHUHSODFHGHYHU\\HDUV 
Non–GEMS Systems
)RUQRQ±*(06V\VWHPVUHIHUWR2(0VHUYLFHGRFXPHQWDWLRQ
Prestige VH/II and VH/AD
)RU3UHVWLJH9+,,DQG9+$'UHIHUWR&'520±

1-31
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

CLEAN and LUBRICATE VASC 1/1 XPM-134


job card: VASC CLEAN AND LUBRICATE
subassembly: VASC TABLE RAM and WORM GEARS date: 05/01/95
VASC TABLE RAILS and STEPPER DR
VASC POSITIONERS
CINE CAMERA and MAGAZINES
purpose: To clean all necessary equipment and to lubricate time: 15 min.
moving parts and bearing surfaces.
PREREQUISITES
'RDOODSSOLFDEOHLWHPVLQMREFDUG;30±DQG;30±EHIRUHSURFHHGLQJZLWKWKLVMRE
FDUG
7RROVUHTXLUHG 7RRONLW
5DJV
/36RU673 OXEULFDQW RUHTXLYDOHQW
)RUPXOD FOHDQLQJVROXWLRQ RUHTXLYDOHQW
9DFXXP
6LOLFRQHJUHDVH
/HQVFOHDQLQJNLW
SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNHQHUJ\ORFNRXWDQGEORRGERUQHSDWKRJHQVSURWHFWLRQZKHQ
LQVSHFWLQJRUUHSDLULQJWKHV\VWHP

TASK DESCRIPTION
7KLVMREFDUGVKRXOGEHGRQHDORQJZLWK;30±;30±DQG;30±9LVXDO
,QVSHFWLRQ
CAUTION: Check with customer for housekeeping assistance for proper disposal of
needles, etc. Make sure all power is off for safety reasons.
Procedure:
&KHFNFOHDQDQGOXEHWKHWDEOHUDPDQGZRUPJHDUVLISUHVHQW
:KLOHLQWKHWDEOHFKHFNWKHWDEOHKHLJKWSRW
&OHDQWKHWDEOHUDLOVDQGWKHVWHSSHUGULYHZKHHO ROGHUXQLWV  ZKHUHDSSOLFDEOH 
&OHDQWKHFLQHFDPHUDDQGPDJD]LQHV
&OHDQZLWKFRPSUHVVHGDLULIDYDLODEOH
&OHDQRXWDOOILOPFKLSV
/XEHDFFRUGLQJWRWKH$UULVHUYLFHPDQXDO
&OHDQDOOSRVLWLRQHUV
,IQHFHVVDU\OXEHDFFRUGLQJWRVHUYLFHPDQXDO
*HQHUDWRUV
&OHDQWKHIRFXVELDVDQGSXOVHELDVWDQNV ZKHUHILWWHG 
&KHFNFRQGLWLRQRIRLOLQ&*5WHWURGHWDQNVHWF6FKHGXOHUHSODFHPHQWLIQHHGHG

1-32
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

FUNCTIONAL CHECK RAD 1/2 XPM-140


job card: FUNCTIONAL CHECK - RAD
subassembly: HANGERS date: 05/01/95
TABLES
CHEST STANDS
purpose: To perform a Functional check on the system time: 30 min.
after the safety checks have been completed.
PREREQUISITES

TASK DESCRIPTION
Hangars:
&KHFNVPRRWKRSHUDWLRQRIKDQJHUORQJLWXGLQDOO\ODWHUDOO\DQGYHUWLFDOO\
9HULI\WKDWORFNVKROGDQGWKDWGHWHQWVDQGPRWRUGULYHVDUHRSHUDEOHZKHUHDSSOLFDEOH
&KHFNWXEHDQJXODWLRQDQGGHWHQWV
&KHFNWXEHURWDWLRQDQGGHWHQWV
&KHFNSOXPERIFROXPQE\ORZHULQJWXEHWRORZHVWSRVLWLRQDQGDOLJQLQJFURVVKDLUVWRWKH
IORRU7DSHDSLHFHRISDSHUWRWKHIORRUDQGPDUNZKHUHWKHFURVVKDLUVDSSHDU ,I
\RXKDYHDWLOHIORRUDOLJQFURVVKDLUVWRWKHSRLQWZKHUHIRXUWLOHVPDNHDFURVV
5DLVHWKHWXEHWRWKHKLJKHVWSRVLWLRQDQGYHULI\WKDWWKHFURVVKDLUVDUHVWLOOZLWKLQ
VSHFV
9HULI\6,'DQGZDUQLQJVWLFNHUVDUHSUHVHQWZKHUHUHTXLUHG
:LWKWKHWDEOHKRUL]RQWDOFHQWHUWKHWXEHRYHUWKHWDEOHDQGYHULI\ZLWKWKHFROOLPDWRUOLJKW
WKDWWKHWXEHLVFHQWHUHGWRWKHWDEOH5XQWKHWXEHORQJLWXGLQDOO\GRZQWKHWDEOHWR
FKHFNWUDFNLQJ$QJXODWHWKHWXEHDOVRZKLOHFHQWHUHGDQGOLJKWRQWRFKHFNWUDFNLQJ
RIWKHFROXPQ
Table:
&KHFNORQJLWXGLQDODQGODWHUDO LIDSSOLFDEOH PRYHPHQWVRIWKHWDEOHWRS$OVRFKHFNWRS
OLPLWVZKLOHDQJXODWLQJ
:KLOHDQJXODWLQJYHULI\RSHUDWLRQRIDQJXODWLRQLQGLFDWRU
&KHFNWKDWWKHUHGHPHUJHQF\VWRSEXWWRQLVRSHUDWLRQDOLIHTXLSSHG
&KHFNWKDWQRDQJXODWLRQLVSRVVLEOHZLWKWKHSDWLHQWVWHSRXW
&KHFNKRUL]RQWDOVWRSIHDWXUHDVZHOODVWDEOHFHQWHULQJVZLWFKHV
&KHFNPRYHPHQWORFNVDQGFRXQWHUEDODQFHRIWKHEXFN\
&KHFNWKDWWKHFDVVHWWHWUD\SOXJDOLJQVSURSHUO\DQGWKDWFDVVHWWHWUD\VWRSLVIXQFWLRQDO
&KHFNWKDWWKHFDVVHWWHKDVPLQLPDOVLGHWRVLGHSOD\ZKHQLQVHUWHG
5HPRYHFDVVHWWHWUD\DQGYLVXDOO\FOHDQLQVSHFWDQGOXEULFDWHDVQHHGHG,QVSHFWFDVVHWWH
WUD\WXQQHOIRUZHDUSDUWLFXODUO\IRUGDPDJHWRLRQGHWHFWRULISUHVHQW

1-33
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

FUNCTIONAL CHECK RAD 2/2 XPM-140


job card: FUNCTIONAL CHECK - RAD
Silhouette HF Systems
&KHFNWKHWDEOH6FLVVRUHOHYDWLQJPHFKDQLFVIRUELQGLQJ
&KHFNWKHRSHUDWLRQRIWKHSULQWHULIHTXLSSHG,IVHUYLFHLVQHHGHGUHIHUWRWKH
VHUYLFHPDQXDO
Chest stand:
9HULI\YHUWLFDOORFNVKROGDQGZKHQORFNVUHOHDVHLWVKRXOGPRYHIUHHO\DQGZLWKPLQLPDO
VLGHSOD\
)RUYHUWLFDOEXFN\VWDQG±UHOHDVHDQJXODWLRQORFN QRWDSSOLFDEOHIRU±3 ±LW
VKRXOGWLOWIRUZDUGGHJUHHVDQGEDFNZDUGVGHJUHHVWRKRUL]RQWDO
(QJDJHDQJXODWLRQORFN,WVKRXOGKROGDQGQRWELQG
%XFN\VKRXOGDOVRURWDWHGHJUHHVWRGHJUHHV
6LWWLQJSRVLWLRQ±WLOWEXFN\WRKRUL]RQWDOSRVLWLRQ5HOHDVHOHJDVVHPEO\DQGORZHUEXFN\WR
WKHIORRUXQWLOOHJVWRXFKWKHIORRU
)RUYHUWLFDOFDVVHWWHKROGHU±RSHUDWHFDVVHWWHVL]HNQRE7U\DOOFDVVHWWHVL]HVDQGYHULI\
WKDWWKHGHWHQWKROGVZKHQDFDVVHWWHLVLQVHUWHG
Changex:
&KHFNILOPWUDQVSRUW
,QVWDOOWKHILOPVXSSO\PDJD]LQH±UHGFKHFNOLJKWRQ
,IIHZHUWKDQ±ILOPVLQWKHPDJD]LQHWKHQDPEHUILOPOLJKWZLOOEHRQ
,QVWDOOSDWLHQW,'FDUGWKHQUHGFKHFNOLJKWJRHVRXW
*UHHQUHDG\OLJKWWXUQVRQDVILOPWUDQVSRUWVWRH[SRVXUHDUHD
6ZLWFKFKDQJH[SRZHURIIWKHQRQ
)LOPWUDQVSRUWVRXWRIH[SRVXUHDUHDDQGUHGFKHFNOLJKWWXUQVRQ
,I\RXKDYHDWDNHXSPDJD]LQHUHPRYHWKHPDJD]LQHDQGYHULI\WKDWDILOPZDVH[SRVHG
,I\RXKDYHDSURFHVVRUWKHZDLWOLJKWZLOOFRPHRQ±WKHWRZHUDQGWKHILOPZLOOEH
GHYHORSHGWKURXJKWKHSURFHVVRU

1-34
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

FUNCTIONAL CHECK R&F 1/1 XPM-142


job card: R&F FUNCTIONAL CHECK
subassembly: SFD date: 05/01/95
FLUORO
purpose: To perform a functional check on the system after time: 15 min.
the safety checks have been completed.
PREREQUISITES

TASK DESCRIPTION
Procedure:
&KHFNWKDWWKHDQJXODWLRQNQRERQWKH6)'DQJXODWHVWKHWDEOHWRLWVIXOOPRYHPHQW
9HULI\WKDWFRQWUROGRHVQRWVWLFNDWDQ\SRVLWLRQ
&KHFNWKDWWKHWDEOHWRSPRYHPHQWRSHUDWHVIURPWKH6)'FRQWUROV
9HULI\WKDWWKH±RQ±±RQ±±RQ±±RQ±±RQ±DQGPLQLVSRW LIDSSOLFDEOH DUH
VHOHFWDEOHDQGEULQJVLQWKHDSSURSULDWHPDVN
9HULI\FRQHGULYH RUPDQXDORSHUDWLRQ LVSHUPLVVLEOH
:LWKKRUL]RQWDOVWRSRII RQWDEOHFRQWUROSDQHO YHULI\QRFRQHGULYHDQGFRQHOLJKWIODVKHV
ZKHQFRQHVHOHFWHG
,IDSSOLFDEOHYHULI\WKDWSRZHUDVVLVWKDQGOHZRUNV
9HULI\WKDWWKHWUDYHORIWKHFDUULDJHLVVPRRWKZLWKQRELQGLQJ
&KHFNWKDWIRUZDUGSDUNODWFKRSHUDWHVSURSHUO\DQGWKDWH[SRVXUHVDUHGLVDEOHGZLWKQR
FDVVHWWHLQSODFH
:LWKDUHPRYDEOHLQWHQVLILHUYHULI\WKDWWKH,,LVVHFXUHDQGWKDWWKHLQWHQVLILHULQSODFH
VZLWFKZRUNVSURSHUO\
:LWKDUHPRYDEOH,,FKHFNWKDWORQJDQGODWHUDOPRYHPHQWVDUHVPRRWK
9HULI\WKDWWKHLQWHQVLILHULVEDODQFHGRQWKHVXSSRUWDUP

1-35
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

FUNCTIONAL CHECK R&F 1/2 XPM-143


job card: R&F FUNCTIONAL CHECKs - REMOTE TABLES
subassembly: REMOTE R&F TABLES date: 05/01/95
purpose: Check Functionality of Remote Table Systems. time:
PREREQUISITES
+DQG7RROV

TASK DESCRIPTION
Console:
&KHFNWKHRSHUDWLRQVRIDOOFRQWUROVDQGVZLWFKHV
&KHFNWKDWWKHMR\VWLFNRSHUDWLRQLVEDODQFHGLQERWKGLUHFWLRQV
9HULI\WKDWWKHHQDEOHUHOD\LVQRWHQHUJL]HGZLWKWKHMR\VWLFNFHQWHUHG,IVRFKHFN
WKHMR\VWLFN
9HULI\WKHIRRWVZLWFKRSHUDWLRQ
&KHFNWKHWDEOHVLGHFRQWURORSHUDWLRQ
&KHFNWKHRSHUDWLRQRIWKHFRPSUHVVLRQGHYLFHDQGWKHSURSHUPRYHPHQWVDUH
ORFNHGRXWZKHQLWLVQRWSDUNHG
Table:
9HULI\DOOWDEOHPRYHPHQWVIRUVPRRWKRSHUDWLRQ
&KHFNWKDWWKHWUDYHOLVWRWKHIXOOUDQJHDQGOLPLWVDUHRSHUDWLRQDO
&KHFNWKHPRWRUEUDNHVDUHRSHUDWLQJ
9HULI\WKDWWKHPRWRUGULYHVJHDUUHGXFHUVEHOWVDQGFKDLQVGRQRWVKRZVLJQVRI
H[FHVVLYHZHDURUELQGLQJ
&KHFNWKHFDVVHWWHWUD\RSHUDWLRQDQGFDVVHWWHFODPSLQJ
2EVHUYHWKHPDVNRSHUDWLRQZKHQWKHILOPVHOHFWLRQLVFKDQJHG
9HULI\WKHFROOLVLRQVHQVRUVLQDOOPRGHV
5XQWKHWDEOHWRFKHFNWKDWQRFROOLVLRQLVSHUPLWWHGZLWKWKHFHLOLQJIORRUFDELQHWV
HWF
9HULI\WKDWWDEOHWLOWLVRQO\HQDEOHGZLWKWKHWXEHDWPLQLPXP6,'
9HULI\WKHPLQDQGPD[6,'WUDYHOVWRSVDQGWKDWWUDYHOLVDERXWWKHVDPHVSHHGLQ
ERWKGLUHFWLRQV,IQRWWKHJDVVSULQJPD\EHWKHSUREHOP LIHTXLSSHG 
)RUV\VWHPVZLWKJULGGULYHFKHFNWKDWWKHJULGGULYHVWRWKHSURSHUSRVLWLRQDVWKH
V\VWHPPRGHVDUHFKDQJHV
9HULI\WKHFROOLPDWRURSHUDWLRQDQGFRQWUROV
9HULI\WKHWXEHURWDWLRQDQGURWDWLRQLQWHUORFNV
&KHFNWKDWWKHP\ODUVKLHOGVDUHWLJKWDQGLQSRVLWLRQ
&KHFNFRQGLWLRQRIWKH',1 DFFVVVRU\ UDLOVRQWKHWDEOHWRS
,IHTXLSSHGZLWKDGRFNLQJILOPFKDQJHUFKHFNWKHLQWHUORFNVDUHRSHUDWLRQDODQGWKH
SURSHUPRYHPHQWVDUHORFNHGRXW
9HULI\RSHUDWLRQRIWKHV\VWHPFHQWHULQJIXQFWLRQ

1-36
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

FUNCTIONAL CHECK R&F 2/2 XPM-143


job card: R&F FUNCTIONAL CHECKs - REMOTE TABLES
subassembly: REMOTE R&F TABLES date: 05/01/95
purpose: Check Functionality of Remote Table Systems. time:
Prestilix 1600
9HULI\WKHFRPSUHVVLRQOLQNLQJEDULVWLJKWDQGQRSOD\LVHYLGHQW VHH)0,±LI
UHTXLUHG 

Futuralix 12/20/90
,IWDEOHWRSFKDLQWHQVLRQLVLQFRUUHFWUHIHUWR6HUYLFH1RWH55)$
Futuralix 1500
,IWDEOHWRSFKDLQWHQVLRQLVLQFRUUHFWUHIHUWR6(UYLFH1RWH
IRU$PHULFDQSROH
IRU(XURSHDQSROH55)
Non–GEMS Systems
5HIHUWR2(06HUYLFH'RFXPHQWDWLRQLIUHTXLUHG

1-37
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

FUNCTIONAL CHECK VASC 1/1 XPM-144


job card: VASCULAR FUNCTIONAL CHECK
subassembly: VASCULAR date: 05/01/95
purpose: Functional check of a vascular room time: 15 min.
PREREQUISITES

TASK DESCRIPTION
0RXQWPDJD]LQHVRQDOOFDPHUDV
9HULI\WKDWIUHHSOD\LQWKH8±DUPLVQRJUHDWHUWKDQGHJUHH KDUGZDUHLQWKH8±DUPORFN
DVVHPEO\KDVDWHQGHQF\WRZRUNORRVH 
:LWKWKHFRQWUROVDWWKHWDEOHGULYHWKH/±DUPDQGWKH8±DUPWKURXJKWKHLUUDQJHRIWUDYHO
DQGYHULI\WKDWPRWLRQLVVPRRWKDQGGRHVQ¶WVWDOO
9HULI\ZKLOHGULYLQJDUPVWKDWWKHPRWLRQFDQEHVWRSSHGZLWKDPLQLPDODSSOLHGIRUFH
5HWXUQ/DQG8WRGHJUHHV
0RYH,,XSDQGGRZQLWVIXOOWUDYHODQGYHULI\WKDWWKHUHLVQRGULIWIURPZKHUHYHULWLV
SRVLWLRQHG
9HULI\RSHUDWLRQRIWKHIXQFWLRQVRQWKHVWDWXVFRQWURODQGWKDWWKHEXWWRQVDUHLOOXPLQDWHG
ZKHQVHOHFWHG
9HULI\WDEOHPRYHPHQWVXSDQGGRZQZLWKQRELQGLQJRUH[FHVVLYHQRLVH
9HULI\ODWHUDOORQJLWXGLQDODQGURWDWLRQDOPRYHPHQWVRIWKHWDEOHDUHVPRRWKWKDWORFNV
KROGDQGWKDWFHQWHULQJVZLWFKHVDUHRSHUDEOH
9HULI\WKDWPRQLWRUVXVSHQVLRQPRYHPHQWVDUHVPRRWK
&KHFN/8$UP/HDG*ODVV6KLHOGPRYHVVPRRWKO\DQGIUHHO\DORQJWKHEULGJH
6KLHOGDUPVKRXOGPRYHIUHHO\IURPPLQWRPD[KHLJKW7KHVKLHOGVKRXOGURWDWH
GHJUHHV7KHOHDGJODVVVKLHOGVXVSHQVLRQDUPVKRXOGURWDWHGHJUHHV
For non–GEMS systems
5HIHUWR2(0VHUYLFHGRFXPHQWDWLRQLIUHTXLUHG

1-38
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

FUNCTIONAL CHECK TOMO 1/3 XPM-150


job card: DEDICATED TOMO TABLES
subassembly: TOMO TABLES date: 11/99
purpose: Functional check of dedicated Tomo tables. time: 10 min.
Mechanical check and Tomo exposure check.
NOTE: Films are not required unless the customer is complaining of film quality.
The frequency of mechanical checks is once every 12 months.
PREREQUISITES
7RROVUHTXLUHG +DQGWRROV7RPRSKDQWRP
TASK DESCRIPTION
After functional check is done on the table, use the tomo phantom during an x-ray exposure in
the Tomo mode to check the Tomo capability of the table. Pictures should not appear blurred.
Procedure:
&KHFNWKDWH[SRVXUHVDUHGLVDEOHGLIWKHFDVVHWWHWUD\LVHPSW\ LIDSSOLFDEOH 
Compression Devices
&KHFNWKDWWRPRDQGWXEHDQJXODWLRQLVGLVDEOHGLIHKFRPSUHVVLRQGHYLFHLVQRWSDUNHG
&KHFNWKDWVFDQQLQJDQGWDEOHPRYHPHQWVDUHGLVDEOHGZKHQWKHFRPSUHVVLRQGHYLFHLVLQ
FRQWDFWZLWKDSDWLHQW
VRT Tables:
'HSUHVVWKHWDEOHORFNIRRWSHGDOWRWKHILUVWSRVLWLRQ
9HULI\WKDWWKHWRSPRYHVIUHHO\LQWKHORQJLWXGLQDOGLUHFWLRQRQO\ ODWHUDOGLUHFWLRQ
UHPDLQVORFNHG 
'HSUHVVWKHWDEOHORFNIRRWSHGDODOOWKHZD\GRZQ
9HULI\WKDWWKHWRSLVIUHHIORDWLQJLQDOOGLUHFWLRQV
5HOHDVHDQGYHULI\WKDWWKHWRSLVORFNHGLQDOOGLUHFWLRQV
$WWKHFROOLPDWRU
'HSUHVVDQGKROGWKHYHUWLFDOORFNEXWWRQ
9HULI\WKDWWKHWXEHDUPPRYHVXSDQGGRZQIUHHO\
5HOHDVHWKHEXWWRQDQGLQVXUHWKDWWKHDUPLVORFNHGLQSODFH
'HSUHVVDQGKROGWKHDQJXODWLRQORFNEXWWRQ
9HULI\WKDWWKHWXEHDQGFROOLPDWRUURWDWHVIUHHO\DERXWWKHKRUL]RQWDOD[LV
5HOHDVHDQGLQVXUHWKDWWKHWXEHLVORFNHGLQSODFH
'HSUHVVDQGKROGWKHFROXPQURWDWLRQEXWWRQ7KHFROXPQVKRXOGURWDWHIUHHO\WRWKH
KHDGHQGDQGWKHIRRWHQGRIWKHWDEOH
5HOHDVHWKHEXWWRQDQGLQVXUHWKDWWKHFROXPQLVORFNHGLQSODFH
'HSUHVVDQGKROGWKHGULYHWRKHDGEXWWRQ9HULI\WKDWWKHWXEHVWDQGGULYHV
VPRRWKO\DQGVWRSVDWWKHEXFN\¶VHQGRIWUDYHO

1-39
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

FUNCTIONAL CHECK TOMO 2/3 XPM-150


job card: DEDICATED TOMO TABLES
'HSUHVVVZLWFKDJDLQ9HULI\WKDWWKHWXEHVWDQGGULYHVWRWKHOLPLWVZLWFKDWWKHHQG
RIWKHWXEHVWDQGUDLO
5HSHDWXVLQJWKHGULYHWRIRRWSXVKEXWWRQ
8VLQJWKHVOLGHRXWRSHUDWRUFRQWURORQWKHWDEOH
'HSUHVVDQGKROGWKH7RPREXWWRQXQWLOWKHWXEHVWDQGVWRSVGULYLQJDQGWKH7RPR
OLJKW
LVRQVWHDG\
9HULI\WKDWWKHEXFN\LVFRXSOHGWRWKHWXEHVWDQG

RTE, RTI, RTP, RTT Tables:


'HSUHVVIRRWSHGDODQGYHULI\WKDWWKHWDEOHWRSIORDWVLQDOOGLUHFWLRQV
5HOHDVHSHGDODQGYHULI\WKDWWKHWRSLVORFNHGLQDOOGLUHFWLRQV
)RU57(YHULI\ERWKSHGDOV
'HSUHVVDQGKROGWKHEXFN\ORFNUHOHDVHEXWWRQDWWKHIRRWHQGRIWKHEXFN\
9HULI\WKDWWKHEXFN\PRYHVIUHHO\IURPWKHKHDGWRWKHIRRWHQGRIWKHWDEOH
5HOHDVHEXWWRQDQGYHULI\WKDWWKHEXFN\LVORFNHGLQSRVLWLRQ
)RU57(
'HSUHVVWKHXSIRRWSHGDODQGWKHYHUWLFDOGULYHHQDEOHVZLWFKRQWKHEXFN\
9HULI\WKDWWKHWDEOHGULYHVXSDQGVWRSVDWWKHH[SRVXUHSRVLWLRQ
/HWRIIWKHIRRWSHGDODQGGHSUHVVDJDLQ
9HULI\WKDWWKHWDEOHGULYHVWRWKHXSSHUOLPLWSRVLWLRQDQGVWRSV
1RIXUWKHUXSZDUGGULYHLVSRVVLEOH
5HSHDWZLWKWKHGRZQIRRWSHGDO
9HULI\WKDWWKHGULYHVWRSVDWWKHH[SRVXUHSRVLWLRQDQGWKHORZHUOLPLW
SRVLWLRQ
For non–GEMS systems,UHIHUWR2(0VHUYLFHGRFXPHQWDWLRQ
)RU577DQG57,DOVR
$WWKHFROOLPDWRUGHSUHVVDQGKROGWKHYHUWLFDOORFNEXWWRQ
9HULI\WKDWWKHWXEHDUPPRYHVIUHHO\XSDQGGRZQ
5HOHDVHEXWWRQDQGYHULI\WKDWWKHDUPLVORFNHGLQSODFH
'HSUHVVDQGKROGWKHDQJXODWLRQORFNEXWWRQ
9HULI\WKDWWKHWXEHDQGFROOLPDWRUURWDWHVIUHHO\DERXWWKHKRUL]RQWDODUP
D[LV
5HOHDVHEXWWRQDQGYHULI\WKDWWKHWXEHLVORFNHGLQSODFH
'HSUHVVWKHORQJLWXGLQDOORFNEXWWRQ
9HULI\WKDWWKHWXEHVWDQGPRYHVIUHHO\IURPWKHKHDGWRWKHIRRWHQGRIWKH
WDEOH
'HSUHVVWKHEXWWRQDJDLQDQGYHULI\WKDWWKHWXEHVWDQGLVORFNHGLQSRVLWLRQ

1-40
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

FUNCTIONAL CHECK TOMO 3/3 XPM-150


job card: DEDICATED TOMO TABLES
7HOHYL[7HOHJHP
9HULI\WDEOHWRSGULYHLQDOOGLUHFWLRQV
9HULI\RWKHUWDEOHPRYHPHQWV
&HQWHUWKHV\VWHP 7±YLDWKHV\VWHPFHQWHUVZLWFK
&HQWHUWKH7RPRSKDQWRPLQWKHH[SRVXUHDUHD
6HOHFWDXWRFROOLPDWLRQ
6HOHFWRQILOPIRUPDW
6HOHFWDSODQHRIFXW
6HOHFWDFXWKHLJKWWRDSSUR[LPDWHO\FHQWHURIWKHSKDQWRP
2EVHUYHWKHSODQHKHLJKWGLVSOD\ 7±PXVWEHDERYHPP 
3XWDFDVVHWWHLQWKHEXFN\DQGUXQWKHWUD\LQ
6HWWKHJHQHUDWRUWRN9SDQGP$V

3UHSWKH7RPRDUP
3UHSWKHURWRUVDQGREVHUYHWKHEXFN\FDUULDJHGULYHDQGJULGRSHUDWLRQ
([SRVHWKHILOP
2EVHUYHWKHV\VWHPRSHUDWLRQDQGPRYHPHQWIRUVPRRWKGULYHRUVLJQVRISUREOHPV
3URFHVVWKHILOPDQGYHULI\SURSHU7RPRRSHUDWLRQ
1RDEQRUPDOYDULDWLRQVRIGHQVLW\
FODULW\RISODQHRIFXWDUHD
SURSHUFXWKHLJKW
DOODUHDVRXWRIWKHSODQHRIFXWEOXUUHGRXW
5HWXUQWKHV\VWHPWRQRUPDOQRQ±7RPRPRGH
3UHVWLOL[6\VWHPV
9HULI\WKHFROOLVLRQVHQVRURSHUDWLRQV
9HULI\WKH6XGGHQ0RYHPHQW6DIHW\&LUFXLWE\WKHIROORZLQJ
7XUQSRZHURIIWRWKHWDEOHDQGUHPRYHWKH$ERDUG
5HVWRUHSRZHUWRWKHWDEOH
$WWHPSWLQJDOHIWVFDQVKRXOGGLVDEOHSRZHUWRWKHWDEOH
$WWHPSWDULJKWVFDQ
7XUQSRZHUWRWKHWDEOHRIIDJDLQ
5HLQVWDOOWKH$ERDUGDQGUHPRYHWKH$$ERDUG
5HVWRUHSRZHUDQGWU\WKHWHVWDJDLQ

1-41
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

FUNCTIONAL CHECK TOMO 1/1 XPM-152


job card: TOMO OPTION
subassembly: ORDOGRAPH (GE) / TOMOLINK date: 11/99
purpose: Functional check of the tomo option. time: 10 min.
NOTE: Films are not required unless the customer is complaining of film quality.
The frequency of mechanical chacks is once every 12 months.
PREREQUISITES
7RROVUHTXLUHG +DQGWRROVDQG7RPRSKDQWRP
TASK DESCRIPTION
Procedure:
NOTE: For non–GEMS systems, refer to OEM service documentation as required.
6HWWKHWXEHVXSSRUWDWLWVODWHUDOGHWHQWRYHUWKHEXFN\
7KHFROOLPDWRUOLJKWVKRXOGEHFHQWHUHGODWHUDOO\
,ID±KDQJHULVSUHVHQWUHOHDVHWKHDQJXODWLRQORFNDQGGHWHQW
0RXQWWKHIXOFUXPEUDFNHWWRWKHUDLODWWKHUHDURIWKHWDEOH
7KHUHVKRXOGEHLQGLFDWRUVVKRZLQJZKHUHWRPRXQWWKHEUDFNHW
8QORFNWKHEXFN\DQGFHQWHULWRQWKHIXOFUXPEUDFNHW
/HDYHLWXQORFNHG7KHORFNVKRXOGDOORZWKHEXFN\WRPRYHIUHHO\
6HWWKH6,'RIWKHWXEHVXSSRUWDWI PP DQGFHQWHULWRYHUWKHEXFN\
7KH6,'LQGLFDWRURQWKHWXEHVXSSRUWVKRXOGEHHDVLO\UHDG
&RQQHFWWKHWXEHDUPWRWKHWXEHVXSSRUWLIDVHSDUDWHWXEHDUPLVXVHG
7KHWXEHDUPNQREWKUHDGVVKRXOGEHJRRGDQGWKHLQVWDOOHGDUPVKRXOGEHULJLG
&RQQHFWWKHOLQNDJHEDUWRWKHWXEHVXSSRUWDQGWKHEXFN\PDNLQJVXUHWKHIXOFUXPSLYRWLV
HQJDJHGZLWKWKHOLQNDJHEDU
7KHOLQNDJHEDUVKRXOGEHHDV\WRLQVWDOODQGEHSDUDOOHOWRWKHIXOFUXPEUDFNHW
7XUQWKHFUDQNRQWKHIXOFUXPEUDFNHWXQWLOWKHSRLQWHULVDW³´
7KHVPDOOGLDODWWKHKDQGOHVKDOODOVRUHDG³´
:LWKWKHWXEHVXSSRUWFRXSOHGWRWKHEXFN\FHQWHUWKHWXEHXQLWRYHUWKHEXFN\
3XVKWKH³RQ´EXWWRQRQWKHFRQWURO
7KHUHPD\EHDVOLJKWGHOD\GXULQJZKLFKWKHPRWRUURWDWHVWKHFDPWRWKH³´SRVLWLRQ
:KHQWKHFDPLVUHVHWWKH2UGR³RQ´OLJKWZLOOOLJKW
$WWKHVDPHWLPHD³FOLFN´VKRXOGEHKHDUGLQGLFDWLQJWKDWWKHFOXWFKKDVHQJDJHG
'HSUHVVDQGKROGWKH³SUHSDUH´EXWWRQ
7KHWXEHVXSSRUWVKRXOGWUDYHOI PP WRZDUGVRQHHQGRIWKHVWDWLRQDU\
UDLOV
7KHSUHSDUHOLJKWVKRXOGOLJKWDQGUHPDLQRQ
$IWHUIXQFWLRQDOFKHFNLVGRQHSHUIRUPDUDGLDWLRQWHVWXVLQJWKH7RPRSKDQWRPZLWKWKH
V\VWHPLQWKH7RPRPRGH
&KHFNWKHILOPVIRUDJRRGVKDUSLPDJHDQGWKDWWKH7RPRSODQHLVFXWWLQJDWWKHFRUUHFW
OHYHO

1-42
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

FUNCTIONAL CHECK 1/1 XPM-160


job card: FUNCTIONAL CHECK
subassembly: FILMCHANGERS AND STEPPERS date: 11/98
purpose: To perform a functional check on filmchangers time: 15 min.
and/or table top steppers
TASK DESCRIPTION
NOTE: 8VHIUHVKILOPWRGRWKHVHUXQV
)LOPFKDQJHUVZLWKRXWDVWHSSHU
7XUQRQWKHILOPFKDQJHU
6HWXSN9SDQGP$
%ULQJWKHILOPFKDQJHULQWRWKHILHOGWRH[SRVHWKHILOP
/LQHXSWKHWXEHXQLWZLWKWKHILOPFKDQJHUZLWKWKHOLJKWIURPWKHFROOLPDWRU
7KHFROOLPDWRUVKRXOGEHLQDXWR
$GYDQFHDILOPWRWKHH[SRVHSRVLWLRQ
([SRVHDILOPDQGYHULI\ILOPFRYHUDJH
6HOHFWDFRXSOHRIILOPVWRSURFHVV LIGRQHLQSUHYLRXVVWHS WRYHULI\WKDWWKHUHDUH
QR
VFUDWFKHVEHQWFRUQHUVRULQGLFDWLRQVRISUREOHPV
38&.DQG6(3V\VWHPV
&OHDQUROOHUVDQGILOPSDWKV
&KHFNEDFNXSEDWWHU\LQFRQWUROOHU UHSODFHHYHU\\HDUV 
&KHFNILOPVHQVRUDQGPDJD]LQHVHQVRUVZLWFKHV
9HULI\ILOPFRXQWHU
6\VWHPZLWKDVWHSSHU
(QDEOHDQGSUHSDUHWKHVWHSSHU
6HWXSWKHN9SRUWKHP$VVWHSSHU ZKLFKHYHULVDSSOLFDEOH 
6HOHFWN9SDQGP$
)RU/8V\VWHPV
/PXVWEHDWGHJUHHV
7DEOHPXVWEHFHQWHUHG
ODWHUDOO\
UDWLRQDOO\
7DNHDUXQZLWKWZRH[SRVXUHVSHUVWHSH[SRVLQJWKHILOP
9HULI\WKDWWKHWDEOHVWHSVVPRRWKO\
2EVHUYHFKDQJLQJRIN9SP$VE\ZDWFKLQJ
&RQVROH UHDGRXW
9ROWSDFFKDQJH YLVXDORUPHWHURQQRORDGV
3URFHVVLQJDOOILOPV
6HOHFWDFRXSOHRIILOPVWRSURFHVV LIQRWGRQHLQSUHYLRXVVWHS WRYHULI\WKDWWKHUHDUHQR
VFUDWFKHVEHQWFRUQHUVRULQGLFDWLRQVRISUREOHPVRQWKHILOPIURPWKHUXQ

1-43
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

LAMPS and INTERLOCKS RAD 1/4 XPM-170


job card: RAD INDICATOR LAMPS AND INTERLOCKS
subassembly: GENERATORS date: 05/01/95
COLLIMATORS
TUBES
purpose: Check all indicator lamps and verify system time: 10 min.
interlocks.
PREREQUISITES
7RROVUHTXLUHG /DPSVDQG+DQGWRROV
TASK DESCRIPTION
Procedure:
&KHFNJHQHUDWRUFRQVROH QRWDSSOLFDEOHIRU$GYDQW[ IRUEXUQHGRXWODPSVE\VHOHFWLQJDOO
IXQFWLRQVDQGUHSODFHDVQHHGHG,IWURXEOHVKRRWLQJLVUHTXLUHG\RXPD\QHHGWR
VFKHGXOHDGGLWLRQDOWLPH
03*JHQHUDWRUV
7RHQWHUVHOI±WHVWKROGGRZQWKHVPDOOIRFDOVSRWWHFKQLTXHDQG.9± .9PLQXV
NH\VVLPXOWDQHRXVO\IRUVHF 5HSHDWWRH[LW
7RWURXEOHVKRRWXVH$60FKDSWHUMREFDUG9)
03*(JHQHUDWRUV
3ULRUWRWXUQLQJRQSRZHULQVWOOWKHFPVHUYLFHFDEOH & LQVHULHVZLWKWKH
FRQVROHFDEOH
7XUQRQWKHV\VWHPDOOSXVKEXWWRQVVKRXOGOLJKWDQGDQ´5´ZLOOEHLQWHUPLWWHQWO\
DSSHDURQWKHOHIWGLVSOD\ )RUDEQRUPDOGLVSOD\VVHHWKH,0(;PDQXDO
3UHVVERWKPRGHVHOHFWEXWWRQVMXVWDERYHWKHGLVSOD\ VHUYLFHEXWWRQV  
7KHLQGLFDWRUODPSVZLOOJRRXWDQGZLOOOLJKWDORQJZLWKWKHDVRXOGLISUHVVHGLQ
FRQMXQFWLRQZLWKWKHVHUYLFHEXWWRQ
7XUQRIISRZHUDQGUHPRYHWKHVHUYLFHFDEOH
3URJUDP;SXVKEXWWRQODPSVDQGWURXEOHVKRRWZLWKMREFDUG9)
3KDVL[JHQHUDWRUV
$OOEXWWRQVVKRXOGOLJKWGXULQJV\VWHPSRZHUXS
0DVL[JHQHUDWRU
3UHVVWKHOW!EXWWRQWRYHULI\DOOGLVSOD\VHJPHQWV
0930LFURJHQHUDWRU
(QWHU´&DO0RGH´E\VHWWLQJVZLWFK3WRRQDQGVZLWFKHV3DQG3RI6:RQ
WKH06$$PRWKHUERDUG
(QWHUGDWD´´LQDGGUHVV&
$XWR7HVWPHVVDJHZLOOEHGLVSOD\HG
3UHVVWKH$(&EXWWRQWRVWDUW
9HULI\WKDWWKHGLVSOD\VIRURQDQGRIILQWKHIROORZLQJVHTXHQFH
6HW/RZ7HFK5HDG\7HFK2/;65RWRU216,';/7XEH
$(&21$(&5HVHW6,'7XEH

1-44
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

LAMPS and INTERLOCKS RAD 2/4 XPM-170


job card: RAD INDICATOR LAMPS AND INTERLOCKS
subassembly: GENERATORS date: 05/01/95
COLLIMATORS
TUBES
purpose: Check all indicator lamps and verify system time: 10 min.
interlocks.
093DQG06;JHQHUDWRUV
3ULRUWRWXUQLQJRQSRZHUVHWWKHIROORZLQJVZLWFKHVRQWKHFRQVROHPLFURSURFHVVRU
ERDUG
093±VZLWFKRI6:WRRII
06;±VZLWFKRI6:WRRII
7XUQRQ3RZHU
1RZVZLWFKWKHIROORZLQJRQWKHFRQVROHSURFHVVRUERDUG
093±VZLWFKRI6:WRRII
06;±VZLWFKRI6:WRRII
9HULI\DOOGLVSOD\V
5HWXUQV\VWHPWRQRUPDODQGFKHFNIRUSURSHURSHUDWLRQDIWHUF\FOLQJV\VWHPSRZHU
Other products including non–GE systems:
&KHFNIRUOHJLELOLW\RILQGLFDWRUV
9HULI\WKDWVZLWFKHVDSSHDUWREHZRUNLQJ
9HULI\WKDWWXEHVHOHFWODPSVRSHUDWHDQGWKDWFDELQHW³RQ´ODPSVDUHOLW
9HULI\QRH[SRVXUHLVSRVVLEOHZLWKGRRULQWHUORFNRSHQLIDSSOLFDEOH
9HULI\RSHUDWLRQRIWKH[±UD\LQGLFDWRUODPSRXWVLGHWKHURRPGRRU
9HULI\QRH[SRVXUHDERYHN9SLVSRVVLEOHZLWK0DPPRILOWHUSXOOHGRXW
9HULI\RSHUDWLRQRIDOOOLPLWVZLWFKHVRQDOOWUDYHODQGWKDW\RXGRQRWKLWIORRUFHLOLQJRUZDOOV
Note:/LPLWVDUHVSFHLDOO\LPSRUWDQWRQUHPRWHV\VWHPV
&KHFNDOOSURWHFWLYHUXEEHUIODSVDQGP\ODUDUHFRUUHFWO\LQSODFH
9HULI\FROOLPDWRUODPSWXUQVRQDQGWLPHUKROGVODPSRQIRUDSSUR[LPDWHO\±VHFRQGV
&KHFNWKDW;±UD\ILHOGLVFOHDUO\GHILQHGLQDIXOO\LOOXPLQDWHGURRP ,ILQGRXEWYHULI\
OLJKWRXWSXWSHUVHUYLFHPDQXDO±GHIHULIQHFHVVDU\
6HWJHQHUDWRUFRQVROHWRORZHVWSRVVLEOHN9SP$DQGWLPHVHWWLQJV
7DNHDQH[SRVXUHDQGYHULI\WKDWWKHUHLVDYLVXDODQGDXGLRWRQHIRU[±UD\
&KHFNHUURUORJVIRULQGLFDWLRQVRISUREOHPV
5HDGWXEHFRXQWHUVDQGQRWHLQORJERRN
&KHFNDOOWKHHPHUJHQF\VWRSEXWWRQV,IDIDXOWLVIRXQGQRWLI\WKHFXVWRPHULIDVVLVWDQFHLV
QHHGHGIRUUHSDLU

1-45
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

LAMPS and INTERLOCKS RAD 3/4 XPM-170


job card: RAD INDICATOR LAMPS AND INTERLOCKS
subassembly: GENERATORS date: 05/01/95
COLLIMATORS
TUBES
purpose: Check all indicator lamps and verify system time: 10 min.
interlocks.
5(027(6<67(06
9HULI\WKDWWKHSURSHUPRYHPHQWVDUHGLVDEOHGZKHQWKHFRPSUHVVLRQGHYLFHLVQRWSDUNHG
LIHTXLSSHG
,IWKHV\VWHPLVFDSDEOHRIPRYLQJVRWKDWWKHWXEHLVQRWDOLJQHGWRWKHUHFHSWRUYHULI\WKDW
IOXRURLVGLVDEOHGLIQRWFHQWHUHG
3UHVWLOL[±$QJLR 0RYHPHQW 6DIHW\
6DIHW\FLUFXLWRQERDUGSURWHFWVIURPXQZDQWHGPRYHPHQWE\UHPRYLQJSRZHU
7HVWLQJWKLVRSHUDWLRQUHTXLUHVWKH&,WHVWWRRO6WDUWZLWKDOO&,WHVWVZLWFKHVLQ
QRUPDO$IWHUHDFKWHVW\RXZLOOQHHGWRUHWXUQWKHVZLWFKWRQRUPDODQGUHF\FOH
SRZHU)RUDOOSRWHQWLRPHWHUWHVWV\RXZLOOQHHGWRUHPRYHSRZHUIURPWKHWDEOH
EHIRUHVHWWLQJVZLWFKHV  
)XQFWLRQ 6ZLWFK 0RYHPHQW 3RZHU&XW±RII
Column Safety
0RYHFRQWURO  QR LQVWDQW
3RVLW(UURU  \HV LQVWDQW
3RWHQWLRPHWHU  \HV GHOD\HG
Carriage Safety
0RYHFRQWURO  QR LQVWDQW
3RVLW(UURU  \HV LQVWDQW
3RWHQWLRPHWHU  \HV GHOD\HG
Tilt Safety
0RYHFRQWURO  QR LQVWDQW
3RVLW(UURU  \HV LQVWDQW
3RWHQWLRPHWHU  \HV GHOD\HG
Long. Tabletop Safety
0RYHFRQWURO  QR LQVWDQW
3RVLW(UURU  \HV LQVWDQW
3RWHQWLRPHWHU  \HV GHOD\HG
)RUWKH$1*,2V\VWHPXQORFNWKHFKDQJHUDQGPRYHLWRXWDIHZFHQWLPHWHUV7KHWLOW
FRPPDQGVKRXOGEHGLVDEOHG

1-46
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

LAMPS and INTERLOCKS RAD 4/4 XPM-170


job card: RAD INDICATOR LAMPS AND INTERLOCKS
subassembly: GENERATORS date: 05/01/95
COLLIMATORS
TUBES
purpose: Check all indicator lamps and verify system time: 10 min.
interlocks.
3UHVWLOL[6XGGHQ0RYHPHQW6DIHW\&KHFN
7XUQRIIWDEOHSRZHU
5HPRYHWKH$ERDUG IRUV\VWHPVZLWKFRXQWHUZHLJKWVUHPRYHIXVH)
7XUQRQSRHZHUDQGDWWHPSWDOHIWVFDQPRYHPHQW
3RZHUVXSSO\VKRXOGFXWRII
5HSHDWWKHWHVWIRUWKHULJKWPRYHPHQWE\UHPRYLQJWKH$ERDUG RUIRU
V\VWHPVZLWKFRXQWHUZHLJKWVUHPRYHIXVH)
5HWXUQV\VWHPWRQRUPDO
)XWXUDOL[8QGHVLUHG0RYHPHQW3URWHFWLRQ
6DIHW\FLUFXLW&LVWRGHWHFWPRYHPHQWQRWFRQWUROOHGE\WKHRSHUDWRUDQGSURWHFWHG
E\RSHQLQJWKHWDEOHEUHDNHU\RXPXVWUHVWRUHWKHV\VWHPE\UHF\FOHSRZHU
EHWZHHQHDFKWHVW

)XQFWLRQ )DXOW6LPXODWLRQ /('/LJKWV


7LOW 5HPRYHZLUHRQ;FRQWDFWRU '
&DUULDJH 5HPRYHZLUHRQ;FRQWDFWRU '
/RQJ7RS 5HPRYHZLUHRQ;FRQWDFWRU '
6,' 5HPRYHZLUHRQ;FRQWDFWRU '
&ROXPQ 8QVROGHUGLRGHV'DQG'
6WDUWUDGLDWLRQDWIRRUGLUHFWLRLQ '
6WDUWUDGLDWLRQDWKHDGGLUHFWLRQ '
3RWVDIHW\ 'LVFRQQHFW35$SOXJIURPSRW '
5HVWRUHV\VWHPWRQRUPDO

1-47
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

LAMPS and INTERLOCKS R&F 1/1 XPM-172


job card: R&F INDICATOR LAMPS AND INTERLOCKS
subassembly: SPOT-FILM DEVICE date: 11/98
FLUORO CONTROLS
purpose: Check all indicator lamps and verify system time: 5 min.
interlocks.
PREREQUISITES
7RROVUHTXLUHG /DPSV
+DQGWRROV
3HUIRUPMREFDUG;30±EHIRUHGRLQJWKLVMREFDUG

TASK DESCRIPTION
Procedure:
&KHFNIRUEXUQHGRXWODPSVRQDOOWKHIOXRURFRQWUROVUHSODFHLIQHHGHG
&KHFNIRUEXUQHGODPSVRQWKHVSRW±ILOPGHYLFHFRQWUROV5HSODFHLIQHHGHG
0DNHVXUHWKDWQRH[SRVXUHLVSHUPLWWHGZKHQWKH6)'LVPRYHGWRZDUGVWKHSDUNSRVLWLRQ
Legacy Systems
9HULI\GLVSOD\RSHUDWLRQYHULI\WKHGLVSOD\URWDWHVZKHQWKHWDEOHLVDQJXODWHGEH\RQG
GHJUHHV

1-48
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY
X–RAY PLANNED
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO GENERAL ELECTRIC COMPANY X–RAY PLANNED MAINTENANCE
REV 16
15 DIRECTION 46–019510
46–019510
5(9
REV 17 ',5(&7,21±
DIRECTION

LAMPS and INTERLOCKS VASC 1/1 XPM-174


job card: VASC INDICATOR LAMPS AND INTERLOCKS
subassembly: DISPLAYS date: 05/01/95
STATUS CONTROL
STEPPER DISPLAY
FILM CHANGER INTERLOCKS
COLLISION INTERLOCKS
COLLISION AVOIDANCE
purpose: Check all indicator lamps and verify system time: 5 min.
interlocks.
PREREQUISITES
3HUIRUPMREFDUG;30±DQG;30±EHIRUHGRLQJWKLVMREFDUG

TASK DESCRIPTION
Procedure:
&KHFNDOOGLVSOD\VIRUSURSHULQWHQVLW\DQGWKDWDOOVHJPHQWVDUHLOOXPLQDWHG
&KHFNDOOVWDWXVFRQWUROV WDEOHDQGVWHSSHU 
&KHFNWKDWWKHEXWWRQVIXQFWLRQ
&KHFNWKDWDOOEXWWRQVDUHLOOXPLQDWHG
&KHFNILOPFKDQJHULQWHUORFNV
&KDQJHUVKRXOGLQGH[DW]HURDQGGHJUHHV
([SRVXUHVKRXOGRQO\EHSRVVLEOHDWDQGGHJUHHV
9HULI\WKDWWKH/8±$³8´DUPZLOORQO\URWDWHSDVWGHJUHHVZKHQWKHWDEOHLVURWDWLRQDOO\
FHQWHUHG
9HULI\WKDWQRH[SRVXUHLVSRVVLEOHGXULQJILOPFKDQJHULQWHUFKDQJHRQ/8±$
9HULI\WKDW/8±$LQWHUFKDQJHFROOLVLRQVHQVRUZRUNV
9HULI\WKDWWKHFROOLVLRQVHQVRUVRQWKHERWWRPRIDOO,,¶VDUHIXQFWLRQDO
9HULI\WKDWWKHFROOLVLRQVHQVRUVRQWKH[±UD\WXEHDQGFROOLPDWRUVDUHZRUNLQJ
9HULI\WKDWFROOLVLRQDYRLGDQFHRQ/&/3V\VWHPVDUHZRUNLQJ

1-49
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

GENERATOR PERFORMANCE
TABLE OF CONTENTS

JOB CARD TITLE PAGE

;30± 78%(3527(&725  ±

;30± 52725&21752//(5;±5$<78%(  ±

;30± 5$',2*5$3+,&7,0(5  ±

;30± 5$',2*5$3+,&.93  ±

;30± 5$',2*5$3+,&0$0$6  ±

;30± 121±92/$7,/(0(025<'$7$$1'%$77(5<92/7$*(  ±

;30± 5$'&2//,0$7,21$1'3+2727,0,1*  ±

;30± 5 )&2//,0$7,21$1'3+2727,0,1*  ±

;30± 0$18$/&2//,0$7256  ±

±L
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

7+,63$*(,17(17,21$//</()7%/$1.

±LL
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

*(1(5$7256 -RE&DUG;30± RI

MREFDUG TUBE PROTECTOR

VXEDVVHPEO\ *(1(5$725&21752/ GDWH

SXUSRVH 7RFKHFNWKHPD[LPXPDOORZDEOHH[SRVXUHWHFKQLFV WLPHPLQ


DJDLQVWWKHWXEHUDWLQJFKDUWV

NOTE: This job card/task is not required on Advantx Generators.

PREREQUISITES
;±UD\WXEHWHFKQLFFKDUWVDYDLODEOH

TASK DESCRIPTION
&KHFNWKHPD[LPXPDQGPLQLPXPWXEHWHFKQLFVDJDLQVWWKHWXEHUDWLQJVFKDUWIRUHDFKWXEH
LQWKHV\VWHP7KLVLVPRUHOLNHO\WRGULIWLQROGHUQRQ&38EDVHGV\VWHPV
0LFURSURFHVVRUEDVHGV\VWHPVVKRXOGQRWFKDQJH
Procedure:
6HOHFWPHGLXPN9SDQGKLJKHVWP$VWDWLRQ
6HOHFWPV RUDVFORVHDVSRVVLEOH DQGLQFUHDVHN9SXQWLODWHFKQLFRYHUORDGLVUHDFKHG
RUWKHJHQHUDWRUDXWRPDWLFDOO\FKDQJHVP$RUWLPH
5HSHDWWKLVIRUPVVHFDQGVHF
5HSHDWWKLVIRUWKHVPDOOIRFDOVSRW
9HULI\WKDWH[SRVXUHVDUHQRWHQDEOHGDERYHWKHFXUYHRQWKHFKDUWIRUWKHJLYHQP$
,IWKHUHLVDVLJQLILFDQWGLIIHUHQFHEHWZHHQWKHWHFKQLFFKDUWDQGWKHDFWXDODOORZDEOHWHFKQLF
E\WKHJHQHUDWRUWKHQWKHWXEHSURWHFWRUZLOOKDYHWREHVFKHGXOHGIRUDGMXVWPHQWRU
KDYHWKHPHPRU\ORFDWLRQVFKHFNHG,IWKHWXEHSURWHFWRULVRYHUSURWHFWLQJFRQVXOW
ZLWKWKHFXVWRPHUEHIRUHFKDQJLQJ7KH\PD\ZDQWWKLVVHWXS

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG TUBE PROTECTOR -RE&DUG;30± RI

Advantx Generators (Not Required)


CGR
6RPH&*5JHQHUDWRUVZLOOQHHGWRKDYHWKH³.:´YHULILHGRQWKHJHQHUDWRU

MPH Generator
,QDFFRUGDQFHZLWK61LI\RXKDYHDQ0;;57FKHFNWKHYDOXHVIRUWKH0;
+LJK6SHHGVPDOOVSRWILODPHQWLQ-RE&DUG5*6PDOOIRFXVSDUDPHWHUV
VKRXOGEH
* 
( 
$/3+ 
&KDQJHWKHVHLIQRWFRUUHFWDQGSHUIRUP5*+HDW&XUUHQW&DOLEUDWLRQIRUWKH
6PDOO)RFXV
GE
*(JHQHUDWRUVXVHVSHFLILFEUHDNSRLQWVWRGHYHORSWKHWXEHSURWHFWRUFXUYHV

MPX Generators
7KH03;JHQHUDWRUKDVQHZUHYLVHGWXEHFXUYHVSHU617KHQHZYDOXHVVKRXOGEH
HQWHUHGLQWRWKH03;GDWDEDVHE\HLWKHUXVLQJWKH03;'DWD%DVH7RRO5HYRU
KLJKHURUE\PDQXDOO\ORDGLQJLQWKHQHZYDOXHV61FRQWDLQVWKHFRUUHFWYDOXHV
IRUDOOFRPPRQO\XVHG*(WXEHV
For non–GE Systems
)RUQRQ±*(V\VWHPVUHIHUWR2(0VHUYLFHGRFXPHQWDWLRQDVUHTXLUHG

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

*(1(5$7256 -RE&DUG;30± RI

MREFDUG ROTOR CONTROLLER/X–RAY TUBE

VXEDVVHPEO\ 52725&21752//(5;±5$<78%( GDWH

SXUSRVH 9HULI\SURSHUURWDWLRQRI[±UD\WXEHDQGEHDULQJQRLVH WLPHPLQ

PREREQUISITES
6\VWHPLVRSHUDWLQJSURSHUO\

TASK DESCRIPTION
Procedure:
2EVHUYHDQGQRWHWKHEHDULQJQRLVHGXULQJWKHDFFHOHUDWLRQDQGEUDNLQJSHULRGV
&KHFN /LVWHQ WKDWWKHDFFHOHUDWLRQDQGEUDNLQJWLPHVDUHW\SLFDOIRUWKHWXEHVXVHG,I
QHHGHGFKHFNWLPLQJZLWKDVFRSH
,IDQ\SUREOHPVDUHHQFRXQWHUHGWKHQVFKHGXOHWKHURRPIRUWURXEOHVKRRWLQJUHSDLURU
FDOLEUDWLRQRIWKHURWRUFRQWUROOHU
7KHQRWHGDFFHOHUDWLRQDQGEUDNLQJWLPHVDUHW\SLFDO
&KHFNWXEHKRXVLQJVIRUSURSHUYHQWLODWLRQ

Chiller
&KHFNIRUSURSHUZDWHUOHYHOVZDWHUOHDNVDQGSURSHUFKLOOHURSHUDWLRQ
&OHDQFKLOOHUSXPSVWUDLQHU&KHFNIRUSURSHUYHQWLODWLRQLQFKLOOHU
7HVWWKHWXEHVHQVRUVLIHTXLSSHGXVLQJWKHIROORZLQJCGRGR Chiller
&KLOOHUWHVW
7XUQRIISRZHU
'LVFRQQHFWLQJWKHGHJUHH&VHQVRU RQHRIWKH´($8´ZLUHVDW76RIWKH7,5& 
5HVWRUHSRZHU
6KXWRIIWKHZDWHUDQGWKHWKHUPRPHWHUODPSVKRXOGIODVKRQWKHFRQVROHRUDQHUURU
ZLOOEHGLVSOD\HG
&KLOOHUWHVW
7XUQRIISRZHU
'LVFRQQHFWWKH´6HFXULW\´ZLUHVRQ76RIWKH7,5&IRUWKHGHJUHH&VHQVRU
5HVWRUHSRZHU
7KHWKHUPRPHWHUODPSDQGWKHUHGLQKLELWODPSDWWKHFRQVROHVKRXOGEHRQRUDQ
HUURUZLOOEHGLVSOD\HG
5HPRYHSRZHUDQGUHVWRUHWKHV\VWHPWRQRUPDORSHUDWLRQ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG ROTOR CONTROLLER/X–RAY TUBE -RE&DUG;30± RI4

VAMP (MPPU) Chiller


3XOO;-RQWKHERWWRPRI03386LPXODWHVWKHGHJUHH&6HQVRUWULSLQWKH;57
&KLOOHUVKRXOGUXQ
5HSODFH;-
7HPSHUDWXUHVKRXOGEHDWGHJUHHV& GHJUHH3XVKGLVSOD\VZLWFKIRUVHWSRLQW

MVP, Advantx
7KHVHWLPHVDUHVRIWZDUHFRQWUROOHGDQGPD\YDU\GHSHQGLQJRQJHQHUDWRUVRIWZDUHUHYV

MVP Micro
6DPHDV03;IRUKLJKVSHHGV\VWHPV

MPX
9HULI\DSSUR[LPDWH6$5&DFFHOHUDWLRQDQGEUDNHWLPHVIRUHDFKWXEH
5$' 0; $FFHO VHF %UDNH VHF
0; VHF VHF
)/ 0; $FFHO VHF *%UDNH VHF
$OVRYHULI\VHFURWRUGHOD\
VHF *
0; $FFHO VHF %UDNH VHF
6)36 0; VHF 7LPHGHOD\XQWLOH[SRVXUHLQ
&,1( 0; ;0;/ VHF +6ERRVW
;66)7 VHF
0; VHF ([SRGHOD\IURPVWRSSHGURWRU
0; VHF 9HULI\VHFKLJKVSHHGKROG

MSI
7KH06,JHQHUDWRUFDQEHXVHGZLWKDYDULHW\RIURWRUFRQWUROOHUV&RQVXOWZLWKWKHVSHFLILF
URWRUFRQWUROOHUPDQXDOIRUPRUHGHWDLO
RARC–II
7<3,&$/$&&(/(5$7,21'(/$<6
6SHHG 0$;5 0$; 0$;
/RZ VHF VHF VHF
+LJK VHF VHF VHF

MST
7KH067JHQHUDWRUFDQEHXVHGZLWKDYDULHW\RIURWRUFRQWUROOHUV&RQVXOWZLWKWKHVSHFLILF
URWRUFRQWUROOHUPDQXDOIRUPRUHGHWDLO

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG ROTOR CONTROLLER/X–RAY TUBE -RE&DUG;30± RI

RARC–II 6HH06,
D32 Panel ,QWHUQDOURWRUFRQWUROOHUPRGXOHRQO\ ORZVSHHGRQO\
0D[LUD\WXEHV VHFRQGURWRUWLPHGHOD\
2WKHUFRPSDWLEOHWXEHV VHFRQGV
,IWKHUHLVDPL[WXUHRIWXEHVWKDWLQFOXGHD0$;WKHQDOOWXEHVZLOOKDYHD
VHFGHOD\

DXS 650 and DXD 350


0D[LUD\WXEHV VHFRQGURWRUWLPHGHOD\
2WKHUFRPSDWLEOHWXEHV VHFRQGV
,IWKHUHLVDPL[WXUHRIWXEHVWKDWLQFOXGHD0$;WKHQDOOWXEHVZLOOKDYHD
VHFGHOD\

MPG, Phasix, MP (all systems with TIRC)


5HPRYHSRZHU
5HPRYH´DX[LOODLUH´ZLUHIURP76LQWKH7,5&*UHHQZLUHWR;57
5HVWRUHSRZHUDQG3UHSWKHURWRUV
7KHFRQVROHVKRXOGGLVSOD\DQHUURUDQGH[SRVXUHVVKRXOGEHLQKLELWHG
5HPRYHSRZHUDQGUHLQVWDOOWKH´DX[LOODLUH´ZLUH
5HPRYHWKH´SULQFLSOH´ZLUHIURP76RIWKH7,5&%ODFNZLUHWR;57
5HVWRUHSRZHUDQGSUHSWKHURWRUV
7KHFRQVROHVKRXOGGLVSOD\DQHUURUDQGH[SRVXUHVVKRXOGEHLQKLELWHG
5HPRYHSRZHUDQGUHVWRUHWKHV\VWHPWRQRUPDORSHUDWLRQ

± ± ± ± ±


*(0;±     
*(0;±     
*(0;±     
0DFKOHWW
:02´     1$
:02´     1$
&*5±6/27 
*     1$
*     1$
*:02     1$
*     1$
WLPHVLQVHFRQGV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG ROTOR CONTROLLER/X–RAY TUBE -RE&DUG;30± RI

VAMP (MPPU)
± ± ± ± ±
0;9     
0;9     

MPH/SCPU Generators
WR/6 WR+6 /6WR+6 +6WR/6 +6WR /6WR
0$;      
WLPHVLQVHFRQGV
Systems with TUG starter
5HPRYHSRZHU
5HPRYH´DX[LOODLUH´ZLUHIURP7ELQWKH78*
5HVWRUHSRZHUDQG3UHSWKHURWRUV
7KHFRQVROHVKRXOGGLVSOD\DQHUURUDQGH[SRVXUHVVKRXOGEHLQKLELWHG
5HPRYHSRZHUDQGUHLQVWDOOWKH´DX[LOODLUH´ZLUH
5HPRYHWKH´SULQFLSOH´ZLUHIURP7ERIWKH78*%ODFNZLUHWR;57
5HVWRUHSRZHUDQGSUHSWKHURWRUV
7KHFRQVROHVKRXOGGLVSOD\DQHUURUDQGH[SRVXUHVVKRXOGEHLQKLELWHG
5HPRYHSRZHUDQGUHVWRUHWKHV\VWHPWRQRUPDORSHUDWLRQ
7LPHVFDQEHFKHFNHGLIQHHGHGZLWKDVFRSHRQRXWSXWRI$2S$
± ± ±
6ORW RKPV
:02   
*   
*   
*   
6ORW RKPV
*   
*   
0DFKOHWW-XQLRU6XSHU  
'\QPP RKPV   
'\QPP RKPV   
1RWH7LPHVDUHLQVHFRQGVDQGDUHEDVHGRQWKHFRUUHFWOLQHYROWDJH
Silhouette Generators
7XEHFKDUWVDUHLQWKHVHUYLFHPDQXDOV
All Other Systems
8VHWKHDSSURSULDWHVHUYLFHPDQXDOWRFKHFNIRUSURSHURSHUDWLRQ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

*(1(5$7256 -RE&DUG;30± RI

MREFDUG RADIOGRAPHIC TIMER

VXEDVVHPEO\ &21752/ GDWH

SXUSRVH &KHFNYHULI\WKH5$'WLPHUIRUDFFXUDF\ WLPHPLQ

NOTE: 30IUHTXHQF\IRU0303386&385DGLRJUDSKLFWLPHULV\HDU)RUDOORWKHUVWKH
30IUHTXHQF\LVPRQWKVXQOHVVLQGLFDWHGRWKHUZLVHLQWKHVSHFLILFSURGXFWPDQXDO
5$'WLPHLVFKHFNHGDWWKHSRLQWRQWKHN9SZDYHIRUP

5$'WLPHFDQEHFKHFNHGXVLQJWKH.HLWKOH\ MREFDUG;30± WKH+9GLYLGHU 7DE RU


DQLRQFKDPEHURURWKHUQRQ±LQYDVLYHN9SGHYLFH
6RPHJHQHUDWRUVKDYHRWKHUWHVWSRLQWVWKDWFDQEHXVHGWRFKHFNWKHWLPHU
7KHWLPHUVKRXOGEHFKHFNHGZKLOHGRLQJWKH5$'N9S MREFDUG;30± DQGRUWKHP$
MREFDUG;30± 
Turn off the Phototimer.

TASK DESCRIPTION
$OODFFXUDF\PHDVXUHPHQWVDUHEDVHGRQVSHFLILFSUHFRQGLWLRQV,IDGGLWLRQDOLQIRUPDWLRQLV
QHHGHGUHIHUWRWKHV\VWHPRSHUDWRU¶VPDQXDO

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RADIOGRAPHIC TIMER -RE&DUG;30± RI4

ADVANTX /);6&38030338 9DPS


8VHUDGPRGHRUFDOLEUDWLRQXQLW5/);++60HDVXUHPHQWV)RUVSHFLILFDWLRQV
UHIHUWRGLUHFWLRQ±6HFWLRQ±LQ7DERIWKLVPDQXDO
MVP 7KUHH3KDVH
0HDVXUHWKH5$'WLPHUXVLQJWKHN9SRXWSXW%1&LQWKHSRZHUXQLWLIDYDLODEOH
7LPHUDFFXUDFLHV
$WDQ\N9S
WKURXJKP$   PVHF
WKURXJKP$   PVHF
P$ XS
WRPVHF  ±PVHF
WRPVHF    PVHF
WRPVHF   PVHF
PVHFWRVHF  
MVP MICRO
7LPHUDFFXUDFLHV +] +]
OHVVWKDQVHF    
± VHF    
± VHF    
±VHF    
MPX
7LPHUDFFXUDFLHV
PVHFWRPVHF  PVHF
PVHFWRPVHF  PVHF
PVHFWRVHF  
5HMHFWLRQOLPLWV
VHF WR PVHF WR
VHF WR PVHF WR
PVHFWR PVHF WR
PVHFWR
MSI
6FRSHPD\DOVREHXVHGDFURVV5P$VERDUGRQVZLQJRXWSDQHO
6HOHFW N9S6 VHF  VHF
N9S/ VHF  VHF
N9S/ VHF  VHF
MST
6FRSHPD\DOVREHXVHGDFURVV5P$VERDUGRQVZLQJRXWSDQHO
6HOHFW N9S6 VHF  VHF
N9S/ VHF  VHF
N9S/ VHF  VHF

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RADIOGRAPHIC TIMER -RE&DUG;30± RI

MVP MICRO 60 Hz 50 Hz
6HOHFW VHF    
±    
±    
±    
DXS 650
6HOHFW N9S/ VHF SXOVH SXOVHV
N9S/ VHF SXOVHV SXOVHV
N9S6 VHF VHFZDYHIRUPRISXOVHV VHF
DXD 350
6HOHFW N9S/ VHF SXOVH SXOVHV
N9S/ VHF SXOVHV SXOVHV
N9S 6 VHF VHFZDYHIRUPRISXOVHV VHF
CGR
&KHFNZKLOHGRLQJP$FKHFNVZLWKVFRSH
6HHMREFDUG;30±
TITANOS
WRVHFDWN9SDQGP$ 
SEPTAR
  PV
WRVHF  PV
WRVHF  
COMPTAR
WRVHF ZLWKIRUFHGH[WLQFWLRQ  
WRVHF ZLWKRXWIRUFHGH[WLQFWLRQ  
)RU±P$DGG VHF
)RU±P$DGG VHF
)RU±P$DGG VHF
SPG
WRVHF /HVVWKDQVHF
WRVHF  VHF
WRVHF  
MPH
  IRUVHOHFWHGWLPHV
CPG
PVWRVHF  SURFHVV  PV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RADIOGRAPHIC TIMER -RE&DUG;30± RI

PHASIX & MPG


([SRVXUHWHUPLQDWLRQRFFXUVRQP$V
7LPHDFFXUDF\LVWKHVXPRIP$DQGP$VDFFXUDF\

TRIPLUNIX 5–7–10–MP and ABAQUE 525


8VLQJDRKP:UHVLVWRULQVHULHVZLWKWKH±0*EULGJHLQWKHFRQVROHDQGD
VFRSHDFURVVWKHUHVLVWRUVHOHFWP$DW.9DQGWHVWDQGVHFRQG
7ROHUDQFH

All other generators refer to the appropriate generator manual.


Turn Phototimer back on when completed.

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

*(1(5$7256 -RE&DUG;30± RI

MREFDUG RADIOGRAPHIC KVP

VXEDVVHPEO\ &21752/32:(581,7 GDWH

SXUSRVH 7RYHULI\SURSHUFDOLEUDWLRQRIWKHUDGLRJUDSKLFN9S WLPHPLQ


FLUFXLWV

NOTE: 30IUHTXHQF\IRU0303386&385DGLRJUDSKLFN9SLV\HDU)RUDOORWKHUVWKH30
IUHTXHQF\LVPRQWKVXQOHVVLQGLFDWHGRWKHUZLVHLQWKHVSHFLILFSURGXFWPDQXDO
PREREQUISITES
3UHYLRXVGDWDUHFRUGHGIURPLQVWDOODWLRQWXEHFKDQJHRUSULRU30LIDYDLODEOH
/LQHFRPSHQVDWLRQVHWWRFRUUHFWOLQHYROWDJHLIDSSURSULDWHIRUWKHJHQHUDWRU
7RROVUHTXLUHG +DQG7RROV
'90
.HLWKOH\RU+9'LYLGHURURWKHUQRQ±LQYDVLYHN9SGHYLFH
6FRSH
7KLVXQLWVKRXOGEHGRQHLQFRQMXQFWLRQZLWK;30± 5DG7LPHU DQG;30±
5DGP$P$V 

TASK DESCRIPTION
9HULI\N9SDWVHOHFWHGP$VWDWLRQVODUJHDQGVPDOOILODPHQWDWN9S
7RYHULI\WKHVORSHFKHFNWKHKLJKHVWDQGORZHVWP$VWDWLRQVRIHDFKILODPHQWDQG
RQHP$VWDWLRQLQEHWZHHQDWDQGN9S)RU86V\VWHPVHQWHUWKLVGDWDRQWKH
GDWDVKHHWV
)RU(XURSHDQV\VWHPVUHFRUGWKHGDWDLQWKHORJERRN
,IFDOLEUDWLRQGDWDLVQHHGHGE\WKHFXVWRPHUWDNHUHDGLQJVDVUHTXLUHG
Line Frequency Systems with Voltpacs
,ISUHYLRXVFDOLEUDWLRQKDVEHHQGRQHDQG\RXKDYHDUHFRUGRIQR±ORDGYROWDJHV
7KUHH3KDVH8QLWV /);03;06,067
,QVWDOO'90RQSKDVHRQHDQGWZRRIWKHYROWSDF WHUPLQDO 
6LQJOH3KDVH8QLWV
,QVWDOO'90RQ3(DQG3(OHDGV
9HULI\WKDWno–load voltagesIRUDOOUHFRUGHGN9S¶VDUHVWLOOZLWKLQ9$&
,IWKHP$P$VLVFRUUHFWWKHQR±ORDGYROWDJHVUHFRUGHGIURPDSUHYLRXV30DQGRU
FDOLEUDWLRQZLOOJLYHWKHFRUUHFWN9SLIZLWKLQ9$&
,IQRORDGVDUHQRWFRUUHFWYHULI\ZLWKD.HLWKOH\ -RE&DUG;30± 
,IN9SYROWDJHVDUHRXWRIWROHUDQFHVFKHGXOHWKHURRPIRUWURXEOHVKRRWLQJUHSDLU
DQGRU FDOLEUDWLRQ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RADIOGRAPHIC KVP -RE&DUG;30± RI

,IWKHUHLVQRSUHYLRXVFDOLEUDWLRQGDWDDYDLODEOHHLWKHU
 8VHWKH.HLWKOH\WRYHULI\WKHN9SLVFRUUHFW
 ,QVWDOOWKH+9GLYLGHUWRFKHFNWKHN9S 7DE 
5HFRUGQR±ORDGVIRUIXWXUHUHIHUHQFH

All Other Systems


8VHWKH.HLWKOH\WRYHULI\DOON9S¶V0$P$VPXVWEHYHULILHGDWWKHVDPHWLPH
KVp must meet published specs per the operator/service manual of each generator.
,IWKHN9SLVQRWFRUUHFWRUWKHUHLVDQ\TXHVWLRQRUGRXEWDVWRWKHN9SUHDGLQJVVFKHGXOH
WLPHLQWKHURRPIRUWURXEOHVKRRWLQJUHSDLURUFDOLEUDWLRQ
)RU86V\VWHPVHQWHUWKHGDWDLQWKHGDWDVKHHWV

ADVANTX – LFX 5HIHUWR&DOLEUDWLRQ8VHUV*XLGH


$WWDFK'90WRWHUPLQDORQWKHYROWSDFSKDVH$DQG% $DQG% 
8VH5DG7DEOH7RS0RGHRU&DO8QLW5/);++60HDVXUHPHQWV
,IXVLQJWKHLQWHUQDORUH[WHUQDOEOHHGHUFKHFNEOHHGHUVHOHFWLRQVZLWFK 6 RQ
/);$$LVGRZQIRULQWHUQDOEOHHGHURUXSIRUWKHH[WHUQDOEOHHGHU
8VHWKHLQWHUQDOEOHHGHURQO\LIWKHDFFXUDF\RIFDOLEUDWLRQKDVEHHQYHULILHG
61 
)RU$GYDQW[/);DFFXUDF\PHDVXUHPHQWVUHIHUWR7DE'LUHFWLRQ±
6HFWLRQ±
$'',7,21$//);.937(6732,17/);$$-%1& N9YROW 
ADVANTX – SCPU/MP/VAMP 5HIHUWR&DOLEUDWLRQ8VHUV*XLGH
8VHWKH.HLWKOH\WRYHULI\DOON9S¶V
0338N9WHVWSRLQW7UDQVIRUPHU±0338$$73RU;- 9N9
6&38N9WHVWSRLQW7UDQVIRUPHU±6&38$$73 9N9
MPX
$WWDFK'90WRYROWSDF0*$7%$DQG%
$FFXUDF\   N9S
MVP 7KUHH3KDVH
$WWDFK'90WR7HUPLQDOVRQWKHPLGGOHDQGXSSHUYROWSDF
8QLWVZLWKRXW±EOHHGHUDGDSWHU
([WHUQDOEOHHGHUFRQQHFWHG
8VH-RQWKHSRZHUXQLWEDFNSODQH
6FRSHVFDOHZLOOEHYROWSHUN9S

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RADIOGRAPHIC KVP -RE&DUG;30± RI

8QLWVZLWK±EOHHGHUDGDSWHU
8VLQJLQWHUQDOEOHHGHU
-3LQSRVLWLRQLQWHUQDO³,17´
73 YROWSHUN9S
8VLQJH[WHUQDOEOHHGHU
-3LQSRVLWLRQ³(;7´
73 YROWSHUN9S
$FFXUDF\
WRN9S  N9S
WRN9SN9S
MPG (All)
$FFXUDF\ ±.9 ±N9S
±.9 ±  N9S
MVP MICRO
$FFXUDF\ WRN9S
WRN9SN9S
MPH
$FFXUDF\ N9SDIWHUPV
DXS
'90WR7%±3(DQG7%±3(
$FFXUDF\ ±N9S  N9S
DXD
'90WR7%±3(DQG7%±3(
$FFXUDF\ ±N9S  N9S
CGR
8VH.HLWKOH\QRQ±LQYDVLYHPHWHU MREFDUG;30± WRPHDVXUHN9S
TITANOS
$FFXUDF\ DQGN9
EHWZHHQDQGP$
SEPTAR
$FFXUDF\ WRN9S N9S
EHWZHHQDQGP$
COMPTAR
$FFXUDF\ ±N9S 
±N9S
SPG
$FFXUDF\ WRN9S 
WRN9S 

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RADIOGRAPHIC KVP -RE&DUG;30± RI

CPG
$FFXUDF\ EHORZN9S 
DERYHN9S 
PHASIX
$FFXUDF\ ±N9±N9S
±N9  N9S
PROCESS
$FFXUDF\ WRP$ 
DWWRN9SIRUWRP$  
TRIPLUNIX 5–7–10–MP and ABAQUE 525
$FFXUDF\ 
MASIX
9HULI\WKDWWKHSUHPDJQHWL]DWLRQWK\ULVWRURSHUDWLRQZLWKDVFRSHIURP73WRJURXQG
RQ,&±(DWWKHIROORZLQJSDUDPHWHUV
7KUHHSRLQWPRGHDW N9P$P$V
N9P$P$V
1RODUJHVXUJHSHDNVKRXOGEHHYLGHQW
$FFXUDF\ 
POWER PAX
$FFXUDF\ N9S
SILHOUETTE
$FFXUDF\ 6HH6HUYLFH2SHUDWRU0DQXDO
For non–GE Systems
)RUQRQ±*(V\VWHPVUHIHUWR2(0HTXLSPHQWVSHFLILFDWLRQV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

*(1(5$7256 -RE&DUG;30± RI

MREFDUG RADIOGRAPHIC MA/MAS

VXEDVVHPEO\ &21752/ GDWH

SXUSRVH 7RYHULI\SURSHUFDOLEUDWLRQRIWKHUDGLRJUDSKLFP$P$V WLPHPLQ


FLUFXLWV

NOTE: 30IUHTXHQF\IRU0303386&385DGLRJUDSKLFP$P$VLV\HDU)RUDOORWKHUV
WKH30IUHTXHQF\LVPRQWKVXQOHVVLQGLFDWHGRWKHUZLVHLQWKHVSHFLILFSURGXFW
PDQXDO
PREREQUISITES
7KHUDGLRJUDSKLFWLPHUKDVEHHQYHULILHGWREHDFFXUDWH
7KHSKRWRWLPHUVKRXOGEHGLVDEOHG
5HIHUWRJHQHUDWRUW\SHIRUWRROVUHTXLUHG
'90P$VPHWHUVFRSHRKP:UHVLVWRU

TASK DESCRIPTION
*HQHUDWRUVSHFLILFDWLRQVFDQEHIRXQGLQWKHRSHUDWRU¶VPDQXDO
3HUIRUPZLWK;30 5DG7LPHU DQG;30 5DGN9S 
)RUDOOOLQHIUHTXHQF\V\VWHPV LH03;06,067 
9HULI\WKDWWKHP$P$VLVZLWKLQVWDWHGDFFXUDFLHVDWHDFKP$VWDWLRQDQGWKDWWKHP$P$V
LVZLWKLQEHWZHHQDGMDFHQWP$VWDWLRQVDWWKHVDPHN9S
9HULI\DOOP$VWDWLRQVDWN9SDQGFKHFNVSDFHFKDUJHDWDQGRUPD[N9SIRUWZR
RUWKUHHP$VWDWLRQVRQWKH;6DQGWKH;/IRFDOVSRW
,IPRUHGDWDLVUHTXLUHGWKHQFKHFNDQGUHFRUGDOOP$VWDWLRQVDWDQG RUPD[
N9SDWWKDWP$VWDWLRQ
NOTES:,IP$P$VLVQRWFRUUHFWVFKHGXOHURRPIRUFDOLEUDWLRQWURXEOHVKRRWLQJDQGRU
UHSDLU
8VHDQH[WHUQDOP$VPHWHULQWKH0RU0OHDGIRUP$VFKHFNV,IWKLVLVQRW
DYDLODEOHXVHVWDQGDUGSURFHGXUHIRUGHWHUPLQLQJWKHDFFXUDF\RIWKHLQWHUQDO
P$P$VPHWHU8VHWKHSURFHGXUHFDOOHGRXWIRULQWKHDSSURSULDWHVHUYLFHPDQXDO
)RUV\VWHPVRWKHUWKDQOLQHIUHTXHQF\UHIHUWRVSHFLILFJHQHUDWRUPDQXDO
ADVANTX /);6&3803389$03
5HIHUWR&DOLEUDWLRQ8VHUV*XLGH
5DGLRJUDSKLF&DOLEUDWLRQ8QLW5/);++60HDVXUHPHQWV
5HIHUWR7DEIRUVSHFLILFDWLRQV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RADIOGRAPHIC MA/MAS -RE&DUG;30± RI

MASIX
,QVHUWPDVPHWHULQSODFHRIWKHMXPSHURQWKH+2+9ERDUG
6HOHFW7KUHHSRLQWPRGH.9P$P$V
9HULI\LQWHUQDOPHWHUUHDGVWKHVDPHDVWKHH[WHUQDOPHWHU
$FFXUDF\ 
MPG
8VLQJDFRD[FDEOHFRQQHFWDVFRSHWR%1&FRQQHFWRURQWKHERDUGDWWKH+9WDQN
6HOHFW.9P$PVODUJHVSRW
9HULI\WKDWH[SRVXUHVGRQRWFKDQJHPRUHWKDWIURPWKHVWDUWWRWKHHQGRIWKH
H[SRVXUH
6HOHFW.9P$PVVPDOOVSRW
9HULI\WKDWWKHH[SRVXUHVGRQRWFKDQJHPRUHWKDW
03*±±P$ P$ IRUN9S!
03*±(P$ 
PHASIX 60–65–80
5HPRYHWKH:MXPSHU
&RQQHFWDP$VPHWHUEHWZHHQ7EDQG7ERQWKH$+9ERDUG
6HOHFW.9PVDQGODUJH)RFDO
9HULI\WKDWWKHPDYDOXHZLWKWKHSRVW±GLVSOD\HGPDYDOXH
E\SUHVVLQJWKHµ(¶EXWWRQDIWHUDQH[SRVXUH
7ROHUDQFH
P$DFFXUDF\  P$
P$VDFFXUDF\ P$
MPX
3XOOWKH0*$$ERDUG GLVDEOH4XDQWDPDW 
7XUQRQWKHP$VPHWHU3KDVH± 0*$$6:)ZG
3KDVH $GGUHVV$WR ³´ HQDEOHP$VPHWHU
³´ GLVDEOHVP$VPHWHU
NOTE: Turn mAs meter off when done.
MVP 7KUHH3KDVH
 ,QVWDOODQH[WHUQDOP$VPHWHULQWKH'&P$FLUFXLWDWWKHWUDQVIRUPHULIPHWHU
LVDYDLODEOH
 0$FDQEHPHDVXUHGGLUHFWO\ZLWKDVFRSH
&KWRP$73&DUGUDFNEDFNSODQHRIWKHSRZHUXQLW
&KWR±P$73
*URXQGWR%1&FRQQHFWRUDGMDFHQWWR73DQG73
3ODFHVFRSHWKHLQ³$''´PRGHDQGLQYHUW&KDQQHO
20 mV = 1 mA.

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RADIOGRAPHIC MA/MAS -RE&DUG;30± RI

 8VHDP$PHWHULQVHULHVZLWK0OHDGDWWUDQVIRUPHUIRUORZHUP$VWDWLRQV
WKDWDOORZORQJHUH[SRVXUHWLPHV
$FFXUDFLHVWRN9S
%HORZPV
P$WKUXP$WR±
$ERYHPV
WRP$  P$
P$XS  P$
MPH
PV P$$(&SRLQW
P$VDOOPRGHV
!PV P$$(&SRLQW
P$VP$VDOOPRGHV
POWER PAX
P$VP$VDQGSRLQWPRGH

MVP MICRO
$OOP$VWDWLRQV WRN9S 
WRN9S %
TRIPLUNIX 5–7–10–MP AND ABAQUE 525
$FFXUDF\ 
PROCESS GEN.
,QVWDOODRKP ZDWWPLQ UHVLVWRULQVHULHVZLWKP$MDFNLQWKHSRZHUFDELQHWE\
WKHKLJKYROWDJHWUDQVIRUPHU8VHORQJEDQDQDSOXJWRPDNHSURSHUFRQWDFW
3ODFHVFRSHDFURVVWKHUHVLVWRUDQGUHDGP$GXULQJDQH[SRVXUH100 mA = 1 V
$FFXUDF\±N9
COMPTAR III
:LWKVFRSH &RQQHFWVFRSHOHDGVDFURVVUHVLVWRU5RKPVLQWKHSRZHU
FDELQHW
:LWK'90 ,QVWDOOP$PHWHULQVHULHVZLWKWKHP$OHDGDWWKH+9WUDQVIRUPHU
$FFXUDF\VDPHDV&RPSWDU,
COMPTAR I
,QVWDOOP$PHWHULQVHULHVZLWKWKHP$OHDGDWWKH+9WUDQVIRUPHU
$FFXUDFLHV WRN9SWR±P$
WRN9SP$
SEPTAR
:LWKVFRSH &RQQHFWVFRSHOHDGVWR73DQG73
*URXQGRQWKHUHOD\PRGXOH
:LWKP$PHWHU ,QVWDOOP$PHWHULQVHULHVZLWKWKHP$OHDGDWWKHWUDQVIRUPHU
$FFXUDF\WRN9SP$

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RADIOGRAPHIC MA/MAS -RE&DUG;30± RI

SPG 515S
5HDGP$DWWKHFRQVROH
,QVWDOOP$PHWHULQVHULHVZLWKP$ZLUHLQVLGHWKHFRQVROH
$FFXUDFLHV WRN9SP$
WRN9SP$
TITANOS
,QVWDOODRKP ZDWWPLQ UHVLVWRULQVHULHVZLWKWKHP$MDFNRQWKHFRQVROH
8VHORQJEDQDQDSOXJWRPDNHSURSHUFRQWDFW
3ODFHDVFRSHDFURVVWKHUHVLVWRUDQGUHDGWKHP$GXULQJDQH[SRVXUH
100 mA = 1 V
$FFXUDFLHV P$WKUXP$DWN9DQGVHF
P$WRP$
CPG
$FFXUDFLHV ±P$ 
8SWRP$V 
All other generators refer to the appropriate generator manual.

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

*(1(5$7256 -RE&DUG;30± RI

MREFDUG NON–VOLATILE MEMORY DATA AND BATTERY VOLTAGE

VXEDVVHPEO\ *(1(5$725&21752/ GDWH

SXUSRVH 9HULI\PHPRU\GDWDWDEOHVDQGPHPRU\EDWWHU\YROWDJH WLPHPLQ

PREREQUISITES
'90

TASK DESCRIPTION
9HULI\WKDWWKHPHPRU\GDWDWDEOHVKDYHEHHQFRPSOHWHGDQGXSWRGDWH&KHFNDIHZP$
VWDWLRQVRQHDFKWXEH
,IGDWDWDEOHVDUHQRWXSWRGDWHWKHQVFKHGXOHWLPHLIQHHGHGWRFRPHEDFNLQWRWKH
URRPWRUHFRUGWKHGDWD&KHFNWKHQRQ±YRODWLOHPHPRU\EDWWHU\YROWDJH
ADVANTX
3XWWKH'90RQ6./$$6&±%,8ERDUG73WR73
*HQHUDWRURII
/LWKLXPEDWWHU\YROWDJHVKRXOGEHEHWZHHQWRYROWV'&
,IWKHYROWDJHLV9'&RUOHVVUHSODFHPHQWLVUHFRPPHQGHG
0338DQG9$03KDYHDEDWWHU\ % RQWKH&38ERDUG
0DNHVXUHWKHUHLVDFXUUHQWGDWDEDVHEDFNXS
MPX 3KDVHWR
3XW'90RQPHPRU\ERDUGV73WR73
*HQHUDWRURII
7KHQL±FDGEDWWHULHVVKRXOGEHEHWZHHQDQG9'&
,IWKHEDWWHU\LV9'&RUOHVVUHSODFHPHQWLVUHFRPPHQGHG
0HPRU\ORVVZLOORFFXUEHORZ9'&
7RUHSODFHDNPHPRU\ERDUGZLWKDNPHPRU\ERDUGVHH61$
3KDVH
3XWWKH'90RQ0*$$PHPRU\ERDUG73WR73
*HQHUDWRURII
/LWKLXPEDWWHU\YROWDJHVKRXOGEHEHWZHHQDQG9'&
,IWKHYROWDJHLV9'&RUOHVVUHSODFHPHQWLVUHFRPPHQGHG
7XUQJHQHUDWRURQ'90VKRXOGUHDG9'&9,IQRWVHH61$
IRUDGMXVWPHQW
&KHFNIRUVLJQVRIFRUURVLRQRUOHDNDJH&OHDQRUUHSODFHDVQHFHVVDU\
8VH03;'DWDEDVH7RROWREDFNXSDQGVDYHWKHGDWDEDVH.LW
L300/L500
&KHFNWKHEDWWHU\RQWKH&LQH975,QWHUIDFH%RDUG,Q0;$,5'WKHEDWWHULHV
³%7´VKRXOGEH9'&WR9'&,IQRWUHSODFHLW

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG NON–VOLATILE MEMORY DATA


AND BATTERY VOLTAGE -RE&DUG;30± RI

PHASIX
&KHFNWKHEDWWHU\LQWKHFRQVROH
5HPRYHWKH&026±5$0ERDUG $
7KHYROWDJHVKRXOGUHDGEHORZ9'&DIWHUVHFZLWKDRKPORDGFRQQHFWHG
%DWWHU\UHSODFHPHQWLVUHFRPPHQGHGHYHU\\HDUV
5HSODFHPHQWSDUW3
MASIX
&KHFNWKHEDWWHU\RQWKHEDWWHU\WHUPLQDOVRIWKH(FLUFXLW
7KHYROWDJHVKRXOGQRWEHOHVVWKDQ9
%DWWHU\UHSODFHPHQWLVVXJJHVWHGHYHU\\HDUV
5HSODFHPHQW3DUW<
MPG
&KHFNWKHEDWWHU\RQWKH03*$$FSXERDUGDQGWKH0*$SURJUDP;&38
ERDUG
7KHYROWDJHVKRXOGEH9,IWKHYROWDJHLV9UHSODFHWKHEDWWHULHV
%DWWHU\UHSODFHPHQWLVVXJJHVWHGHYHU\\HDUV
7KH&38SRZHUVKRXOGEH9P9EHWZHHQ%±DQGJURXQG7KH/('V
03*$$DQG03*$$ VKRXOGEHRQ
5HSODFHPHQWSDUW
MVP MICRO
7KHQRQ±YRODWLOH5$08±RQWKH06$$PRWKHUERDUGLQWKHFRQVROHKDVDQ
LQWHUQDOEDWWHU\
%DFN±XSWKHGDWDRQWKH8± QHZFKLS EHIRUHUHSODFLQJ
5HSODFHPHQWHYHU\\HDUV
3DUW±3
DX/DX Hiline/DLX
,IWKHEDWWHU\RQWKH90(ERDUGLVORZGXULQJV\VWHPSRZHUXSWKHPHVVDJH
EDWWHU\ORZDQGRUQRQ±YRODWLOH5$0DFFHVVHUURUZLOODSSHDU,IWKHEDWWHU\IDLOVWKH
V\VWHPZLOOQRWERRW
7KHEDWWHU\LVLQWHUQDOLQWKH195$0FKLSVRLWcannotEHFKHFNHGZLWKDPHWHU7KH
OLIHH[SHFWDQF\LV\HDUV
7KHEDWWHU\NLWLVSW7KH7FRVWRIWKHERDUGLVDERXWWLPHVWKHFRVW
RIWKHEDWWHU\NLW
Angix M200–4
%DWWHULHVPXVWEHUHSODFHGHYHU\\HDUV
2Q&38ERDUG ZR35206 &XVHSDUWYROWDJHVKRXOGEH9
2Q&38ERDUG ZR35206 XVHSDUWYROWDJHVKRXOGEH9
LQ*(06$0DGGµ&*¶EHIRUHSDUWQXPEHUV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG NON–VOLATILE MEMORY DATA


AND BATTERY VOLTAGE -RE&DUG;30± RI

Senix HF 500/600
%DWWHULHVPXVWEHUHSODFHGHYHU\\HDUV
2Q&38ERDUG ZR35206 &XVHSDUWYROWDJHVKRXOGEH9
2Q&38ERDUG ZR35206 XVHSDUWYROWDJHVKRXOGEH9
LQ*(06$0DGGµ&*¶EHIRUHSDUWQXPEHUV
Senographe 700T/800T/DMR
%DWWHULHVPXVWEHUHSODFHGHYHU\\HDUV8VHSDUW
VMX and VMX+
%DWWHU\PXVWEHUHSODFHGHYHU\\HDUV
For non–GE systems
)RUQRQ±*(V\VWHPVUHIHUWR2(0VHUYLFHGRFXPHQWDWLRQ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

&2//,0$7,21 3+2727,0,1* -RE&DUG;30± RI

MREFDUG RAD COLLIMATION AND PHOTOTIMING

VXEDVVHPEO\ &2//,0$72563+2727,0(56,21&+$0%(56 GDWH

SXUSRVH 9HULI\SURSHUFROOLPDWRUDOLJQPHQWDQGSURSHU WLPHPLQ


SKRWRWLPHURSHUDWLRQDQGGHQVLW\

NOTE: Phototiming checks are now optional. They should be done only if the customer is
complaining of density problems, the site requires data, or you need to get
benchmark data.
PREREQUISITES
7RROUHTXLUHG &XDQG$OIURP&9SKDQWRPRUHTXLYDOHQW
'HQVLWRPHWHU
5$7NLWRSWLRQDO
/LJKWPHWHU

TASK DESCRIPTION
Light Field Check
'DUNHQWKHURRPOLJKWV
7XUQRQFROOLPDWRUOLJKW
7KHOLJKWILHOGSDWWHUQVKRXOGEHRIXQLIRUPEULJKWQHVV QRVKDGRZVRUEORWFKHV
/LJKWRXWSXWPXVWEHPLQLPXPRIIW±FDQGOHV#FP6,'RUWKHYROWDJHDERYH
9$&DWWKHEXOE
,IQRWVFKHGXOHWLPHIRUUHSDLU
Blade Response
&KHFNEODGHUHVSRQVH FROOLPDWRULQDXWRPRGHWDEOHKRUL]RQWDOIRUQRUPDO6,' 
5HPRYHDQGUHLQVHUWWKHFDVVHWWHWUD\VHYHUDOWLPHVZKLOHREVHUYLQJEODGHPRWLRQ
(QHUJL]HWKHILHOGOLJKWDQGZDWFKWKHOLJKWSDWWHUQ 
'XULQJWKHUHSRVLWLRQLQJRIWKHEODGHVWKHUHVKRXOGEHQRPRUHWKDQWKUHH
RVFLOODWLRQVRIHLWKHUEODGHVHWDIWHUFRPLQJWRDQHZUHVWSRVLWLRQ
7KHUHVKRXOGEHQRHYLGHQFHRIELQGLQJFKDWWHULQJRUH[FHVVLYHRVFLOODWLRQGXULQJ
EODGHWUDYHO
,IVRVFKHGXOHWLPHIRUUHSDLU
Collimator Blade SID Tracking
:KLOHREVHUYLQJWKHOLJKWILHOGSDWWHUQRQWKHWDEOHWRSPRYHWKHWXEHXQLWDQG
FROOLPDWRUYHUWLFDOO\IURPWKHLQLWLDOI6,'WRWKHPD[LPXP6,'DYDLODEOH
DQGWKHQEDFNWRWKHI6,'
$VWKH6,'LVYDULHGWKHILHOGVL]HVKRXOGUHPDLQDSSUR[LPDWHO\WKHVDPHVL]H
%ODGHVVKRXOGRSHQDV6,'GHFUHDVHVDQGFORVHDV6,'LQFUHDVHV
,IQRWVFKHGXOHWLPHIRUUHSDLU

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD COLLIMATION AND PHOTOTIMING -RE&DUG;30± RI

36I SID Crossover Point


:LWKDFDVVHWWHLQVWDOOHGLQWKHFDVVHWWHWUD\ORZHUWKHWXEHDQGFROOLPDWRUDQG
YHULI\WKDWWKHWXEHJRHVLQWRQRQ±DXWRPRGHEHORZI FP DQG
UHWXUQVWRDXWRPRGHDURXQGI FP DVWKHWXEHLVUDLVHG
Fan and Select Light
&KHFNWKDWWKHVHOHFWOLJKWLVOLWDQGWKHIDQLVURWDWLQJ
'RWKHIROORZLQJSKRWRWLPLQJGHQVLW\FKHFNVDQGFROOLPDWRUFKHFNVRQO\LIQHFHVVDU\
RUFDOOHGIRU
$VNWKHFXVWRPHULIWKHUHDUHDQ\LVVXHVZLWKWKHGHQVLWLHVRIHDFKUHFHSWRURUWKH
FROOLPDWLRQWRHDFKUHFHSWRU
<RXVKRXOGWDNHDUHIHUHQFHILOPDWHDFKUHFHSWRU LRQFKDPEHU IRUGHQVLW\7KLVZLOO
EHXVHIXOIRUWURXEOHVKRRWLQJDQGRUFRPSRQHQWUHSODFHPHQW

CAUTION: The following procedures require the production of x–rays. Observe


radiation safety rules. A lead protective screen, lead apron or other protective medium
should be used to avoid unnecessary exposure.
PHOTOTIMING (Optional)
Backup Safety Timer
&ORVHWKHFROOLPDWRUEODGHV
3ODFHDOHDGDSURQLQWKH[±UD\ILHOG
6HOHFWN9SP$VHF
3RVLWLRQWKHWXEHDWQRUPDO6,'
7DNHDQH[SRVXUHDQGPDNHVXUHWKDWWKHVDIHW\EDFNXSWRQHVRXQGVDQGWKDWWKH
ODPSLVOLWLIRQHH[LVWVRQWKHJHQHUDWRU
Ion Chamber Balance VNLSLI\RXKDYHDSKRWRWXEH
3ODFHD[I [FP ILOPFDVVHWWHLQWKHFDVVHWWHWUD\
3ODFH&XDQG$OLQWKH[±UD\EHDP
6HOHFWN9SP$DQGDVHFEDFNXSWLPHRQWKHJHQHUDWRU
7DNHDQH[SRVXUHXVLQJHDFKLRQFKDPEHU
5HSHDWIRUHDFKLRQFKDPEHUDQGUHFHSWRULQWKHURRP
0$VRUWLPHVKRXOGEHDSSUR[LPDWHO\WKHVDPH  IRUHDFKLRQFKDPEHU
Beam Alignment, Field Size Test and Density Check
3ODFHD[I [FP FDVVHWWHLQWKHUHFHSWRU
0DQXDOO\FROOLPDWHGRZQWRD[I [FP ILHOGXVLQJWKHFROOLPDWRU
SRLQWHUV
3ODFHWKH5$7SDWWHUQRQWRSRIWKH&XDQG$O
7XUQRQWKHOLJKWILHOGDQGUHFRUGWKHOLJKWILHOGDVVKRZQRQWKH5$7SDWWHUQ
,ID5$7SDWWHUQLVQRWDYDLODEOHWKHQ\RXFDQSODFH$OOHQZUHQFKHVDURXQG
WKHOLJKWILHOGRQWRSRIWKH&XDQG$O
6HOHFWN9SP$DQGQRUPDOEDFNXSWLPHRQWKHJHQHUDWRU
6HWSKRWRWLPHUWRFXVWRPHU¶VQRUPDOVHWWLQJDQGWDNHDQH[SRVXUH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD COLLIMATION AND PHOTOTIMING -RE&DUG;30± RI

Develop and Check the Film


&KHFNILOPIRUQRUPDOFXVWRPHUGHQVLW\DQGUHFRUG
&KHFNOLJKWWR[±UD\ILHOG
&KHFN FHQWHU±WR±FHQWHU
0HDVXUHWKHVL]HRQILOP [I 
0HDVXUHPHQWHUURUVKRXOGEHQRPRUHWKDQI FP IRUOLJKWWR[UD\
FHQWHUWRFHQWHUDQGILOPVL]H7KLVLVDQHUURURIDWI FP 6,'
DQGDWI FP 6,'$JUHDWHUHUURUPD\EHDFFHSWDEOHWR*(
DQG++6EXWQRWWRWKHFXVWRPHU7KHURRPVKRXOGEHVFKHGXOHGIRU
UHFDOLEUDWLRQLIQHHGHG
Check Two Other Film Sizes 8VHFDVVHWWHVWKDWDUHFRPPRQO\XVHGE\WKHFXVWRPHU
6HOHFWDXWRFROOLPDWLRQ
2EVHUYHWKHSRLQWHUVRQWKHFROOLPDWRUDIWHUWKHILOPKDVEHHQLQVHUWHGLQWKH
UHFHSWRU7KH\VKRXOGUHDGWKHILOPVL]HFRUUHFWO\
,IWKHFROOLPDWRUURWDWHVURWDWHLWE\GHJUHHVWDNHDQH[SRVXUHDQGPHDVXUHWKH
VL]HGLUHFWO\RIIWKHILOP
NOTE: ,IWKHFROOLPDWRURQ\RXUV\VWHPFDQQRWEHURWDWHGGHJUHHVWKHQSODFHD
ILOPRQWKHWDEOHWRSURWDWHGGHJUHHV
&DOFXODWHWKHSHUFHQW6,'HUURUXVLQJWKHIROORZLQJIRUPXOD
$ ILOPVL]H $ PHDVXUHGVL]HRQWKHWDEOHWRSILOP
²± [ HUURU6,' ; IRFDOVSRWWRWDEOHWRSILOPGLVWDQFH
; 6,' ILOPVL]H ILOPVL]HLQEXFN\ I
6,' IRFDOVSRWWREXFN\ILOPGLVWDQFH

Verify the photo timer density can change


7DNHH[SRVXUHVDWQRUPDODQGDSOXVDQGPLQXVGHQVLW\VHWWLQJ
0DNHVXUHWKDWWKHWLPHRUP$VLVJUHDWHUDWWKHSOXVGHQVLW\DQGOHVVDWWKHPLQXV
GHQVLW\
Verify the minimum exposure
6HOHFWN9S/RU/DQGVHF
$OLJQGHWHFWRUDQG[±UD\EHDPDQGSODFHWXEHDWPLQLPXP6,'
5HPRYHHYHU\WKLQJLQ[±UD\SDWK
([SRVXUHVKRXOGEHOHVVWKDQP$VRUPVRQHDFKGHWHFWRU
Repeat this procedure for each receptor in the system

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

&2//,0$7,21 3+2727,0,1* -RE&DUG;30± RI

MREFDUG R&F COLLIMATION AND PHOTOTIMING

VXEDVVHPEO\ *(1(5$7256327±),/0'(9,&( GDWH

SXUSRVH 9HULI\SURSHUFROOLPDWRUDOLJQPHQWDQGSURSHU WLPHPLQ


SKRWRWLPHURSHUDWLRQDQGGHQVLW\

NOTE: Phototiming checks are now optional. They should be done only if the customer is
complaining of density problems, the site requires data, or you need to get
benchmark data.
PREREQUISITES
7RROUHTXLUHG &XDQG$OIURP&9SKDQWRPRUHTXLYDOHQW&XDQG$O
'HQVLWRPHWHU
3DSHUFDVVHWWH
5$7NLWRUIOXRURVFUHHQ

TASK DESCRIPTION
Blade Response
&KHFNEODGHUHVSRQVHPDNLQJIOXRURUDGLDWLRQ
7KHUHVKRXOGEHQRHYLGHQFHRIELQGLQJRUFKDWWHULQJGXULQJEODGHWUDYHO
7KHUHVKRXOGEHQRHYLGHQFHRIRVFLOODWLRQVZKHQFRPLQJWRDQHZUHVW
SRVLWLRQ
Collimator Blade Tracking
,QIOXRURREVHUYHWKHFROOLPDWRUEODGHVZKLOHPRYLQJWKHWRZHUXSDQGGRZQ
7KHEODGHVVKRXOGWUDFNDVWKH6,'LVYDULHG
Fan
&KHFNWKDWWKHIDQLVURWDWLQJ
7KHIROORZLQJGHQVLW\DQGFROOLPDWLRQFKHFNVPD\QRWEHQHFHVVDU\'RRQO\LIQHHGHG
&KHFNZLWKWKHFXVWRPHUWRVHHLIWKHUHDUHDQ\LVVXHVZLWKGHQVLW\RUFROOLPDWLRQ
&KHFNWRVHHLIH[SRVXUHVDUHURXWLQHO\WDNHQDWDSOXVRUPLQXVGHQVLW\VHWWLQJ

PHOTOTIMING (Optional)
Backup Safety Timer
&ORVHWKHFROOLPDWRUEODGHV
3ODFHDOHDGDSURQLQWKH[±UD\ILHOG
6HOHFWN9SP$VHF
7DNHDVSRW±ILOPH[SRVXUHDQGPDNHVXUHWKDWWKHVDIHW\EDFNXSWRQHVRXQGVDQG
WKDWWKHODPSLVOLWLIRQHH[LVWVRQWKHJHQHUDWRU
For non–GE ProductUHIHUWR2(0VSHFLILFGRFXPHQWDWLRQ
)RU03*DQG3KDVL[V\VWHPV
&ORVHWKHFROOLPDWRUEODGHVDQGSODFHDOHDGDSURQLQWKHEHDP

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG R&F COLLIMATION AND PHOTOTIMING -RE&DUG;30± RI

&KHFNWKH±SRLQWPRGHRQODUJHVSRWDQG.9
7KHH[SRVXUHPXVWEHOLPLWHGWRP$V
&KHFNWKH±SRLQWPRGHDW.9P$DQGPV
7KHH[SRVXUHPXVWEHOLPLWHGWRWLPHGLVSOD\HG LHP$V
5HPRYHWKHOHDGDSURQDQGRSHQWKHFROOLPDWRU
Ion Chamber Balance RQO\IRURU6)'
3ODFHD[IILOPFDVVHWWHLQWKHFDVVHWWHWUD\6HOHFWILOPIRUPDW
3ODFH&XDQG$OLQWKH[±UD\EHDP
6HOHFWN9SP$DQGDVHFEDFNXSWLPHRQWKHJHQHUDWRU
([SRVHILOP1RWHWKHP$VWLPH
6HOHFWDRQRQD[IILOPFDVVHWWH
([SRVHILOP1RWHWKHP$VWLPH
0$VRUWLPHVKRXOGEHDSSUR[LPDWHO\WKHVDPH  IRUHDFKILOP
,IWKHFKDQJHLVJUHDWHUVFKHGXOHWLPHIRUUHSDLU7KHSUREOHPFRXOGEHDUHDFRPS
 RULRQFKDPEHUFHOOEDODQFH
CAUTION: Any change will change the overall density. Make sure you have a density
benchmark so you can reset the overall densities back to normal after
repairs/adjustments.

Reproducibility
3ODFHPPRIFRSSHULQWKHILHOG
6HOHFWN9SP$ P$V
7DNHH[SRVXUHVDQGWKHPDVVKRXOGEHZLWKLQIRUHDFKH[SRVXUH

UNDERTABLE TUBE SYSTEMS:


SFD Center to Center
6HOHFWN9SP$
6HOHFWPDQXDOFROOLPDWLRQ
6HWWKHWDEOHWRSWR6)'ILOPSODQHGLVWDQFHWRLQFKHV
*(5 )WDEOHVKDYHDIRFDOVSRWWRWDEOHWRSGLVWDQFHRIDSSUR[LPDWHO\
I>FP@UHVXOWLQJLQDI>FP@WRWDO6,' 
&ROOLPDWHGRZQWRDPHGLXPVL]HGVTXDUHDUHD
&HQWHU&XDQG$OIURPWKH&9SKDQWRP RUHTXLYDOHQW&8DQG$O LQWKHEHDP
6HOHFWDRQILOPIRUPDW
([SRVHDQGSURFHVVD[I [FP FDVVHWWHILOP
)LQGWKHFHQWHURIWKHILOPDQGWKHFHQWHURIWKHH[SRVHGDUHD
0HDVXUHWKHHUURUEHWZHHQWKHFHQWHUPDUNV
7KLVHUURUPXVWEHOHVVWKDQI FP  IUHSUHVHQWVD6,'HUURUDW
I>FP@6,'ZLWKFRPSHQVDWLRQIRUPLQLILFDWLRQ 
$JUHDWHUHUURUWKDQI FP PD\EHDFFHSWDEOHWR*(DQG++6EXWQRWWRWKH
FXVWRPHU
7KHURRPVKRXOGEHVFKHGXOHGIRUUHFDOLEUDWLRQRIWKH6)'FROOLPDWRULIQHHGHG

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG R&F COLLIMATION AND PHOTOTIMING -RE&DUG;30± RI

SFD Sizing and Film Density


6HOHFWN9SP$
6HOHFWDXWRFROOLPDWLRQ
&HQWHU&XDQG$OIURPWKH&9SKDQWRPLQWKHEHDP RUHTXLYDOHQW&XDQG$O 
8VHFXVWRPHUQRUPDOGHQVLW\VHWWLQJ
0DLQWDLQWKHI FP 6,'
7DSHD[I [FP SDSHUFDVVHWWH SDUW($' XQGHUWKHVSRW±ILOP
GHYLFHFHQWHUHGZLWKLQWKHH[SRVXUHDUHDURWDWHGDSSUR[LPDWHO\_
6HOHFWDRQILOPIRUPDW
8VLQJD[I [FP FDVVHWWHH[SRVHDQGSURFHVVDILOP
0HDVXUHWKHH[SRVHGDUHDGLUHFWO\RQWKH[I [FP ILOP
7KHH[SRVHGDUHDPXVWEHEHWZHHQI FP DQGI FP  WKLVLV
 6,'HUURUZLWKFRPSHQVDWLRQIRUPLQLILFDWLRQ 
$JUHDWHUHUURUWKDQI FP PD\EHDFFHSWDEOHWR*(DQG++6EXWQRWWRWKH
FXVWRPHU
7KHURRPVKRXOGEHVFKHGXOHGIRUUHFDOLEUDWLRQRIWKH6)'FROOLPDWRULIQHHGHG
,IDQ\GRXEWH[LVWVRQWKHFHQWHULQJRUVL]LQJYHULI\E\XVLQJWKH++6SURFHGXUHVLQ
'LUHFWLRQ±6\VWHP)LHOG7HVWIRU++6 RUORFDOHTXLYDOHQWUHJXODWLRQV 
)RU86V\VWHPVYHULI\WKDWWKHILOPGHQVLW\RQWKH´[´ [FP ILOPLV
FRUUHFWDQGUHFRUGLQWKHGDWDVKHHWV
REMOTE SYSTEMS:
Beam Alignment, Field Size Test and Density Check
3ODFHD[I [FP FDVVHWWHLQWKHUHFHSWRU
0DQXDOO\FROOLPDWHGRZQWRD[I [FP LQFKILHOGXVLQJWKHFROOLPDWRU
SRLQWHUV
3ODFHWKH5$7SDWWHUQRQWRSRIWKH&XDQG$O
7XUQRQWKHOLJKWILHOGDQGUHFRUGWKHOLJKWILHOGDVVKRZQRQWKH5$7SDWWHUQRU
IOXRURVFUHHQ
,ID5$7SDWWHUQLVQRWDYDLODEOHWKHQ\RXFDQSODFH$OOHQZUHQFKHVDURXQGWKHOLJKW
ILHOGRQWRSRIWKH&XDQG$O
6HOHFWN9SP$DQGQRUPDOEDFNXSWLPHRQWKHJHQHUDWRU
6HWSKRWRWLPHUWRFXVWRPHU¶VQRUPDOGHQVLW\VHWWLQJDQGWDNHDQH[SRVXUH
Develop and Check the Film
&KHFNILOPIRUQRUPDOFXVWRPHUGHQVLW\DQGUHFRUGLQGDWDVKHHWV
&KHFNOLJKWWR[±UD\ILHOG
&KHFN FHQWHU±WR±FHQWHU
0HDVXUHWKHVL]HRQILOP ´[´ RU [FP 
0HDVXUHPHQWHUURUVKRXOGEHQRPRUHWKDQ´ FP IRUOLJKWWR[±UD\
FHQWHU±WR±FHQWHUDQGILOPVL]H7KLVLVDQHUURURIDWI FP 6,'
$JUHDWHUHUURUPD\EHDFFHSWDEOHWR*(DQG++6EXWQRWWRWKHFXVWRPHU
7KHURRPVKRXOGEHVFKHGXOHGIRUUHFDOLEUDWLRQRIWKHFROOLPDWRULIQHHGHG

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG R&F COLLIMATION AND PHOTOTIMING -RE&DUG;30± RI

Ion Chamber Balance VNLSLI\RXKDYHDSKRWRWXEH


3ODFHD[I [FP ILOPFDVVHWWHLQWKHFDVVHWWHWUD\
3ODFH&XDQG$OLQWKH[±UD\EHDP
6HOHFWN9SP$DQGDVHFEDFNXSWLPHRQWKHJHQHUDWRU
7DNHDQH[SRVXUHXVLQJHDFKLRQFKDPEHU
0$VRUWLPHVKRXOGEHDSSUR[LPDWHO\WKHVDPH  IRUHDFKLRQFKDPEHU
5HSHDWIRUHDFKLRQFKDPEHUDQGUHFHSWRULQWKHURRP
Spot–Film Sizing
&HQWHUV\VWHPPRYHPHQWV
6HOHFWDXWRFROOLPDWLRQ
/RDGD[I [FP FDVVHWWHLQWKHEXFN\DQGVHOHFWDRQIRUPDW
&HQWHU&XDQG$OIURPD&9SKDQWRPLQWKH[±UD\EHDP
3RVLWLRQD[I [FP SDSHUFDVVHWWHRQWRSRIWKH&XDQG$OURWDWHG
GHJUHHVVRWKDWDOOHGJHVRIWKHOLJKWILHOGDUHYLVLEOHRQWKHILOP
([SRVHDQGSURFHVVWKHILOPV
0HDVXUHWKHILHOGVL]HGLUHFWO\RQWKH[I [FP ILOP7KHVL]HPXVWIDOO
EHWZHHQ I FP DQGI FP  6LQFHWKH6,'LVI>FP@
DQGWKHILOPSODQHWRWDEOHWRSGLVWDQFHLVI>FP@WKLVUHSUHVHQWVD
 6,'HUURUZLWKFRPSHQVDWLRQIRUPLQLILFDWLRQ
,I\RXZDQWWRFDOFXODWHWKHDFWXDOHUURUXVHWKHIROORZLQJIRUPXOD
$ ILOPVL]H $ PHDVXUHGVL]HRQWKHWDEOHWRSILOP
²± [ HUURU6,' ; IRFDOVSRWWRWDEOHWRSILOPGLVWDQFH
; 6,' ILOPVL]H ILOPVL]HLQEXFN\I FP
6,' IRFDOVSRWWREXFN\ILOPGLVWDQFH
7KLVHUURUPD\EHZLWKLQ)'$DQG*(WROHUDQFHVEXWREMHFWLRQDEOHWRWKHFXVWRPHU
7LPHPD\QHHGWREHVFKHGXOHGIRUUHFDOLEUDWLRQRIWKHFROOLPDWRU
9HULI\RWKHUILOPVL]HVDQGIRUPDWVXVLQJWKHFROOLPDWRUOLJKW
,QVHUWD[I [FP ILOPLQWKHFDVVHWWHWUD\DVWRGLYLGHWKHI FP 
GLUHFWLRQZLWKDRQIRUPDW
([SRVHWKHILOPWKHQWXUQWKHFDVVHWWHGHJUHHV
([SRVHWKHILOPZLWKDRQIRUPDW
([SRVHDVHFRQGILOPZLWKDRQIRUPDW
3URFHVVWKHILOPVDQGYHULI\WKHEORFNVDUHHTXDOVL]HDQGWKHERDUGHUVDUH
DSSUR[LPDWHO\PP

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG R&F COLLIMATION AND PHOTOTIMING -RE&DUG;30± RI

For All Systems Verify the Phototimer Density Can Change


6HOHFWRQILOPIRUPDW
7DNHH[SRVXUHVDWQRUPDODSOXVDQGPLQXVGHQVLW\VHWWLQJ
0DNHVXUHWKDWWKHWLPHRUP$VLVJUHDWHUDWWKHSOXVGHQVLW\VHWWLQJDQGOHVVDWWKH
PLQXVGHQVLW\VHWWLQJ
3URFHVVWKHILOPDQGREVHUYHWKHERUGHUVEHWZHHQWKHH[SRVHGDUHDVDUH
DFFHSWDEOHWRWKHFXVWRPHU
5HWXUQWKHGHQVLW\ZKHHOEDFNWRFXVWRPHU¶VQRUPDOVHWWLQJ
Verify the Minimum Exposure
6HOHFWN9S/DQGVHF
3ODFH6)'DWPLQLPXP6,'
5HPRYHHYHU\WKLQJLQ[±UD\SDWK
([SRVXUHVKRXOGEHOHVVWKDQP$VRQHDFKGHWHFWRU

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

&2//,0$7,21 3+2727,0,1* -RE&DUG;30± RI

MREFDUG MANUAL COLLIMATORS

VXEDVVHPEO\ 0$18$/&2//,0$7256 GDWH

SXUSRVH 9HULI\PDQXDOFROOLPDWRUDOLJQPHQW WLPHPLQ

PREREQUISITES
[IRU[IFDVVHWWH
/LJKWILHOGHGJHPDUNHUV
5DWNLWRSWLRQDO
CAUTION: The following procedure requires the production of X–rays. Observe
radiation safety rules. A lead protective screen, lead apron, or other protective
medium should be used to avoid unnecessary exposure.

TASK DESCRIPTION
3RVLWLRQD[I [FP FDVVHWWHRQWDEOHWRSRUIORRU
$GMXVW6,'RI;±UD\WXEHRYHUWKHFDVVHWWHWRI
'LPURRPOLJKWVWRHQDEOHHDV\YLVLELOLW\RI;±UD\ILHOGOLJKW
0DQXDOO\FROOLPDWHWRD[I [FP ILHOGXVLQJWKHFROOLPDWRUSRLQWHUV
9HULI\WKHILHOGLV[I [FP RQWKHFDVVHWWH
0DUNWKHHGJHVRIWKHOLJKWILHOGZLWK$OOHQZUHQFKHVVRWKDWWKH_HQGRIWKH$OOHQ
ZUHQFKHVDUHSRLQWLQJLQWRWKHOLJKWILHOG RUSODFH5$7SDWWHUQRQFDVVHWWH 
7DNHDQH[SRVXUHXVLQJWKHIROORZLQJIDFWRUV
N9S
P$
P$V
3URFHVVWKHILOP
,IQHHGHGFKDQJHP$VDQGWDNHDQHZILOPLIHGJHVDUHQRWHDVLO\YLVLEOH
7KHPHDVXUHGHUURUIRUVL]H[I [FP DQG;±UD\WROLJKWILHOGPXVWEHOHVVWKDQ
I FP 
,IWKHHUURULVJUHDWHUVFKHGXOHWLPHIRUVHUYLFH
,ILQGRXEWUHIHUWRWKHDSSURSULDWHWHVWSURFHGXUHLQ'LUHFWLRQ± 6\VWHP)LHOG7HVW
IRU++6 RU2(0VHUYLFHGRFXPHQWDWLRQ 

±
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

GENERATOR PERFORMANCE
TABLE OF CONTENTS

JOB CARD TITLE PAGE

;30± )/82527,0(5  ±

;30± )/8252.93  ±

;30± )/8252(175$1&((;32685(5$7( 7$%/(723'26(  ±

;30± ,1387'26(  ±

;30± &,1(0$;,08038/6(:,'7+6  ±

;30± &,1(.93$1'0$  ±

;30± (/(&75,&$//($.$*(&855(17$1'*5281'5(6,67$1&(  ±

±L
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

7+,63$*(,17(17,21$//</()7%/$1.

±LL
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

*(1(5$7256 -RE&DUG;30± RI

MREFDUG FLUORO TIMER

VXEDVVHPEO\ *(1(5$725,0$*(6<67(0 GDWH

SXUSRVH 7RYHULI\WKHIOXRURWLPHULVIXQFWLRQDO WLPHPLQ

PREREQUISITES

TASK DESCRIPTION
Procedure:
$OORZWKHILYHPLQXWHIOXRURWLPHUWRUXQRXWZKLOHIOXRURLQJGXULQJRWKHUWHVWLQJ
7KHV\VWHPVKRXOGGRWZRWKLQJV
 $QDXGLEOHDODUPVKRXOGVRXQGVRPHZKHUHQHDUWKHHQGRIILYHPLQXWHV
 )OXRURH[SRVXUHVVKRXOGEHLQKLELWHGDWWKHHQGRIWKHILYHPLQXWHV
7KHWLPHUVKRXOGEHDEOHWREHUHVHWEDFNWRILYHPLQXWHV
NOTE:6RPHQHZHUV\VWHPVPD\KDYHDPLQXWHWLPHU

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

*(1(5$7256 -RE&DUG;30± RI

MREFDUG FLUORO KVP

VXEDVVHPEO\ *(1(5$725,0$*(6<67(0 GDWH

SXUSRVH 7RFKHFNDQGYHULI\WKDWWKHIOXRURN9SLVZLWKLQ WLPHPLQ


VWDWHGDFFXUDFLHV

PREREQUISITES
'90
.HLWKOH\N9SPHWHURUHTXLYDOHQW
&RD[FDEOH
6FRSH

TASK DESCRIPTION
Procedure:
,ISUHYLRXVFDOLEUDWLRQKDVEHHQGRQHDQG\RXKDYHDUHFRUGRIQR±ORDGYROWDJHV
7KUHH3KDVH8QLWV
,QVWDOO'90RQSKDVHRQHDQGWZRRIWKHYROW±SDF WHUPLQDO 
6LQJOH3KDVH8QLWV
,QVWDOO'90RQ3(DQG3(OHDGV
,QVWDOOWKH.HLWKOH\ MREFDUG;30± WRYHULI\N9SQR±ORDGYROWV
5DLVHP$XQWLON9SYDOXHVVWDELOL]HRQ.HLWKOH\EHIRUHPHDVXULQJYDOXHV
.HLWKOH\QHHGVWRP$IRUDYDOLGUHDGLQJ
9HULI\WKDWQR±ORDGYROWDJHVIRUDOOUHFRUGHGN9S¶VDUHVWLOOZLWKLQ 9$&

Permitted Tube Current Settings (less than + 1 kV effect)


Single-phase Single-phase Three-phase
half-wave full-wave
0LQLPXP7XEH&XUUHQW I P$ P$ P$
6RXUFH±WR±7DEOH
0D[LPXP7XEH&XUUHQW I P$ P$ P$
6RXUFH±WR±7DEOH
)DFWRU\FDOLEUDWLRQSHUIRUPHGDWP$PP$OLQKHUHQWILOWUDWLRQLQFKHVVRXUFH±WR±
WDEOH6L[SRLQWFDOLEUDWLRQFKHFN

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG FLUORO KVP -RE&DUG;30± RI

(QWHUGDWDRQWKHGDWDIRUP
Systems with no Volt–pac or where no previous kVp no–load readings are available:
 8VHWKH.HLWKOH\WRYHULI\WKHIOXRURN9SLVFRUUHFW
 ,QVWDOOWKH+9GLYLGHUWRFKHFNWKHN9S5HFRUGQR±ORDGVIRUIXWXUHUHIHUHQFH
,IWKHUHLVDQ\TXHVWLRQRUGRXEWDVWRWKHN9SUHDGLQJVWKHQVFKHGXOHWLPHLQWKHURRPIRU
WURXEOHVKRRWLQJUHSDLURUFDOLEUDWLRQ

NON-PULSED KVP WAVEFORM

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

*(1(5$7256 -RE&DUG;30± RI

MREFDUG FLUORO ENTRANCE EXPOSURE RATE (TABLE TOP DOSE)

VXEDVVHPEO\ *(1(5$725,0$*(6<67(0 GDWH

SXUSRVH 7RYHULI\WKDWWKHPD[LPXPSDWLHQWHQWUDQFH
UDGLDWLRQLVQRWJUHDWHUWKDQWKHPD[LPXPDPRXQW WLPHPLQ
SHUPLWWHGE\IHGHUDOUHJXODWLRQV

PREREQUISITES
7RRO5HTXLUHG +DQGWRROV
5DGLDWLRQPHWHU LH0'+PHWHUXVHFFSUREHRUHTXLYDOHQW
'90
3RUWEORFNHUDQGDWWHQXDWRUEORFNVIURP5$7NLW

TASK DESCRIPTION
Procedure:
NOTE: ,IPD[IOXRURP$DQG³5´±OHYHOGDWD 2%7$,1(':,7+,17+(/$670217+6 LV
DYDLODEOHIRUFRPSDULVRQWKHQVNLSWRVWHSGRIWKLVSURFHGXUHHOLPLQDWLQJWKHXVHRIWKH
UDGLDWLRQPHWHUDQGXVLQJWKHUHFRUGHGFRQVROHP$UHDGLQJ
 5 )6\VWHPV
3RVLWLRQWKH³5´PHWHUSUREHRQWKHWDEOHWRSZLWKWKHD[LVRIWKHSUREHSHUSHQGLFXODU
WRDQRGH±FDWKRGHD[LVRIWKH[±UD\WXEH
/RZHUWKH6)'WRPLQLPXP6,'6HHIROORZLQJLOOXVWUDWLRQ

6327),/0'(9,&(
,0$*(6<67(0
/($'3257%/2&.(5´;´
FP;FP
86()8/%($0
$77(18$7,21
%/2&.
$66(0%/< ´ FP
352%(


FP 7$%/(723

',$*1267,&
6285&(
$66(0%/<

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG FLUORO ENTRANCE EXPOSURE RATE


(TABLE TOP DOSE) -RE&DUG;30± RI

)RURYHUWDEOHWXEHV3ODFHWKH³5´PHWHURQDVWDQGIDERYHWKHWDEOH
6HHIROORZLQJLOOXVWUDWLRQ

6(7$6
&/26(
$6
3266,%/(

I
FP PROBE
/($'3257
%/2&.(5
I;I
FP;FP
7$3(,13/$&(

I
FP

/$7(5$/
,17(16,),(5
',$*1267,&
6285&(
FOOTREST $66(0%/<
$77(18$7,21
%/2&.$66(0%/<

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG FLUORO ENTRANCE EXPOSURE RATE


(TABLE TOP DOSE) -RE&DUG;30± RI

 9DVFXODU6\VWHPV
0RXQWWKHUDGLDWLRQSUREHVWDQGWRWKHERWWRPRIWKH,,WXEHZLWKWKHSUREHFP
I IURPWKHERWWRPVXUIDFHRIWKHIOXRURVFRSLFLPDJLQJDVVHPEO\
6HWWKHV\VWHPWRPLQLPXP6,' IRU/8±$PRYHERWKWKH[±UD\WXEHDQG,,WR
PLQLPXP6,' 
$OLJQWKHD[LVRIWKHUDGLDWLRQSUREHSHUSHQGLFXODUWRWKHDQRGH±FDWKRGHD[LVRIWKH
[±UD\WXEH6HHIROORZLQJLOOXVWUDWLRQ

&0
5$',$7,21
352%(

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG FLUORO ENTRANCE EXPOSURE RATE


(TABLE TOP DOSE) -RE&DUG;30± RI

 )RUDOOV\VWHPV
D &HQWHUWKHSUREHLQWKHFHQWHURIWKHSULPDU\[±UD\EHDPLIPHDVXULQJ³5´
RXWSXW6HHVWHSVDQGIRUSUREHSODFHPHQW
E 3XWWKH,,LQWKH1RUPDO)29
F 2SHQWKHFROOLPDWRUVWRPD[LPXP
G 3URWHFWWKHLPDJLQJV\VWHPIURPRYHUORDGGXHWRKLJKUDGLDWLRQXVHGLQWKLVWHVW
E\HLWKHU
D &RYHULQJWKH,,LQSXWZLWKDWOHDVWIRIOHDGZKLFKFDQEHWDSHGWRWKH
ERWWRPRIWKH6)'RU,,LQSXW
D 7XUQLQJRIIWKH,,SRZHUVXSSO\

 0HDVXUHWKHH[SRVXUHUDWHDVIROORZV
NOTE: ,IWKHN9SJRHVLQWRWKHRYHUULGHFRQGLWLRQGXULQJWKLVSURFHGXUHWKHQWKHN9S
RYHUULGHFLUFXLWZLOOKDYHWREHGLVDEOHGRUVHOHFWPDQXDO%HVXUHWRUHHQDEOHWKH
RYHUULGHFLUFXLWVDIWHUILQLVKLQJWKLVMREFDUG
0DQXDO0RGH
6HWPDQXDOP$WRPD[LPXP
0DNHDIOXRURH[SRVXUH
)RUHDFKN9S DWPLQLPXPDQGPD[LPXPN9S UHFRUGWKHIROORZLQJ
0D[LPXPH[SRVXUHUDWH LI³5´PHWHULVEHLQJXVHG
0D[LPXPIOXRURP$GLVSOD\HGDWWKHFRQVROH
Specification: 0D[LPXPH[SRVXUHUDWHLV5PLQ

 9DVFXODU6\VWHPV
0RYH[±UD\WXEHWRWKHPD[LPXP6,'DQG,,WRFPDERYHLVRFHQWHU
5HSHDWSUHYLRXVPHDVXUHPHQWVRIH[SRVXUHDQGPD[LPXPP$
5HFRUGXQGHUWKHFROXPQV³0D[6,'0D[P$´DQG³0D[6,'([S5DWH´
NOTE:8VHDFWXDOLVRFHQWHUQRWWDEOHWRSDW

 'DWD&KHFN
,I³5´PHWHUZDVQRWXVHGYHULI\WKDWWKH0D[P$GDWDLVZLWKLQRISUHYLRXVGDWD
WDNHQ
,IWKHUHDUHDQ\GRXEWVDERXWWKHGDWDWDNHQRUWKHSUHYLRXVFDOLEUDWLRQGDWD
VFKHGXOHWKHURRPIRUWURXEOHVKRRWLQJUHSDLURUFDOLEUDWLRQ
 For non–GE systemsUHIHUWR2(0VHUYLFHGRFXPHQWDWLRQ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,,(175$1&('26( +] -RE&DUG;30± RI

MREFDUG INPUT DOSE STANDARD OPERATING PROCEDURE FOR DOSE CALCULATOR

VXEDVVHPEO\ ,0$*( ,17(16,),(5 GDWH

SXUSRVH 9HULILFDWLRQRI'RVH WLPHPLQ

PREREQUISITES
NOTE: 7KLVSURFHGXUHGRHVQRWPHDVXUH'563HGLDWULF
7RROV5HTXLUHG 5DGLDWLRQ0HWHU LH0'+PHWHUZLWKFFSUREH
3KDQWRP LQFKDOXPLQXPLQFKFRSSHUDQG±LQFKHVRIDFU\OLF
RUPPFRSSHUVHWUHI
NOTE:For non–GE systemsUHIHUWR2(0VSHFLILFVHUYLFHGRFXPHQWDWLRQ
TASK DESCRIPTION
Establish the following operating conditions:
*ULGLQVWDOOHG²(;&(37/8±&5 )/(*$&<
3RVLWLRQLPDJHLQWHQVLILHUDVIROORZV
D R&F systemsWRPD[LPXP6,'
D Vascular/Cardiac systemsWRFP6,'DQGWDEOHWRSFPEHORZWKH
LPDJHLQWHQVLILHU
3ODFH)ODW)LHOGSKDQWRP ±LQFKHVRIDFU\OLFLQFKDOXPLQXPDQGLQFK
FRSSHU RQWKHWDEOHWRS DFU\OLFRQWKHERWWRPDQGFRSSHURQWKHWRS RU
PPFRSSHU
&HQWHUUDGLDWLRQSUREH GRQRWKDQG±KROGSUREHGLUHFWO\XVHLQVXODWLQJKROGHU
DJDLQVWWKHERWWRPRIWKHLPDJHLQWHQVLILHUVXUIDFH LHFROOLVLRQVHQVRUJULG
KROGHURUERWWRPRIVSRWILOPGHYLFH 

FLUORO PROCEDURE
$WWKHRSHUDWRUFRQVROHVHOHFW
D N9S
D &RQYHQWLRQDO )OXRUR
D 'RVH 0HGLXP'HWDLO
D 1RUPDO /)29 )LHOGRI9LHZ
0HDVXUHWKH&RQYHQWLRQDO)OXRURGRVHDQGUHFRUGWKH³0HDVXUHG'RVH´UHVXOWVRQ
'DWD6KHHWORFDWHGLQ&KDSWHURIWKLVPDQXDO
In addition:
6\VWHPVWKDWKDYH3URJUHVVLYH)OXRUR ';RU3XOVFDQ VHOHFW'LJLWDO)OXRURDW
FRQVROHPHDVXUHDQGUHFRUGRQ'DWD6KHHWLQ&KDSWHURIWKLVPDQXDO

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG INPUT DOSE STANDARD OPERATING


PROCEDURE FOR DOSE CALCULATOR
-RE&DUG;30± RI

VASCULAR, DIGITAL RECORD or PHOTOSPOT ENTRANCE DOSE PROCEDURE


:LWK³(VWDEOLVK2SHUDWLQJ&RQGLWLRQV´FRPSOHWHGVHOHFWWKHIROORZLQJSDUDPHWHUVDW
FRQVROH
D N9S
D P$ZKLFKSURGXFHVDQH[SRVXUH±PVHF 6WDUWZLWKP$ 
D LQFKILHOGRIYLHZ
D 'RVH
±³'´IRUVascular system
±'RVH³0HGLXP´IRUDigital Record systems with and without
subtraction
D 3URJUDPDQDFTXLVLWLRQUDWHRIRULPDJHVSHUVHFRQG
IRUH[SRVXUHV
0HDVXUHWKHDFFXPXODWLRQRIWHQFRQVHFXWLYHH[SRVXUHVGLYLGHWKHUHVXOWVE\WHQ
5HFRUGWKH´0HDVXUHG'RVH´UHVXOWVRQWKH'DWD6KHHWXVHGLQ)OXRUR3URFHGXUH

CARDIAC, CINE AND DYNAMIC ENTRANCE DOSE PROCEDURE


:LWK³(VWDEOLVK2SHUDWLQJ&RQGLWLRQV´FRPSOHWHGVHOHFWWKHIROORZLQJSDUDPHWHUVDW
FRQVROH
D N9S
D 6PDOOIRFDOVSRW 
D LQFKILHOGRIYLHZ
D 'RVH&RU&LQHLIDSSOLFDEOH
D IUDPHVSHUVHFRQG
3HUIRUPD&LQH'\QDPLFDFTXLVLWLRQDQGPHDVXUHWKHH[SRVXUH
5HFRUGWKH³0HDVXUHG'RVH´UHVXOWVRQWKH'DWD6KHHWXVHGLQ)OXRUR3URFHGXUH
NOTE: (QVXUHWKHH[SRVXUHLVDWOHDVWPVHF,QFUHDVH6,'DQGPDLQWDLQFPWR
WDEOHWRSLIQHFHVVDU\
&RPSDUHWKHUHVXOWZLWKWKHUHFRPPHQGHGYDOXHVLQWKHWDEOHRIWKHV\VWHP
,IWKH0HDVXUHG'RVHLVQRWZLWKLQWKH0LQ0D[RIDGRVHFDOLEUDWLRQLV
UHFRPPHQGHG

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
INDEX OF TABLES

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Positioner Type
ÁÁÁÁÁÁÁÁ
Table Number Positioner Type Table Number

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
/&/3&)0
ÁÁÁÁÁÁÁÁ 7$%/( /8$ 7$%/(

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
/8& 7$%/( $)0 7$%/(

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
/&
ÁÁÁÁÁÁÁÁ 7$%/( /HJDF\' 'LJLWDO 7$%/(

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
/&9 ÁÁÁÁÁÁÁÁ 7$%/( /HJDF\,6)' 7$%/(
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
/&$7LOW±& 7$%/( 5 )±´,, 7$%/(

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
/&9 7$%/( 5 )±´,, 7$%/(

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG INPUT DOSE -RE&DUG;30± RI

7$%/(
LC/LP/CFM

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
)255()(5(1&(&219(56,21)$&725,6

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ + 15% Range

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Suggested System

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Mode II Entrance Dose Dose Measurement Min Max

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Conventional Fluoro * 5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Pulsed Progressive Fluoro ** 5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Vascular Dose D X5H[S X5H[S X5H[S X5H[S

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Cardiac Cine or Dig. Dose C
ÁÁÁÁÁ
5K XUIU 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Dig. Cardiac film-less Dose C 5K XUIU 5K 5K 5K

7$%/(
LU–C
)255()(5(1&(&219(56,21)$&725,6*ULG5HPRYHG
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ Suggested System + 15% Range

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Mode
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
II Entrance Dose Dose Measurement Min Max

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Conventional Fluoro *
ÁÁÁÁÁÁÁÁÁÁÁ 5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ 5K 5K 5K 5K


ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Pulsed Progressive Fluoro **

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Vascular Dose D uR/exp X5H[S X5H[S X5H[S X5H[S

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Cardiac Cine or Dig. Dose C
ÁÁÁÁÁ
5K XUIU 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Dig. Cardiac film–less Dose C

7$%/(
5K XUIU 5K 5K 5K

LC+
)255()(5(1&(&219(56,21)$&725,6

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ Suggested System + 15% Range

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Mode
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
II Entrance Dose Dose Measurement Min Max

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Conventional Fluoro *
ÁÁÁÁÁÁÁÁÁÁÁ 5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Pulsed Progressive Fluoro **
ÁÁÁÁÁ 5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Vascular Dose D
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁX5H[S X5H[S X5H[S X5H[S

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
5K XUIU 5K 5K 5K
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Cardiac Cine or Dig. Dose C

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Dig. Cardiac film–less Dose C 5K XUIU 5K 5K 5K

&RQYHQWLRQDO)OXRURLVXVHGLQ&RQYHQWLRQDO,')DQG'5'5('56,PDJHKROGPRGH
3XOVHG3URJUHVVLYH)OXRURLVXVHGLQ3XOVFDQ&DPWURQLFVDQG';±'/;PRGH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG INPUT DOSE -RE&DUG;30± RI

7$%/(
LCV+

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
)255()(5(1&(&219(56,21)$&725,6

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ + 15% Range

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Suggested System

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Mode II Entrance Dose Dose Measurement Min Max

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Conventional Fluoro * 5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Pulsed Progressive Fluoro ** 5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Vascular Dose D X5H[S X5H[S X5H[S X5H[S

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
DRS Photospot
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁX5H[S X5H[S X5H[S X5H[S

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Cardiac Cine or Dig. Dose C
ÁÁÁÁÁ
5K XUIU 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
5K XUIU
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Dig. Cardiac film–less Dose C 5K 5K 5K

7$%/(
LCA, TILT– C

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
)255()(5(1&(&219(56,21)$&725,6

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ Suggested System + 15% Range

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Mode
ÁÁÁÁÁÁÁÁÁÁÁ
II Entrance Dose Dose Measurement Min Max

ÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁ
Conventional Fluoro *
ÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁ
5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ
Pulsed Progressive Fluoro ** 5K 5K 5K 5K

ÁÁÁÁÁ
Vascular Dose D X5H[S X5H[S X5H[S X5H[S

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Cardiac Cine or Dig. Dose C
ÁÁÁÁÁ
5K XUIU

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Dig. Cardiac film–less Dose C 5K XUIU
5K
5K
5K
5K
5K
5K

7$%/(
LCV
)255()(5(1&(&219(56,21)$&725,6

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ Suggested System + 15% Range

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Mode
ÁÁÁÁÁÁÁÁÁÁÁ
II Entrance Dose Dose Measurement Min Max

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Conventional Fluoro *
ÁÁÁÁÁÁÁÁÁÁÁ 5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Pulsed Progressive Fluoro ** 5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Vascular Dose D
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
X5H[S X5H[S X5H[S X5H[S

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
5K XUIU 5K 5K 5K
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Cardiac Cine or Dig. Dose C

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Dig. Cardiac film–less Dose C 5K XUIU 5K 5K 5K
&RQYHQWLRQDO)OXRURLVXVHGLQ&RQYHQWLRQDO,')DQG'5'5('56,PDJHKROGPRGH
3XOVHG3URJUHVVLYH)OXRURLVXVHGLQ3XOVFDQ&DPWURQLFVDQG';±'/;PRGH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG INPUT DOSE -RE&DUG;30± RI

7$%/(
LU/A

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
)255()(5(1&(&219(56,21)$&725,6

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ + 15% Range

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Suggested System

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Mode II Entrance Dose Dose Measurement Min Max

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Conventional Fluoro * 5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Pulsed Progressive Fluoro ** 5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Vascular Dose D X5H[S X5H[S X5H[S X5H[S

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Cardiac Cine or Dig. Dose C
ÁÁÁÁÁ
5K XUIU 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Dig. Cardiac film–less Dose C 5K XUIU 5K 5K 5K

7$%/(
AFM
)255()(5(1&(&219(56,21)$&725,6
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ Suggested System + 15% Range

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Mode
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
II Entrance Dose Dose Measurement Min Max

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Conventional Fluoro *
ÁÁÁÁÁÁÁÁÁÁÁ 5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ 5K 5K 5K 5K


ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Pulsed Progressive Fluoro **

ÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ
Vascular Dose D X5H[S X5H[S X5H[S X5H[S
DRS Photospot
ÁÁÁÁÁ X5H[S X5H[S X5H[S X5H[S

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Cardiac Cine or Dig. Dose C
ÁÁÁÁÁ
5K XUIU

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Dig. Cardiac film–less Dose C 5K XUIU
5K
5K
5K
5K
5K
5K

7$%/(
R&F 16” LEGACY D (DIGITAL ONLY)
)255()(5(1&(&219(56,21)$&725,6*5,'2872))29
ÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ Suggested System + 15% Range

ÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁ
Mode
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
II Entrance Dose Dose Measurement Min Max

ÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Conventional Fluoro *
ÁÁÁÁÁÁÁÁÁÁÁ 5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁ
DRS Photospot
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ X5H[S X5H[S X5H[S X5H[S

ÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
DRS Dynamic

&RQYHQWLRQDO)OXRURLVXVHGLQ&RQYHQWLRQDO,')DQG'5'5('56,PDJHKROGPRGH
3XOVHG3URJUHVVLYH)OXRURLVXVHGLQ3XOVFDQ&DPWURQLFVDQG';±'/;PRGH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG INPUT DOSE -RE&DUG;30± RI

7$%/(
R&F 16” LEGACY ISFD

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
)255()(5(1&(&219(56,21)$&725,6*5,'2872))29

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ
Suggested System + 15% Range

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Mode II Entrance Dose Dose Measurement Min Max

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Conventional Fluoro * 5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ
DRS Photospot X5H[S X5H[S X5H[S X5H[S
DRS Dynamic
ÁÁÁÁÁ
7$%/(
R&F 9”II
)255()(5(1&(&219(56,21)$&725,6*5,'2872))29
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁSuggested System + 15% Range

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Mode
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
II Entrance Dose Dose Measurement Min Max

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Conventional Fluoro *

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
DRS Photospot X5H[S X5H[S X5H[S X5H[S

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
DRS Dynamic

7$%/(
R&F 12” II
)255()(5(1&(&219(56,21)$&725,6*5,'2872))29

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ
Suggested System + 15% Range

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Mode
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
II Entrance Dose Dose Measurement Min Max

ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
Conventional Fluoro *
ÁÁÁÁÁÁÁÁÁÁÁ
5K 5K 5K 5K

ÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁÁÁ
ÁÁÁÁÁÁÁÁÁÁÁ
DRS Photospot X5H[S X5H[S X5H[S X5H[S
DRS Dynamic
ÁÁÁÁÁ
&RQYHQWLRQDO)OXRURLVXVHGLQ&RQYHQWLRQDO,')DQG'5'5('56,PDJHKROGPRGH
3XOVHG3URJUHVVLYH)OXRURLVXVHGLQ3XOVFDQ&DPWURQLFVDQG';±'/;PRGH
NOTE 1: For non–GE systemsUHIHUWR2(0VSHFLILFVHUYLFHGRFXPHQWDWLRQ
NOTE 2: For Prestige VH/II and VH/AD systemsUHIHUWR&'520±

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

*(1(5$7256 -RE&DUG;30± RI

MREFDUG CINE MAXIMUM PULSE WIDTHS

VXEDVVHPEO\ *(1(5$725,0$*(6<67(0 GDWH

SXUSRVH 7RYHULI\WKHPD[LPXPSXOVHZLGWKRIWKHV\VWHP WLPHPLQ


DWHDFKIUDPHUDWH

PREREQUISITES
7RRO5HTXLUHG +DQGWRROV
6FRSH
.HLWKOH\+9GLYLGHU RSWLRQDO
,RQFKDPEHU RSWLRQDO

TASK DESCRIPTION
Procedure:
NOTE: 7KHPD[LPXPSXOVHZLGWKIRUHDFKIUDPHUDWHLVRIWKHIUDPHUDWHLQXVHRU
PVHFZKLFKHYHULVOHVV
9HULI\WKDWWKHGLVSOD\HGSXOVHZLGWKVDQGWKHDFWXDOSXOVHZLGWKVDUHWKHVDPH
9HULI\WKDWHDFKIUDPHUDWHLVFDSDEOHRILWVPD[LPXP
CGR:
9HULI\WKHSXOVHZLGWKIRUHDFKRIHLJKWFRQVROHVHOHFWLRQVLVWKHVDPHDVLQGLFDWHG
3XOVHZLGWKFDQEHYHULILHGE\XVLQJWKH.HLWKOH\WKH+9GLYLGHURULRQFKDPEHULQ
WKH[±UD\ILHOGRUE\ORRNLQJDWDN9SRUP$UHIHUHQFHSRLQWZLWKDVFRSHLQ
\RXUSDUWLFXODUJHQHUDWRU
6HHWKHIROORZLQJLOOXVWUDWLRQRQZKHUHWRPHDVXUHSXOVHZLGWK

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG CINE MAXIMUM PULSE WIDTHS -RE&DUG;30± RI

ADVANTX
8VH&DOLEUDWLRQ8QLW;0DQXDO&LQH)OXRUR7RRO
)UDPHUDWHFDQEHVHOHFWHGDQGWKHSXOVHZLGWK0$;DQG$&78$/FDQEH
GLVSOD\HG
3:FDQDOVREHVHHQRQN9SZDYHIRUP
-N9S2XWRQ/);$$VFRSHWHVWSRLQW
,QWKHFDOXQLWVHOHFWHDFKIUDPHUDWHDQGYHULI\3:¶V
9HULI\3:¶VLQWKHDSSOLFDWLRQPRGHWKDWDUHGLVSOD\HGRQWKHVFUHHQ
IUDPHVVHF PV
IUDPHVVHF PV
IUDPHVVHF PV
IUDPHVVHF PV
IUDPHVVHF PV
MPX/L500
3XOVHZLGWKVDUHWKHVDPHDV$GYDQW[
9HULI\3:¶VRQFRQVROHDUHFRUUHFW
'XULQJFLQHYHULI\WKDW0D[3:IRUHDFKIUDPHUDWHLVFRUUHFW
MSI/FL300
3KDVH
'XULQJFLQHYHULI\WKDW0D[3:IRUHDFKIUDPHUDWHLVFRUUHFW
IUDPHVVHF PV
IUDPHVVHF PV
IUDPHVVHF PV
IUDPHVVHF PV
3KDVHDQGEHORZ
'XULQJFLQHYHULI\WKDW0D[3:IRUHDFKIUDPHUDWHLVFRUUHFW
IUDPHVVHF PV
IUDPHVVHF PV
IUDPHVVHF PV
IUDPHVVHF PV
IUDPHVVHF PV
NOTE: For non–GE systemsUHIHUWRVSHFLILF2(0VHUYLFHGRFXPHQWDWLRQ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

*(1(5$7256 -RE&DUG;30± RI

MREFDUG CINE KVP AND MA

VXEDVVHPEO\ ,0$*(6<67(0*(1(5$725 GDWH

SXUSRVH 7RYHULI\WKHN9SDQG0D[P$GXULQJWKHFLQH WLPHPLQ


PRGHRIRSHUDWLRQ

PREREQUISITES
-RE&DUG;30±0D[&LQH3XOVH:LGWKVVKRXOGEHGRQHILUVW
7RRO5HTXLUHG '90
.HLWKOH\RU+9GLYLGHURUHTXLYDOHQW RSWLRQDO
+DQGWRROV
TASK DESCRIPTION
For All Cine Systems
,IQR±ORDGN9SGDWDKDVEHHQDFTXLUHGZLWKLQWKHODVWPRQWKVWKHQSODFHWKH
'90RQWKHYROW±SDFRQWHUPLQDORIWKH$DQG%SKDVHZLQGLQJ
7KH.HLWKOH\FDQEHXVHGDORQJZLWKWKLVWRYHULI\WKHYROWDJHDQGN9S
NOTE: .HLWKOH\ZLOOFUHDWHSXOVHVRQWKHVL]HDQGIDOOWLPHVRIWKHZDYHIRUPRQSXOVH
V\VWHPV,ILQGRXEWFKDQJHWKH6,'DQGLIWKHSXOVHVDUHFUHDWHGE\WKH.HLWKOH\
WKHLUDPSOLWXGHZLOOQRWFKDQJH
7KHQR±ORDGYROWDJHVPXVWEHZLWKLQ 9$&
,I\RXGRQRWKDYHUHFHQWQR±ORDGN9SGDWDIRUWKLVV\VWHPWKHQ\RXPXVWYHULI\WKH
N9SZLWKHLWKHUWKH.HLWKOH\ VHHMREFDUG;30± RU\RXPXVWXVHWKH+9
GLYLGHU VHH7DE 5HFRUGQR±ORDGYROWDJHVDIWHUXVLQJWKH+9GLYLGHU
CGR Systems
&3*V\VWHPVPXVWXVHHLWKHUWKH.HLWKOH\WKHLQWHUQDOYROWDJHGLYLGHURUWKH
&*5H[WHUQDOGLYLGHU7KH*(+9GLYLGHUFDQEHXVHGEXWEHFDXVHRIWKH
ODFNRIIUHTXHQF\FRPSHQVDWLRQWKH&*5GLYLGHULVSUHIHUUHG
ADVANTX 5HIHUWR&DOLEUDWLRQ8VHUV*XLGH
&DOLEUDWLRQ8QLW³;0DQXDO&LQH)OXRUR7RRO´
7KLVFDOLEUDWLRQXQLWLVDVHUYLFHIXQFWLRQIRUFKHFNLQJWKH&LQHDQG)OXRURIXQFWLRQ
RIWKHLPDJHV\VWHP
&KHFNERWK;/DQG;6DWWKHPLQLPXPDQGPD[LPXPN9S¶VIRUERWKN9SDQGP$
DFFXUDF\
6HOHFWIUDPHUDWHDQGPD[LPXPSXOVHZLGWK
&ORVHWKHFROOLPDWRUEODGHVLIQRWXVLQJWKH.HLWKOH\
NOTE: 7KH$GYDQW[LQWHUQDOEOHHGHUPD\EHXVHGLIWKHDFFXUDF\KDVEHHQ
GHWHUPLQHG6HHWKHIROORZLQJLOOXVWUDWLRQVKRZLQJZKHUHWRPHDVXUHSHDNFLQHN9S
IRU.HLWKOH\DQG+9EOHHGHU

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG CINE KVP AND MA -RE&DUG;30± RI

Oscilloscope Trace of Cine kV Accuracy Test

DURING AFTER
INITIAL INITIAL
INTERVAL INTERVAL

B
C

MPX/L500
&KHFNWKHPD[LPXPFLQHN9SDQGP$IRUERWKWKHODUJHDQGVPDOOILODPHQW
6HOHFWIUDPHUDWHDQGPD[LPXPSXOVHZLGWK
'LVDEOHN9SRYHUULGH SXOO0;$$ 
5HPRYH,,+9SRZHUVXSSO\ERDUG 0;$$ 
&ORVHWKHFROOLPDWRUEODGHVLIQRWXVLQJWKH.HLWKOH\
8VHWKHFRQVROHPHWHULISRVVLEOHRULQVWDOOP$PHWHULQVHULHVZLWKP$OHDGDWWKH
WUDQVIRUPHU
6HOHFWN9SDQGIRFDOVSRWIRU\RXUV\VWHP
'HSUHVVFLQHIRRWVZLWFKDQGUHFRUGN9SDQGDYHUDJHP$
CAUTION: The panel and external meter reads average mA. This is the result of
the peak mA values and the pulse width. If the average mA is incorrect, verify
the pulse width before any service is done to correct the mA settings.
0; J GHJ N9S P$ N9S P$
0; J GHJ N9S P$ N9S P$
0; J GHJ N9S P$ N9S P$
0; J GHJ N9S P$ N9S P$
0; J GHJ N9S P$ N9S P$
0; J GHJ N9S P$ N9S P$
0; J GHJ N9S P$ N9S P$
0; J GHJ N9S P$ N9S P$

+7&+7*WXEHVXVHWKHVDPHN9SDQGP$DVWKH0;±GHJ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG CINE KVP AND MA -RE&DUG;30± RI

MSI/FLUORICON 300
&KHFNWKHPD[LPXPFLQHN9SDQGP$RQERWKWKHODUJHDQGVPDOOILODPHQW
6HOHFWIUDPHUDWH
6HOHFWPD[LPXPSXOVHZLGWK
CAUTION: The panel and external meter reads average mA. This is the result of
the peak mA values and the pulse width. If the average mA is incorrect, verify
the pulse width before any service is done to correct the mA settings.
'LVDEOH.9RYHUULGH LIV\VWHPJRHVLQWR.9RYHUULGH±SXOOFDUG 
0; J GHJ N9S P$ N9S P$
0; J GHJ N9S P$ N9S P$
+7&WXEHXVHVWKHVDPHN9SDQGP$FDOLEUDWLRQGDWD

NOTE: For non–GE systemsUHIHUWRVSHFLILF2(0VHUYLFHGRFXPHQWDWLRQ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

/($.$*(&855(17 -RE&DUG;30± RI

MREFDUG ELECTRICAL LEAKAGE CURRENT AND GROUND RESISTANCE

VXEDVVHPEO\ GDWH

SXUSRVH 9HULI\VDIHW\JURXQGLQJ WLPHPLQ

PREREQUISITES
'DOH6DIHW\$QDO\]HURU0LFURJXDUGRUHTXLYDOHQW
SAFETY PRECAUTIONS
8VHDSSURSULDWHEDFNDQGEORRGERUQSDWKRJHQVSURWHFWLRQZKHQLQVSHFWLQJRUUHSDLULQJWKH
V\VWHP
TASK DESCRIPTION
7KHVHSURFHGXUHVPD\EHXVHGLQVWHDGRIPRUHFRPSUHKHQVLYHWHVWV,QVRPHDUHDV
FHUWDLQDUHDVLQWKH8QLWHG6WDWHVDQG(XURSH ORFDOFRGHVUHTXLUHWKDWOHDNDJHDQG
JURXQGLPSHGDQFHWHVWVPHHWPRUHFRPSUHKHQVLYHUHTXLUHPHQWV7KHVHXVXDOO\
LQFOXGHPHHWLQJWKHUHTXLUHPHQWVRI8/6WDQGDUGDQG,(&,QWKHVH
FLUFXPVWDQFHV\RXPXVWSHUIRUPWKHWHVWVLQWKHIROORZLQJGLUHFWLRQVLQDGGLWLRQWR
WKHWHVWVLQGLFDWHGKHUH
±(OHFWULFDO6DIHW\±/HDNDJH&XUUHQWV
±(OHFWULFDO6DIHW\±(TXLSPHQW*URXQGLQJ
7KLVWHVWVDUHH[WUDFWHGIURPGLUHFWLRQ±$GYDQW[/8±$5HVLVWDQFH0HDVXUHPHQW
DQG/HDNDJH7HVWLQJ7KLVPHHWVVSHFLILFDWLRQVRI$16,1)3$
$GGLWLRQDOLQIRUPDWLRQFDQEHREWDLQHGLQWKHIROORZLQJGRFXPHQWV
±$GYDQW[/8$3RZHUDQG*URXQGLQJ
±$GYDQW[6\VWHP)DFLOLW\3RZHUDQG*URXQGLQJ
±$GYDQW[6\VWHP&DEOH5RXWLQJ
±$GYDQW[V\VWHP3RZHUDQG*URXQG7URXEOHVKRRWLQJ
)RUDGGLWLRQDOLQIRUPDWLRQRQH[WHUQDOPHDVXUHPHQWVUHIHUWRWKH'DOHPHWHUPDQXDO
Verify that the hospital is completing leakage testing and note in the checklist
comments. If no testing has been done, complete the following procedures to
insure patient safety.
7KHVHWHVWVDUHQRWDEVROXWHLQILQGLQJJURXQGLQJSUREOHPVEXWDUHDQLQGLFDWRUWRDGGLWLRQDO
WHVWVQHHGHG'DWDVKHHWVFDQEHIRXQGLQVHFWLRQRIWKLVPDQXDO
CAUTION: Disconnecting grounds can be dangerous. First verify that there is minimal current in
the ground wire prior to disconnecting. Use a clamp on ampmeter. High currents are the result of
large voltage differences. None of the tests in these procedures require the grounds to be
disconnected unless troubleshooting a problem. Use established safety procedures at all times.

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG ELECTRICAL LEAKAGE CURRENT


AND GROUND RESISTANCE -RE&DUG;30± RI

,//8675$7,21 
ADVANTX PATIENT VICINITY “STAR” GROUND SYSTEM

= CHASSIS GROUND

System = GROUND WIRE


Cabinet
LFX1

LFX2

GANTRY
TABLE

Positioner
Cabinet PATIENT VICINITY

2.3 METERS
7 FEET 6 INCHES
(FROM FLOOR)
1.8 METERS
6 FEET

1.8 METERS
6 FEET

1.8 METERS
6 FEET

As defined in NFPA 99 Standard


1.8 METERS for Health Facilities,
6 FEET
PATIENT VICINITY is 1.8m (6 ft.) beyond the
perimeter of the table and extending vertically
2.3m (7 ft. 6 in.) off the floor.

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG ELECTRICAL LEAKAGE CURRENT


AND GROUND RESISTANCE -RE&DUG;30± RI

Leakage Current Test Procedure:


6HH,OOXVWUDWLRQIRUWKHXVDJHRIWKH'DOHPHWHUWRPHDVXUHOHDNDJHFXUUHQW
&RQQHFWWKHEODFNOHDGWRWKHSOXJDQGWKHUHGOHDGWRWKHH[WHUQDOSOXJRIWKH'DOH
PHWHU6HWWKHIXQFWLRQVZLWFKWRH[WHUQDODQGGLVSOD\UHDGLQJVZLOOEHLQPLFURDPSV
7KHEODFNOHDGZLOOEHFRQQHFWHGWRWKHWDEOHEDVHDQGWKHUHGOHDGLVWKHQ
FRQQHFWHGWRWKHGHYLFHXQGHUWHVW
/HDNDJHFXUUHQWFDQQRWH[FHHGWKHIROORZLQJDQGLVWHVWHGZLWKSRZHUon
&ULWLFDOFDUHDUHDV LQYDVLYH  ±XD
*HQHUDOFDUHDUHDV ±XD
1RWLQWHQGHGIRUSDWLHQWDUHD ±XD
7HVWLQJPXVWEHFRPSOHWHGEHWZHHQWKHV\VWHPUHIHUHQFHJURXQGSRLQW WDEOHEDVH WRXQLW
UHIHUHQFHJURXQGSRLQWV LHJDQWU\DQGFDELQHWVVHHLOOXVWUDWLRQ LQIXQFWLRQDOVWDU
JURXSLQJV7HVWDOOFDELQHWVIRRWVZLWFKDQGURRPJURXQGEXVEDU7HVWWKHDX[LOLDU\
LWHPVVXFKDVPRQLWRUVLQMHFWRUFKDQJHUVKLLQWHQVLW\ODPSVRYHUKHDGWXEH
VXVSHQVLRQVDQGOHDGJODVVVKLHOG7HVWDOOH[SRVHGFRQGXFWLYHPHWDOVXUIDFHVLQ
SDWLHQWYLFLQLW\ IHHWDURXQGWDEOHDQGPRUIHHWDERYH 6HHLOOXVWUDWLRQ
5HFRUGWKHVHUHVXOWVLQWKHGDWDVKHHW
+LQWV
/RRNIRULWHPVWKDWKDYHDEQRUPDOPHDVXUHPHQWVKLJKRUORZ7KHVHFRXOGLQGLFDWH
PLV±ZLULQJORRVHFRQQHFWLRQVRUSRRUFRQQHFWLRQVGXHWRFRUURVLRQSDLQWHG
VXUIDFHVHWF+LJKOHDNDJHFRXOGLQGLFDWHDZLULQJHUURUVXFKDVDQHXWUDOFRQQHFWHG
WRWKHJURXQG
)OXFWXDWLQJJURXQGFXUUHQWVFRXOGLQGLFDWHDVKRUWSRRUFRQQHFWLRQRUIDFLOLWLHV
JURXQGSUREOHPFDXVLQJOHDNDJHFXUUHQWVIURPRWKHUDUHDVRIWKHIDFLOLW\WRIORZ
WKRXJKRXUV\VWHPJURXQGV
Ground Resistance Test Procedure:
6HH,OOXVWUDWLRQIRUWKHXVDJHRIWKH'DOHPHWHUWRPHDVXUHJURXQGUHVLVWDQFH
&RQQHFWWKHEODFNOHDGVWRWKHH[WHUQDODQGFKDVVLVSOXJVRIWKH'DOHPHWHU6HWWKH
IXQFWLRQVZLWFKWRUHVLVWDQFHDQGGLVSOD\UHDGLQJVZLOOEHLQWHQWKVRIRKPV7KHEODFN
FKDVVLVOHDGZLOOEHFRQQHFWHGWRWKHWDEOHEDVHDQGWKHRWKHUEODFNOHDGLVWKHQ
FRQQHFWHGWRWKHGHYLFHXQGHUWHVW
$OOJURXQGUHVLVWDQFHWHVWLQJLVGRQHZLWKSRZHUoff*URXQGFXUUHQWZLOOFDXVHHUURUVLQWKH
UHVLVWDQFHUHDGLQJV8VHORFNRXWWDJRXWSURFHGXUHV
0D[LPXPJURXQGUHVLVWDQFHLVRKPVLPSHGDQFH
7KLVGRHVQRWLQFOXGHFRUGFRQQHFWLRQGHYLFHV&RUGFRQQHFWLRQGHYLFHVPXVWEHFKHFNHG
LQGLYLGXDOO\E\PHDVXULQJIURPJURXQGWHUPLQDORIWKHGHYLFHSRZHUSOXJWRWKH
FKDVVLVRIWKHGHYLFH7KLVPXVWEHOHVVWKDQRKPV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG ELECTRICAL LEAKAGE CURRENT


AND GROUND RESISTANCE -RE&DUG;30± RI

,//8675$7,21 
USING DALE 600 TO MEASURE LEAKAGE CURRENT

CONNECT METER
1. LEADS
%/$&. 5('
/($' /($'

/($'

&+$66,6 (;7(51$/ %/. 5('


P$ 72 72
W P$ &+$66,6 (;7(51$/
7(6732,176

UNIT A UNIT B
&+$66,6 &+$66,6
*5281'32,17 *5281'
25 32,17
7$%/(6<67(0
5()(5(1&(
SELECT *5281'32,17
2. FUNCTION

9 ± /,1(92/76
$ ± &855(17
W ± 5(6,67$1&(
/ ± ($57+
3.
READ
( /$ DISPLAY
± &+$66,6 5$ //
$ 5/
. ± /($'±*1' &
$ ± /($'±/($'
*
( ± /($'±,62
m$ ± (;7(51$/
$//

RECORD
4. VALUE

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG ELECTRICAL LEAKAGE CURRENT


AND GROUND RESISTANCE -RE&DUG;30± RI

,//8675$7,21 
USING DALE 600 TO MEASURE GROUND RESISTANCE

CONNECT METER
1. LEADS
%/$&. %/$&.
/($' /($'

/($'

&+$66,6 (;7(51$/ %/. %/.


P$ 72 72
W P$ &+$66,6 (;7(51$/
7(6732,176

81,7$ 81,7%
&+$66,6 &+$66,6
*5281' *5281'
32,17 32,17

SELECT
2. FUNCTION

9 ± /,1(92/76
$ ± &855(17
W ± 5(6,67$1&(
/ ± ($57+ READ
( ± &+$66,6 5$
/$
//
3. DISPLAY
$ 5/
. ± /($'±*1' &
$ ± /($'±/($'
*
( ± /($'±,62
m$ ± (;7(51$/
$//

RECORD
4. VALUE

NOTE: 72&255(&7)25$3266,%/('&&20321(172)7+(/($.$*(&855(17
)/2:,1*%(7:((17:232,1765(9(56(7+(0(7(5/($'&211(&7,216
$1'$9(5$*(7+(7:25($',1*6

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG ELECTRICAL LEAKAGE CURRENT


AND GROUND RESISTANCE -RE&DUG;30± RI

8VLQJWKHWDEOHEDVHJURXQGDVDUHIHUHQFHFKHFNWKHJURXQGUHVLVWDQFHWRDOORIWKHV\VWHP
FRPSRQHQWVLQIXQFWLRQDOVWDUJURXSVDQGUHFRUGWKHPHDVXUHPHQWVLQWKHGDWD
VKHHW7HVWDOOFDELQHWVIRRWVZLWFKDQGURRPJURXQGEXVEDU7HVWWKHDX[LOLDU\LWHPV
VXFKDVPRQLWRUVLQMHFWRUFKDQJHUVKLLQWHQVLW\ODPSVRYHUKHDGWXEHVXVSHQVLRQV
DQGOHDGJODVVVKLHOG+LJKUHVLVWDQFHFRXOGEHFDXVHGE\QRJURXQGRUDSRRU
FRQQHFWLRQ7HVWDOOFRQGXFWLYHVXUIDFHVLQWKHSDWLHQWYLFLQLW\
+LQWV
/RRNIRUXQGHUVL]HGJURXQGZLUHVDQGVFKHGXOHWLPHWRUHSODFHZLWKDZLUHWKDWZLOO
PHHW VSHFLILFDWLRQV
*URXQGUHVLVWDQFHUHDGLQJVVKRXOGQRWIOXFWXDWH,IVRWKLVLQGLFDWHVDQLQWHUPLWWHQW
VKRUWRUDORRVHFRQQHFWLRQ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

IMAGING PERFORMANCE
TABLE OF CONTENTS

JOB CARD TITLE PAGE

;30± ,0$*(48$/,7<  ±

;30± 5(62/87,21  ±

;30± 3+2726327),/05(9,(:  ±

;30± 3+2726327&$0(5$  ±

;30± ',*,7$/3+2726327 ,0$*(5(9,(:  ±

;30± &,1(),/05(9,(:  ±

;30± &,1(&$0(5$  ±

;30± 352&(66254&  ±

;30± &,1(352&(6625  ±

;30± ')9$6&8/$5,0$*(48$/,7<  ±

;30± ')&$5',$&,0$*(48$/,7<  ±

;30± '*';'/;9$6&8/$5,0$*(48$/,7<  ±

;30± '*';'/;&$5',$&,0$*(48$/,7<  ±

;30± 0,±)250$77(5  ±

;30± 0/$6(5&$0(5$  ±

;30± &,1(352-(&7256  ±

±L
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

7+,63$*(,17(17,21$//</()7%/$1.

±LL
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG IMAGE QUALITY

VXEDVVHPEO\ ,0$*(6<67(0 GDWH

SXUSRVH (YDOXDWLRQRILPDJHTXDOLW\DQG$%&UHVSRQVH WLPHPLQ

PREREQUISITES
7RROV5HTXLUHG &9SKDQWRP LISOH[LJODVLVQRWUHPRYDEOHPP&XFDQEHXVHGDV
KRPRJHQHRXV SKDQWRP
/RZFRQWUDVWSKDQWRPIRUQRQ±*(V\VWHPVXVHPP&X
2VFLOORVFRSHZLWKFRD[DQG7FRQQHFWRU
TASK DESCRIPTION
(VWDEOLVKWKHIROORZLQJRSHUDWLQJFRQGLWLRQV
N9IOXRUR
$872EULJKWQHVVPRGH
I)29 ODUJHVW)29LIVPDOOHUWKDQI
0LQLPXP6,'
7DEOHIIURP,,LIPRYDEOH
*ULG,1
0HGLXPIOXRURGRVH LIDSSOLFDEOH
&HQWHU±ISOH[LJODVI$ODQGI&XIURP&9SKDQWRPLQ)29 &XWRZDUGV,, 
NOTE: PPRI&XRUVKHHWVRI&X VKHHW$OIURP&9SKDQWRPPD\EHXVHG
&ROOLPDWHVRWKDWFROOLPDWRUEODGHVDUHFOHDUO\YLVLEOHRQDOOVLGHV DSSUR[LPDWHO\RIDUHD
IRUFLUFXODUFROOLPDWRU 
NOTE: &ROOLPDWRUEODGHVZLOOEHVHHQRQYLGHRDVDEODFNOHYHOUHIHUHQFH
&RQQHFWVFRSHWRPRQLWRUYLGHR XVHFRD[DQG³7´DWEDFNRIPRQLWRURUZKHUHYHU
FRQYHQLHQW 
9HULI\DPSOLWXGHRIV\QFSXOVHV7KH\VKRXOGEHDSSUR[LPDWHO\P9,IQRWFKHFNIRU
SURSHUWHUPLQDWLRQRIYLGHRFRD[ RKPV 

VIDEO LEVELS
Conventional Fluoro

6HOHFW&RQYHQWLRQDO)OXRURPRGHLIPRUHWKDQRQHPRGHRIIOXRURLVDYDLODEOH
'XULQJIOXRURH[SRVXUHQRWHYLGHR³EODFNOHYHO´DQGIOXRURYLGHROHYHOREVHUYHGRQ
VFRSH
5HFRUGWKHVHYLGHROHYHOVRQGDWDVKHHW VHHLOOXVWUDWLRQ
%ODFNOHYHOLVW\SLFDOO\P9DERYHEODQNLQJ P9IRU7(VHULHVFDPHUDV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG IMAGE QUALITY -RE&DUG;30± RI

9LGHROHYHOLVW\SLFDOO\±P9DERYHEODFNOHYHOIRUV\VWHPVXVLQJ$YHUDJH
%ULJKWQHVV'HWHFWLRQRU±PYIRUV\VWHPVXVLQJ3HDNGHWHFWLRQ
,//8675$7,21 
VIDEO LEVEL

SCOPE SETTINGS VIDEO LEVEL


VERT AMPL
0.2 volt/div
TIME BASE
5 msec/div BLACK LEVEL - - -- - - ---
} 50 mV
BLANKING --- - - -- - -

SYNC TIPS ---

NOTE 1: 9LGHROHYHOVDUHPHDVXUHGIURPFHQWHURIFROOLPDWRUEODFNWRFHQWHURI
ZKLWH
NOTE 2: For non–GE systemsUHIHUWRVSHFLILF2(0VHUYLFHGRFXPHQWDWLRQ
Digital Fluoro (Image Hold)

6HOHFW'LJLWDO)OXRURPRGHLIDYDLODEOH ,PDJH+ROGPRGHIRU5 )V\VWHPV


'XULQJIOXRURH[SRVXUHQRWHIOXRURYLGHROHYHOREVHUYHGRQVFRSH
5HFRUGIOXRURYLGHROHYHORQGDWDVKHHW
%ODFNOHYHOPD\EHKLJKHUWKDQFRQYHQWLRQDOIOXRUR ±P9
9LGHROHYHOLVW\SLFDOO\  P9IRUGLJLWDOIOXRUR
NOTE: 'LJLWDOV\VWHP52, 5HJLRQRI,QWHUHVW WRROVPD\EHXVHGWRYHULI\YLGHR
OHYHOV5HIHUWRVHUYLFHPDQXDOVIRUVSHFLILFSURFHGXUHV

Other Fluoro Modes (IDF, Pulscan, etc.)

6HOHFWRWKHUIOXRURPRGHVLIDYDLODEOH LH,')RU3XOVFDQ
'XULQJIOXRURH[SRVXUHQRWHIOXRURYLGHROHYHOREVHUYHGRQVFRSH
5HFRUGIOXRURYLGHROHYHORQGDWDVKHHW
9LGHROHYHOLVW\SLFDOO\ZLWKLQP9RI&RQYHQWLRQDOYLGHROHYHO
Stenoscop 2

'XULQJIOXRURH[SRVXUHQRWHIOXRURYLGHROHYHOREVHUYHGRQVFRSH
5HFRUGIOXRURYLGHROHYHORQGDWDVKHHW
9LGHROHYHOLVW\SLFDOO\  P9

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG IMAGE QUALITY -RE&DUG;30± RI

Alternate Method using DSM:


(QWHUWKH,4PRGH *0$NH\VSUHVVHGVLPXOWDQHRXVO\LVSDVVZRUG 
6HOHFWWKH52,DQGGUDZDER[LQWKHFHQWHURIWKHLPDJH
)OXRURLQDXWRPRGH
)ROORZWKH52,SURPSWVWRPHDVXUHWKHYLGHR
7KHGHQVLW\VKRXOGEHEHWZHHQ±
&ORVHWKHFROOLPDWRUDQGIOXRURDWPDQXDOPLQLPXP
5HSHDWWKH52,PHDVXUHPHQW
7KHGHQVLW\VKRXOGEHEHWZHHQ±
5HFRUGUHVXOWVRQGDWDVKHHWV
For MDA:
6HOHFWV\VWHPVHWXSSHUPDQHQWGDWDVHUYLFHPHQXLPDJHTXDOLW\PHDVXUH52,
3ODFHPPRIFRSSHU VKHHWVRIFRSSHURUVKHHWVRIFRSSHUDQGDOXPLQXP 
)OXRURLQDXWRPRGH
0HDVXUHPHDQYDOXH±VKRXOGEHEHWZHHQ±
&ORVHWKHFROOLPDWRUEODGHVDQGIOXRURDWPDQXDOPLQLPXP
5HSHDW52,PHDVXUHPHQW
7KHGHQVLW\VKRXOGEHEHWZHHQ±

Accent

6DPH0'$,4WHVWDVVWHQRVFRS

Digital Record (EPS – DRS, DRE, DRI, etc.)

6DPHRSHUDWLQJFRQGLWLRQVDV)OXRURZLWKWKHIROORZLQJDGGLWLRQV
N95HFRUG
P$6PDOOIRFDOVSRW
LPDJHVVHFIUDPHUDWH
6HOHFW'LJLWDO5HFRUGPRGHLIDYDLODEOH
6HOHFW³,PDJH+ROG´IOXRURPRGHLIDYDLODEOH
5HFRUGVHTXHQFHRIVHYHUDOLPDJHVDWHDFKGLJLWDOUHFRUGGRVHDYDLODEOH&KDQJH
P$LIQHFHVVDU\WRREWDLQDQH[SRVXUHWLPHRI±PV
5HYLHZRQHUHFRUGHGLPDJHIURPHDFKVHTXHQFHDQGQRWHYLGHROHYHOREVHUYHGRQ
VFRSH
5HFRUGYLGHROHYHORQGDWDVKHHW
'LJLWDOYLGHROHYHOLVW\SLFDOO\  P9
NOTE:'LJLWDOV\VWHP52, 5HJLRQRI,QWHUHVW WRROVPD\EHXVHGWRYHULI\YLGHR
OHYHOV5HIHUWRVHUYLFHPDQXDOVIRUVSHFLILFSURFHGXUHV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG IMAGE QUALITY -RE&DUG;30± RI

IMAGE CONTRAST

5HSODFHKRPRJHQHRXVSKDQWRPZLWK&9±SKDQWRP QR&XRU$OILOWHUV
NOTE: &9±SKDQWRPXVHGWRLQFUHDVHUDGLRJUDSKLFFRQWUDVW
&HQWHU&9±SKDQWRPLQ)LHOGRI9LHZ
2WKHURSHUDWLQJFRQGLWLRQVUHPDLQWKHVDPH

Monitor Brightness & Contrast


NOTE: ,ISURFHGXUHVXVLQJWHVWSDWWHUQVDQGRUOLJKWPHWHUVDUHDYDLODEOHWKH\VKRXOGEH
XVHG

$GMXVWDPELHQWOLJKWFRQGLWLRQVWRWKRVHXVHGGXULQJH[DPV
6HOHFW&RQYHQWLRQDO)OXRURPRGH
'XULQJIOXRURH[SRVXUHDGMXVWPRQLWRUBrightnessVRWKDWFLUFXODUEODQNLQJ
FROOLPDWRUEODGHDQGDEGRPHQVHFWLRQRISKDQWRPDUHHDVLO\YLVLEOHDQG
GLVWLQJXLVKDEOH
$GMXVWContrastVRWKDWOXQJVHFWLRQRISKDQWRPLVQRWRYHUO\EULJKWDQG
SHQHWURPHWHUVDUHHDVLO\YLVLEOHDQGDQ\DOSKD±QXPHULFVDUHQRWEOXUULQJ
H[FHVVLYHO\ &RQWUDVWZLOOEHUHDGMXVWHGGXULQJ('5HYDOXDWLRQLI
QHFHVVDU\

EDR Evaluation (if applicable)

6HOHFWI)29
6HOHFW'LJLWDO)OXRURRU,PDJH+ROGPRGHLIDYDLODEOHWRYHULI\WKDW$'FRQYHUWHUVLQ
GLJLWDOV\VWHPZLOOQRWEHVDWXUDWHG
3RVLWLRQ&9SKDQWRPDVVKRZQLQ,OOXVWUDWLRQ

,//8675$7,21 
CV PHANTOM

abdomen

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG IMAGE QUALITY -RE&DUG;30± RI

5HDGMXVWPRQLWRUContrastLIQHFHVVDU\WRPD[LPL]HYLVLELOLW\RIOXQJDUHDIHDWXUHV
ZLWKRXWEHLQJH[FHVVLYHO\EULJKW
2EVHUYHOXQJILHOGSDUWLFXODUO\YLVLELOLW\RISHQHWURPHWHUV
,ISHQHWURPHWHUVDUHQRWYLVLEOHUHFRUGSUREOHPRQGDWDVKHHW
NOTE: ,QDELOLW\WRYLVXDOL]HSHQHWURPHWHUVFDQEHFDXVHGE\('5FDO*DLQFDOPD[
%HDP&XUUHQWFDOPRQLWRUDGMXVWPHQWVHWF
GENERAL IMAGE QUALITY

$GGDOXPLQXPVKHHWWR&9±SKDQWRPWRPDNHLWD&9±SKDQWRP
NOTE: &9±LVJHQHUDOO\XVHGDVVWDQGDUGSKDQWRPZKHQREVHUYLQJYLGHR
ZDYHIRUPV
&HQWHU&9±SKDQWRPLQ)29
3HUIRUPWKHIROORZLQJREVHUYDWLRQVRIWKHIOXRURLPDJHLQ$//IOXRURPRGHV
9HULI\YLVLELOLW\RIDOOSHQHWURPHWHUKROHVLQ&9SKDQWRP
9HULI\YLVLELOLW\RIFROOLPDWRUEODGHEHWZHHQFLUFXODUEODQNLQJDQGDEGRPHQVHFWLRQRI
SKDQWRP
9HULI\LPDJHURXQGQHVV
9HULI\LPDJHVL]LQJDQGFHQWHULQJ
9HULI\LPDJHUHYHUVDORSHUDWLRQDQGLPDJHFHQWHULQJ
9HULI\VKXWWHUVDUHYLVLEOHLQDOOPDJPRGHVIRU86V\VWHPV
,IDQ\SUREOHPVDUHREVHUYHGUHFRUGSUREOHPVRQGDWDVKHHW

Digital Record (EPS – DRS, DRE, DRI, etc.)

5HFRUGVHYHUDOGLJLWDOLPDJHV
&KDQJHP$LIQHFHVVDU\WRREWDLQDQH[SRVXUHWLPHRI±PV
5HYLHZLPDJHIRUYLVLELOLW\RIFROOLPDWRUEODGHLQDUHDRIDEGRPHQVHFWLRQRI
SKDQWRP
,IFROOLPDWRUEODGHLVQRWYLVLEOHUHFRUGSUREOHPRQGDWDVKHHWDVD³GLJLWDOEODFN
OHYHOSUREOHP´
NOTE: ,QDELOLW\WRVHHFROOLPDWRUEODGHPD\LQGLFDWHDOLJKWELDVRUEODFNOHYHORIIVHW
SUREOHP
Photospot

5HFRUGVHYHUDOSKRWRVSRWLPDJHV
&KDQJHP$LIQHFHVVDU\WRREWDLQDQH[SRVXUHWLPHRI±PV
2EVHUYHLPDJHIODVKRQPRQLWRUGXULQJH[SRVXUHV
,IPRQLWRULPDJHLVWRRGDUNRUWRREULJKWUHFRUGSUREOHPRQGDWDVKHHW
5HFRUGHGLPDJHVZLOOEHHYDOXDWHGLQ;30±

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG IMAGE QUALITY -RE&DUG;30± RI

Cine
NOTE: 'LJLWDOFDUGLDF G\QDPLF IXQFWLRQVLIDYDLODEOHZLOOEHFKHFNHGLQ;30±

6HOHFW´)29
6HOHFWVPDOOIRFDOVSRW
9HULI\WKDW9&5LVHQDEOHGLISUHVHQW
'XULQJIOXRURH[SRVXUHQRWHDPSOLWXGHRIYLGHRZDYHIRUP
5HFRUGVHYHUDOVHFRQGVRIFLQHDWISV ISVIRU+]V\VWHPV
9HULI\WKDWSXOVHZLGWKLVDWOHDVWPV,QFUHDVH6,'LIQHFHVVDU\
'XULQJFLQHUHFRUGREVHUYHYLGHRZDYHIRUP
,IFLQHYLGHROHYHOLVQRWZLWKLQP9RIIOXRURYLGHROHYHOUHFRUGSUREOHPRQGDWD
VKHHW
5HSHDWIRUDQ\RWKHUFRPPRQO\XVHGIUDPHUDWHV
5HFRUGHGLPDJHVZLOOEHHYDOXDWHGLQ;30±
,//8675$7,21 
PEAK VIDEO LEVEL
HEART LUNG LUNG
(CENTER OF NOISE) PEAK (CENTER OF NOISE)
MEDIA

ABDOMEN

COLLIMATOR

BLACK
PEAKDET LEVEL

LEAD SLUG BLANKING

NOTE: For non–GE systemsUHIHUWRVSHFLILF2(0VHUYLFHGRFXPHQWDWLRQIRU


IDFWRUVVHWWLQJVDQGWHVWWRROV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG RESOLUTION

VXEDVVHPEO\ ,0$*(6<67(0 GDWH

SXUSRVH 0HDVXULQJKLJKFRQWUDVWUHVROXWLRQRILPDJH WLPHPLQ


V\VWHP

PREREQUISITES
7RROVUHTXLUHG /LQH3DLU3KDQWRPRU5HVROXWLRQ:HGJH PP3EUHVROXWLRQSDWWHUQ
I$O
NOTE:5HVROXWLRQPHDVXUHPHQWVZLWKPHVKSDWWHUQVFDQQRWEHFRQYHUWHGGLUHFWO\WROHDG
EDUSDWWHUQPHDVXUHPHQWVEHFDXVHPHVKSDWWHUQVKDYHORZHUUDGLRJUDSKLFFRQWUDVWDQGOLQH
ZLGWKVDUHJHQHUDOO\XQHTXDOWRVSDFLQJRIOLQHV
TASK DESCRIPTION
(VWDEOLVKWKHIROORZLQJRSHUDWLQJFRQGLWLRQV
N9IOXRUR
0D[LPXP6,'
&RQYHQWLRQDOIOXRUR LIVHOHFWDEOH
1RJULG LIJULGLVHDVLO\UHPRYDEOH  RWKHUZLVHOHDYHLQSODFH
I$OXPLQXPLQ)29
&HQWHUUHVROXWLRQSDWWHUQDWGHJUHHDQJOHLQ)29DVFORVHWR,,HQWUDQFHSODQHDV
SRVVLEOH
NOTE: ,IWKHJULGLVUHPRYDEOHUHVROXWLRQSDWWHUQPD\EHRULHQWHGYHUWLFDOO\LQWKH)29
2EVHUYHGUHVROXWLRQZLOOEHJUHDWHUWKDQZLWKSDWWHUQRULHQWHGDWGHJUHHV
Fluoro
5HPRYHJODUH7KLVFDQGRQHE\GLPPLQJURRPOLJKWV
6HOHFWIOXRUR'RVH +LJK'HWDLO LIDYDLODEOH
5HFRUGUHVROXWLRQLQDOOPDJPRGHVLQWKHGDWDVKHHW
9HULI\WKDWREVHUYDWLRQVH[FHHGPLQLPXPVLQGLFDWHGLQ7DEOH
NOTE: 7\SLFDOPLQLPXPUHVROXWLRQVWDWHGLVIRUUHVROXWLRQSDWWHUQRULHQWHGDW
GHJUHHV)RUFRPSOHWHWDEOHVRIPLQLPXPDQGW\SLFDOUHVROXWLRQVVHH,PDJH4XDOLW\
+DQGERRN ± For non–GE systemsUHIHUWR2(0WHFKQLFDO
VSHFLILFDWLRQV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RESOLUTION -RE&DUG;30± RI

7$%/(
MINIMUM CONVENTIONAL FLUORO RESOLUTION (LP/MM)

FOV 16” 12” 9” 6” 4.5”


     
     

NOTE: 5HVROXWLRQPD\EHVOLJKWO\OHVVIRUSLFN±XSWXEHVRWKHUWKDQ3ULPLFRQV
6DWLFRQVDQG&]LFRQVDQGIRUROGHULPDJHLQWHQVLILHUW\SHV
NOTE: ,WLVQRWQHFHVVDU\WRUHFRUGUHVROXWLRQRIRWKHUIOXRURPRGHVEXWPLQLPXP
UHVROXWLRQVIRUGLJLWDOIOXRURPRGHVDUHVKRZQLQ7DEOH XVHWKHOLQHUDWHDSSURSULDWH
IRUIOXRURDFTXLVLWLRQ 
Recording Modes:
,I5HFRUGLQJPRGHVDUHDYDLODEOHVHOHFWWHFKQLFIDFWRUVDFFRUGLQJWRDSSOLFDWLRQ
EHLQJWHVWHG VHH7DEOH 

7$%/(
TECHNIC FACTORS

Photospot DR Cine DX/DLX


P$ 6 6 6PDOO6SRW 6
N9    
)UDPH5DWH 6LQJOH 6LQJOH ISV VHF
'RVH +LJK '

5HFRUGDWOHDVWRQHLPDJHDWHDFK0DJPRGH
,PDJHVZLOOEHHYDOXDWHGLQMREFDUGVIRUVSHFLILFUHFRUGPRGHV
5HSHDWWKLVVHFWLRQIRUDOO5HFRUGLQJPRGHV LH3KRWRVSRW&LQH'56'/; 
NOTE: 7\SLFDOPLQLPXPGLJLWLDOUHVROXWLRQVLQ7DEOHDUHZLWKUHVROXWLRQSDWWHUQ
RULHQWHGDWGHJUHHV)RUFRPSOHWHWDEOHVRIPLQLPXPDQGW\SLFDOUHVROXWLRQVVHH
,PDJH4XDOLW\+DQGERRN ± 
Digital System Resolutions

7$%/(
TYPICAL MINIMUM DIGITAL RESOLUTIONS

FOV 16” 12” 9” 6” 4.5”


'\QDPLF&DUGLDF9DVFXODU     
9DVFXODU     

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RESOLUTION -RE&DUG;30± RI

Cine Film Resolutions

7$%/(
CINE LIMITING RESOLUTIONS

MINIMUM LIMITING TYPICAL RESOLUTION


II SIZE FIELD SIZE
RESOLUTION (Lp/mm) (Lp/mm)
1250  
I
0$*  
7+±)
0$*  
1250  
I 0$*  
7+±) 0$*  
0$*  

MINIMUM LIMITING TYPICAL RESOLUTION


II SIZE FIELD SIZE
RESOLUTION (Lp/mm) (Lp/mm)
1250  
I
0$*  
7+±+3
0$*  
1250  
I 0$*  
7+±+3 0$*  
0$*  

MINIMUM LIMITING TYPICAL RESOLUTION


II SIZE FIELD SIZE
RESOLUTION (Lp/mm) (Lp/mm)
1250  7%'
I
0$*  7%'
7+±+;
0$*  7%'
1250  
I 0$*  
7+±+; 0$*  
0$*  

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RESOLUTION -RE&DUG;30± RI

Photospot Resolutions

7$%/(
PHOTOSPOT LIMITING RESOLUTIONS

MINIMUM LIMITING TYPICAL


II SIZE FIELD SIZE
RESOLUTION (Lp/mm) RESOLUTION (Lp/mm)
1250  
I
0$*  
7+±)
0$*  
1250  
I 0$*  
7+±) 0$*  
0$*  
1250  
I 0$*  
7+±) 0$*  
0$*  

MINIMUM LIMITING TYPICAL


II SIZE FIELD SIZE
RESOLUTION (Lp/mm) RESOLUTION (Lp/mm)
1250  
I
0$*  
7+±+3
0$*  
1250  
I 0$*  
7+±+3 0$*  
0$*  

MINIMUM LIMITING TYPICAL


II SIZE FIELD SIZE
RESOLUTION (Lp/mm) RESOLUTION (Lp/mm)
1250  7%'
I
0$*  7%'
7+±+;
0$*  7%'
1250  
I 0$*  
7+±+; 0$*  
0$*  

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG PHOTOSPOT FILM REVIEW

VXEDVVHPEO\ ,0$*(6<67(0 GDWH

SXUSRVH (YDOXDWLQJSKRWRVSRWLPDJHTXDOLW\DQGUHVROXWLRQ WLPHPLQ

PREREQUISITES
7RROVUHTXLUHG 'HQVLWRPHWHU
([SRVHG3KRWRVSRWILOPIURPSUHYLRXVMREFDUGVLIDSSOLFDEOH

TASK DESCRIPTION
5HIHUWR-RE&DUG;30±WRGHWHUPLQHLIVHQVLWRPHWU\GDWDZLOOEHQHHGHGDQGIRU
GLUHFWLRQVWRREWDLQGDWDLIQHHGHG
)RU*(PPFDPHUDVDGYDQFHILOPVHYHUDOIUDPHVWRFUHDWHDOHDGHU
5HPRYHWDNH±XSPDJD]LQHIURPFDPHUD
3URFHVVILOPZKLFKZDVH[SRVHGGXULQJLPDJHTXDOLW\DQGUHVROXWLRQWHVWV ;30±  
5HYLHZSKRWRVSRWLPDJHVRQDOLJKWER[DQGREVHUYHWKHIROORZLQJ
9LVLELOLW\RISHQHWURPHWHUVLQHDFKDUHDRIWKH&9SKDQWRP
&KHFNIRUHYLGHQFHRIVFUDWFKHVZDWHUPDUNVHWF
5HYLHZWKHUHVROXWLRQLPDJHVDQGUHFRUGUHVROXWLRQREVHUYHGRQWKHGDWDVKHHW VHH
;30±IRUPLQLPXPUHVROXWLRQVSHFV 
9LVXDOO\LQVSHFWWKHILOPIRUSURSHUIUDPLQJRIH[SRVHGDUHD
6HOHFWRQHRIWKH&9±SKDQWRPLPDJHVDQGPHDVXUHWKHGHQVLWLHVRIDOOIRXUVHFWLRQVRI
WKHSKDQWRPQHDUWKHDSH[RIWKHSKDQWRP
W\SLFDOGHQVLW\LQ+HDUWVHFWLRQRISKDQWRPLV
5HFRUGUHVXOWVRQGDWDVKHHWIRUSRVVLEOHIXWXUHXVHDVDEHQFKPDUN
1RWHDQ\FRQFHUQVRUFRPPHQWVUHJDUGLQJSKRWRVSRWILOPTXDOLW\RQFKHFNOLVWDQGRUGDWD
VKHHW
NOTE: For non–GE systemsUHIHUWR2(0WHFKQLFDOGRFXPHQWDWLRQ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG PHOTOSPOT CAMERA

VXEDVVHPEO\ ,0$*(6<67(0 GDWH

SXUSRVH &OHDQLQJDQG)XQFWLRQDO&KHFNRI3KRWRVSRW WLPHPLQ


&DPHUD

PREREQUISITES
7RROVUHTXLUHG $OFRKROZLSHV
6RIWEULVWOHVEUXVK
/HQVWLVVXH
&RPSUHVVHGDLURUHTXLYDOHQW

TASK DESCRIPTION
5HPRYHILOPIURPFDPHUDRUUHPRYHVXSSO\DQGUHFHLYHUPDJD]LQHV
CAUTION: Dim room lights to save unexposed film in GE 105 mm cameras while
unloading and reloading.
5HPRYHDQ\SLHFHVRIILOPRUHPXOVLRQGXVWIURPLQVLGHFDPHUDDQGPDJD]LQHV
5HPRYHEXLOG±XSRIHPXOVLRQRQILOPJXLGHVDQGRWKHUDUHDVRIILOPSDWK
&OHDQVXUIDFHVRIDQ\OHQVHVRUPLUURUVZKLFKDUHHDVLO\DFFHVVLEOH
9HULI\RSHUDWLRQRIILOPLQGLFDWRU
&KHFNPDJD]LQHOLJKWVHDOVPRXQWLQJRIDOOPDJD]LQHVDQGRSHUDWLRQRIILOPNQLIH
5HORDGILOPLILWKDGEHHQUHPRYHGRUUHLQVWDOOILOPPDJD]LQHV
3HUIRUPDIXQFWLRQDOFKHFNRIWKHFDPHUDDWISVRUWKHKLJKHVWIUDPHUDWHDYDLODEOHWR
HQVXUHVPRRWKRSHUDWLRQ
NOTE: 6HOHFWSKDQWRPJHQHUDWRUWHFKQLFVHWFWRSURGXFHD±PVH[SRVXUH
5HFRUGDQ\SUREOHPVRQWKHFKHFNOLVWDQGRUGDWDVKHHWV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG DIGITAL PHOTOSPOT IMAGE REVIEW

VXEDVVHPEO\ '5'5('5,'56,0$*(6<67(0 GDWH

SXUSRVH 'LJLWDOLPDJHTXDOLW\DQGUHVROXWLRQ WLPHPLQ

PREREQUISITES
7RROVUHTXLUHG 1RQH

TASK DESCRIPTION
9LGHROHYHOVUHVROXWLRQDQGRWKHULPDJHTXDOLW\SDUDPHWHUVDUHHYDOXDWHGLQ;30±DQG
;30±6RPHGLJLWDOV\VWHPVKDYH,PDJH4XDOLW\WRROVDYDLODEOHZKLFKPD\EH
XVHIXOWRWURXEOHVKRRWLPDJLQJSUREOHPV7KHVHWHVWVDUHJHQHUDOO\EH\RQGWKHVFRSH
RID30LQVSHFWLRQ3OHDVHUHIHUWRVSHFLILFGRFXPHQWDWLRQIRUGHWDLOV
5HYLHZUHFHQW³GLJLWDO´ILOPVRULQWHUYLHZFXVWRPHUDERXWDQ\SUREOHPVZLWKGLJLWDOLPDJH
TXDOLW\1RWHDQ\SUREOHPVRQGDWDVKHHWV
&KHFNWKHRSHUDWLRQRIDOOIXQFWLRQVRIWKHGLJLWDOV\VWHPDQGQRWHDQ\SRWHQWLDOSUREOHPV
ZLWKWKHRSHUDWRUFRQWUROVVXFKDVNH\ERDUGHWF
)RUIXWXUHUHIHUHQFHILOP,QVWDOODWLRQ0HQX8VHU0HQXHWFLISRVVLEOH7KHSURFHGXUHWRGR
WKLVZLOOYDU\DFFRUGLQJWRV\VWHPW\SHDQGVRIWZDUHYHUVLRQVRUHIHUWRV\VWHP
GRFXPHQWDWLRQLIDGGLWLRQDOLQIRUPDWLRQLVQHHGHG

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG CINE FILM REVIEW

VXEDVVHPEO\ ,0$*(6<67(0 GDWH

SXUSRVH (YDOXDWLQJFLQHILOPSURFHVVLQJUHVROXWLRQDQG WLPHPLQ


LPDJHTXDOLW\

PREREQUISITES
7RROVUHTXLUHG 6HQVLWRPHWHU SUHIHUDEO\JUHHQOLJKW
'HQVLWRPHWHU
([SRVHGFLQHILOPIURPSUHYLRXVMREFDUGV

TASK DESCRIPTION
%HIRUHUHPRYLQJILOPPDJD]LQHIURPV\VWHPDGYDQFHILOPWRFUHDWHD³OHDGHU´
5HIHUWR;30±WRGHWHUPLQHLID4&FKHFNRIWKHFLQHSURFHVVRUZLOOEHQHFHVVDU\,IVR
XVHVHQVLWRPHWHUWRH[SRVHILOPOHDGHUDWWKLVWLPH
3URFHVVWKHFLQHILOPH[SRVHGLQ;30±DQG;30±
,IQHFHVVDU\GHWHUPLQH6SHHG &RQWUDVW,QGH[RIWKHFLQHILOPDVRXWOLQHGLQ;30±DQG
UHFRUGUHDGLQJVRQGDWDVKHHW$OVRUHFRUG%DVH)RJ'HQVLW\RIILOP
6HOHFWSURMHFWRUPRVWRIWHQXVHGE\WKHFDUGLRORJLVWV5HYLHZWKHFRQGLWLRQRIFLQHILOP
SURMHFWRU 5HIHUWR-RE&DUG;30±IRUSURMHFWRU30LIQHFHVVDU\
/RDGFLQHILOPRQSURMHFWRU
9LVXDOO\LQVSHFWWKHILOPIRUSURSHUIUDPLQJRIH[SRVHGDUHD VHH,OOXVWUDWLRQ DQGHYLGHQFH
RIDQ\VFUDWFKHVRUZDWHUPDUNV

,//8675$7,21 
FILM FRAMING

),/0)5$0,1*

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG CINE FILM REVIEW -RE&DUG;30± RI

5HYLHZWKHUHVROXWLRQUXQVDQGUHFRUGUHVROXWLRQREVHUYHGRQWKHGDWDVKHHW VHH;30±
IRUPLQLPXPUHVROXWLRQVSHFV
6HOHFWDIUDPHQHDUWKHPLGGOHRIWKH&9±SKDQWRPUXQDQGPHDVXUHWKHGHQVLWLHVRIDOO
IRXUVHFWLRQVRIWKHSKDQWRPQHDUWKHDSH[RIWKHSKDQWRP
W\SLFDOGHQVLW\LQKHDUWVHFWLRQRISKDQWRPLV
5HFRUGUHVXOWVRQGDWDVKHHWIRUSRVVLEOHIXWXUHXVHDVDEHQFKPDUN
1RWHDQ\FRQFHUQVRUFRPPHQWVUHJDUGLQJFLQHILOPTXDOLW\RQFKHFNOLVWDQGRUGDWDVKHHWV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG CINE CAMERA

VXEDVVHPEO\ ,0$*(6<67(0 GDWH

SXUSRVH &OHDQLQJDQGPHFKDQLFDOFKHFNRIFLQHFDPHUD WLPHPLQ

PREREQUISITES
7RROVUHTXLUHG $OFRKROZLSHV
6RIWEULVWOHVEUXVK
/HQVWLVVXH
&RPSUHVVHGDLURUHTXLYDOHQW

TASK DESCRIPTION
5HPRYHFLQHPDJD]LQHIURPFDPHUD
5HPRYHDQ\SLHFHVRIILOPRUHPXOVLRQGXVWIURPLQVLGHFDPHUDDQGPDJD]LQHV
CAUTION: Magazines may be loaded with exposed patient film or unexposed film (if in
doubt, open magazines in total darkness).
5HPRYHDQ\HPXOVLRQEXLOG±XSIURPILOPJXLGHVDQGRWKHUDUHDVRIILOPSDWK
&KHFNRSHUDWLRQRIILOPVHQVRURQFDPHUDGULYH
&OHDQVXUIDFHVRIDQ\OHQVHVRUPLUURUVZKLFKDUHHDVLO\DFFHVVLEOH
9HULI\RSHUDWLRQILOPLQGLFDWRULQHDFKPDJD]LQH
&KHFNPRXQWLQJRIPDJD]LQHV
3HUIRUPDIXQFWLRQDOFKHFNRIFLQHFDPHUD
5HFRUGDQ\SUREOHPVRQFKHFNOLVWDQGRUGDWDVKHHWV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG PROCESSOR QC

VXEDVVHPEO\ *(1(5$725,0$*( 6<67(0 GDWH

SXUSRVH 4XDOLW\FRQWUROSURFHGXUHIRUVKHHWILOP WLPHPLQ


SURFHVVRUV

PREREQUISITES
7RROVUHTXLUHG 6HQVLWRPHWHU
'HQVLWRPHWHU
TASK DESCRIPTION
NOTE: 3HUIRUPWKLVMREFDUGRQO\LIXVHULVQRWSHUIRUPLQJSHULRGLFSURFHVVRUTXDOLW\
FRQWURO,ISUREOHPVZLWKILOPGHQVLWLHVRUFRQWUDVWDULVHUHYLHZFXVWRPHU¶VSURFHVVRU4&
GDWDVKHHWVIRUFKDQJHVLQSURFHVVLQJSDUDPHWHUVDQGWKHQLIQHFHVVDU\UHSHDWFXVWRPHU¶V
SURFHGXUHVRUWKHSURFHGXUHRXWOLQHGEHORZ
([SRVHDQXQH[SRVHGILOPXVLQJWKHVHQVLWRPHWHU
NOTES: ,IILOPLVVLQJOHHPXOVLRQW\SHH[SRVHHPXOVLRQVLGHRIILOP([SRVHERWKVLGHVRI
ILOPDORQJGLIIHUHQWHGJHVLIHPXOVLRQVLGHFDQQRWEHLGHQWLILHG
)RUPDPPRJUDSK\VHOHFWWKHVDPHW\SHRIILOPWKDWLVQRUPDOO\XVHG
3URFHVVILOP
Speed Index:
0HDVXUHWKHEDVHIRJRIWKHILOPDQGUHFRUGRQGDWDVKHHW
'HWHUPLQHZKLFKVHQVLWRPHWHUVWHSKDVDGHQVLW\FORVHVWWREDVHIRJ7KLVLVWKH
63(('VWHSRU,1'(;
5HFRUGWKHVWHSQXPEHUDQGGHQVLW\RIWKH63((',1'(;RQWKH0DPPRJUDSK\30
'DWD6KHHW
Contrast Index:
5HFRUGWKHQXPEHUDQGGHQVLW\RIWKHVWHSWZRVWHSVDERYHWKH63(('VWHS
7KLVLV&2175$67VWHS
NOTE: ,I\RXDUHXVLQJDQHOHYHQVWHSGHQVLWRPHWHUWKH&2175$67VWHSVDUHRQH
 VWHSDERYHDQGRQH  EHORZWKH63(('VWHS
5HFRUGWKHQXPEHUDQGGHQVLW\RIWKHVWHSWZRVWHSVEHORZWKH63(('VWHS
7KLVLV&2175$67VWHS RQHVWHSIRUVWHSVHQVLWRPHWHU 
6XEWUDFWWKHYDOXHVRIWKH&2175$67VWHSVWRREWDLQWKH&2175$67,1'(;
5HFRUGWKLVYDOXHRQWKH0DPPRJUDSK\30'DWD6KHHW
5HFRUGVWHSQXPEHUVDQGDQGHQWHURQWKH0DPPRJUDSK\30'DWD6KHHW

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG PROCESSOR QC -RE&DUG;30± RI

5HFRUGILOPDQGVFUHHQW\SHRQ0DPPRJUDSK\30'DWD6KHHW
,ISUHYLRXVGDWDLVDYDLODEOHFRPSDUHQHZGDWDZLWKSUHYLRXVGDWD$FFHSWDEOH
WROHUDQFHLVIRUWKH63((',1'(;DQGIRUWKH&2175$67
,1'(;
)RU0DPPRJUDSK\ILOPWKH63((',1'(;LVUHGXFHGWR

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG CINE PROCESSOR

VXEDVVHPEO\ ,0$*(6<67(0 GDWH

SXUSRVH &LQHILOPSURFHVVRU4& WLPHPLQ

PREREQUISITES
7RROVUHTXLUHG 6HQVLWRPHWHU SUHIHUDEO\JUHHQOLJKW
'HQVLWRPHWHU
TASK DESCRIPTION
NOTE: 3HUIRUPWKLVMREFDUGRQO\LIXVHULVQRWSHUIRUPLQJSHULRGLFSURFHVVRUTXDOLW\
FRQWURO,ISUREOHPVZLWKILOPGHQVLWLHVRUFRQWUDVWDULVHUHYLHZFXVWRPHU¶VSURFHVVRU4&
GDWDVKHHWVIRUFKDQJHVLQSURFHVVLQJSDUDPHWHUVDQGWKHQLIQHFHVVDU\UHSHDWFXVWRPHU¶V
SURFHGXUHVRUWKHSURFHGXUHRXWOLQHGEHORZ
%HIRUHUHPRYLQJILOPPDJD]LQHIURPV\VWHPDGYDQFHILOPWRFUHDWHD³OHDGHU´
,QWRWDOGDUNQHVVUHPRYHILOPIURPPDJD]LQHDQGXVH*5((1OLJKWVHQVLWRPHWHUWRH[SRVH
HPXOVLRQVLGHRIILOPOHDGHU
NOTES: ,I\RX¶UHQRWVXUHZKLFKLVHPXOVLRQVLGHRIILOPH[SRVHERWKVLGHVRIILOPLQ
GLIIHUHQWDUHDVRIILOP
,IILOPLVRUWKRFKURPDWLFDVDIHOLJKWPD\EHXVHGLQGDUNURRP
3URFHVVILOP

Speed Index:
0HDVXUHGHQVLW\RIILOPLQXQH[SRVHGDUHDDQGUHFRUGUHDGLQJRQGDWDVKHHWDV
%$6()2*
'HWHUPLQHZKLFKVHQVLWRPHWHUVWHSKDVDGHQVLW\FORVHVWWR7KLVLVWKH63(('
VWHSRU,1'(;
5HFRUGWKHVWHSQXPEHUDQGGHQVLW\RIWKH63((',1'(;RQWKHGDWDVKHHW
Contrast Index:
5HFRUGWKHQXPEHUDQGGHQVLW\RIWKHVWHSWZRVWHSVDERYHWKH63(('VWHS
7KLVLV&2175$67VWHS
NOTE: ,I\RXDUHXVLQJDQHOHYHQVWHSGHQVLWRPHWHUWKH&2175$67VWHSVDUHRQH
 VWHSDERYHDQGRQH  VWHSEHORZWKH63(('VWHS
5HFRUGWKHQXPEHUDQGGHQVLW\RIWKHVWHSWZRVWHSVEHORZWKH63(('VWHS
7KLVLV&2175$67VWHS RQHVWHSIRUVWHSVHQVLWRPHWHU 
6XEWUDFWWKHYDOXHVRIWKH&2175$67VWHSVWRREWDLQWKH&2175$67,1'(;
5HFRUGWKLVYDOXHRQWKHGDWDVKHHWV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION


,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG DF VASCULAR IMAGE QUALITY

VXEDVVHPEO\ ') GDWH

SXUSRVH 9DVFXODUYHVVHOWHVW WLPHPLQ

PREREQUISITES
7RROVUHTXLUHG ')SKDQWRP
7HFKQLFV 6WDWXVPRGHYHVVHOWHVW
N9SIOXRUR
$XWRP$'RVH
&ROOLPDWRUIXOO\RSHQ
*ULGLQSODFH
1LQHLQFKILHOGVL]H IRQILQWHQVLILHUV
1RUPDO79VZHHSV
N9S5$'P$PVHF QRPLQDOH[SRVXUHWLPH
TASK DESCRIPTION
Procedure:
3+$1720326,7,21,1*
3ODFH')VWHSZHGJHZLWKQREORFNLQVWDOOHGRQWKHWDEOHWRS7KHVWHSZHGJHVKRXOGEH
FHQWHUHGLQWKH)29ZLWKWKLFNHVWSRUWLRQWRZDUGVWKHSDWLHQW¶VOHIWVLGH PRQLWRUULJKW
VLGH RIWKHWDEOH1RSRUWLRQRIWKHILUVWRUQLQWKVWHSVKRXOGEHLQVLGHWKHWULDO
ZLQGRZ:KLOHWDNLQJWULDOLPDJHVKRUL]RQWDOO\FHQWHUWKHZHGJHDQGDGMXVWWKHLPDJH
LQWHQVLILHUKHLJKWXQWLOWKHHGJHEHWZHHQWKHVWQGWKDQGWKVWHSVDUHRXWVLGH
WKHWULDOZLQGRZE\ LQFKRQWKHLQFKRULQ±URRPPRQLWRU9HUWLFDOO\FHQWHU
WKHZHGJHVRWKHFHQWHULQJPDUNHUVDUHHTXLGLVWDQWIURPWKHFLUFXODUEODQNLQJHGJH
$OOQLQHVWHSVRIWKHZHGJHVKRXOGEHYLVLEOHRQWKHPRQLWRUDQGDSSUR[LPDWHO\HTXDO
LQZLGWK

        

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG DF VASCULAR IMAGE QUALITY -RE&DUG;30± RI

7$%/(5(48,5(0(176
LUA SYSTEMS:7DEOHKHLJKW LQFKHVIURPWKH[±UD\WXEHIRFDOVSRWRULQFKHV
IURPWKHWRSRIWKHFROOLPDWRU
/ ±GHJUHHV
8GHJUHHV
LU–C SYSTEMS:7DEOHKHLJKW LQFKHVIURPWKH[±UD\WXEHIRFDOVSRWRULQFKHV
IURPWKHWRSRIWKHFROOLPDWRU
RFX SYSTEMS:7DEOHWRSDQG[±UD\WXEHDUHYHUWLFDOO\IL[HG
7KHVWDWLFDFTXLVLWLRQVFUHHQVKRXOGKDYHLWVFXUVRUVLWWLQJRQWKHVWHQWU\ 35272&2/ 
8VHWKH1(;7(175<DQG35,25(175<NH\VWRPRYHWKHFXUVRUWRVHWXSWKH
WHFKQLTXHVKRZQLQWKHVFUHHQEHORZ
'RVH'
)UDPHV,PDJH 
,QM±0DVN0DVN±,QM 'HOD\ 11
0DVN±5XQ'HOD\  VHF
*URXS5DWH7RWDO 
*URXS±*URXS'HOD\  VHF
*URXS5DWH7RWDO 
*URXSB*URXS'HOD\  VHF
*URXS5DWH7RWDO 
NOTE: *URXSUDWHLVIRU+]V\VWHPV
 7DNHDWULDOH[SRVXUH7KHYDULDEOHDSHUWXUHFKDQJHVWRDFKLHYHDSHDNYLGHR
OHYHOEHWZHHQDQG7KHV\VWHPVKRXOGVWDELOL]HZLWKLQWULDOVWRWKDWRI
YLGHROHYHO2Q')0$5.V\VWHPVWKHDSHUWXUHLVPDQXDOO\FRQWUROOHG
2Q0$5.V\VWHPVZLWKRXW$(&WKHP$VQHHGVWREHFKDQJHGWRDFKLHYHWKH
SURSHUYLGHROHYHO2Q')WKHDSHUWXUHDQGH[SRVXUHWLPHLVDXWRPDWLFDOO\
DGMXVWHG
 7DNHDQLPDJHVHULHV
,QVWDOOWKHPDVNEORFNLQWKHFHQWHUVKHOIRIWKH')SKDQWRP
5HSHDWVWHS
 7DNHDQLPDJHVHULHV$IWHUWKHPDVNLPDJHKDVDSSHDUHGRQWKHPRQLWRUDQG
GXULQJWKHPDVN±WR±UXQGHOD\UHOHDVHWKHKDQGVZLWFKWRWKH35(3SRVLWLRQ
5HPRYHWKHFOHDUEORFNIURPWKHVWHSZHGJHDQGLQVHUWWKHDUWHU\EORFN ZLWKWKH
DUWHULHVSHUSHQGLFXODUWRWKHVWHSV '2127EXPSWKHVWHSZHGJHRUWDEOH
GXULQJWKLVFKDQJHRYHU
 'HSUHVVWKHKDQGVZLWFKWRWKH(;326(SRVLWLRQDQGWDNHWKHUHVWRIWKHLPDJH
UXQ
 9LHZWKHWUDLOHUIUDPH RQWKHQLQHLQFKPRQLWRU 9HULI\WKDWWKHIROORZLQJ
FRQGLWLRQVDUHPHW
7KHPD[LPXPLPDJHUDWHLVDWOHDVWLPDJHVVHF
7KHSHDNYLGHRLVEHWZHHQ± LQFOXVLYH 
7KHH[SRVXUHWLPHLVEHWZHHQ±PVHF LQFOXVLYH 

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG DF VASCULAR IMAGE QUALITY -RE&DUG;30± RI

 ,IWKHDERYHFRQGLWLRQVDUHQRWPHWDGMXVWWKHDSSURSULDWHSDUDPHWHUWREULQJLW
LQWRVSHFLILFDWLRQV$IWHUGRLQJVRUXQDQRWKHUVHULHV

PP 
PP 
PP 
PP 
PP 
PP 
PP 
PP 
PP 
PP 
PP 

 9LHZYHVVHOLPDJHVLQUHSURFHVVPRGH
 9HULI\WKDWWKHPDVNLPDJHKDVDOOVKDGHVRIJUD\YLVLEOH
 2EVHUYHLPDJHVL]LQJFHQWHULQJDQGFLUFXODUPDVNDOLJQPHQWV

7KHVXEMHFWLYHYLVXDOL]DWLRQSURFHGXUHRIWKHPPFRQWUDVWDUWHU\WKDWIROORZVPD\EH
XVHGWRFRPSOLPHQWWKHDERYHTXDQWLWDWLYHPHDVXUHPHQWV
 6LQFHVWHSLVRXWVLGHWKHWULDOZLQGRZLWPD\HLWKHUEHRYHU±UDQJHGRUWKH
DUWHU\PD\EHFOHDUO\LGHQWLILDEOH
 1RVDWXUDWLRQRUVDWXUDWLRQLQVWHSLQGLFDWHVFDOLEUDWLRQSUREOHPVLQWKH$'
FRQYHUWHURUWKHFDPHUD,QVWHSVDQGWKHDUWHU\PXVWEHFOHDUO\
LGHQWLILDEOH
 6WHSVDQGPXVWGLVSOD\WKHDUWHU\VXFKWKDWLWLVUHFRJQL]DEOHE\FODVV,W
PXVWEHUHFRJQL]DEOHDVDPPOLQHUXQQLQJKRUL]RQWDOO\WKURXJKWKHVWHS
 9HULI\WKDWWKHVWHSDUWHU\LVGLVFHUQDEOHDVDQREMHFWWKDWLVKRUL]RQWDOO\
RULHQWHG
 9HULI\WKDWWKHVWHSDUWHU\LVGLVSOD\HGDVDQREMHFWRIDQ\RULHQWDWLRQZKLFK
PD\EHFODVVLILHGDVEHLQJGHWHFWHGLQRIREVHUYDWLRQV$QREVHUYDWLRQLV
GHILQHGDVWKHWKLUGHLJKWRUWKLUWHHQWKVXEWUDFWLRQLQDVWDQGDUGLPDJH
DFTXLVLWLRQUXQ
 5HFRUGYHVVHOVWHSYLVLEOHH[SRVXUHWLPHDQGSHDNYLGHRRQWKHGDWDVKHHW

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG DF VASCULAR IMAGE QUALITY -RE&DUG;30± RI

FOR DF 5000
([LWDSSOLFDWLRQVRIWZDUHDQGHQWHU,0$*($1$/<6,6PRGHE\W\SLQJ³,0$*(´
(QWHUWKH,0$*($1$/<6,6PRGHDQGUHYLHZWKHUHTXLUHGPHQXVRUVFUHHQVE\UHIHUULQJWR
WKHIROORZLQJVHFWLRQLQ&KDSWHURI'LUHFWLRQ± 'LJLWDO)OXRUR
6HFWLRQ,PDJH$QDO\VLV
9LHZWKHILUVWDFTXLVLWLRQUXQWDNHQZLWKRXWWKHEORFNE\
3UHVVLQJ6(/5DQG
(QWHULQJWKHGHVLUHGUXQQXPEHUIROORZHGE\1(;7(175<
6HOHFWWKHDSSOLFDEOHUXQIURPWKHLPDJHGLUHFWRU\VKRZQRQWKH$&7,9(6&5((1
(YDOXDWHWKHDFTXLVLWLRQXVLQJ,0$*(6+$',1*DVIROORZV
 8VLQJWKH)25:NH\VHOHFWWKHVHFRQGLPDJHLQWKHUXQ
 3UHVV$771WRHQWHUWKH,0$*($1$/<6,6PHQXVHOHFWLRQVFUHHQ
 6HOHFW2SWLRQ6+$',1*IROORZHGE\1(;7(175<
 (GLWWKH6+$',1*VFUHHQWRUHIOHFWDQ$1$/<6,6$5($RIDQGD%2;
&856256,=(2) 
 3UHVV( H[HFXWH DQGWKHV\VWHPFDOFXODWHVWKHIROORZLQJ
$YHUDJHYDOXHRIKLJKHVWER[ DOOEODFN
$YHUDJHYDOXHRIORZHVWER[ DOOZKLWH
'LIIHUHQFHLQKLJKHVWDQGORZHVWER[ GHOWDZLWKLQLPDJH 
 5HFRUGWKHGLVSOD\HGGLIIHUHQFHLQKLJKHVWDQGORZHVWER[YDOXHIRUWKLVLPDJHLQ
WKHGDWDUHFRUGVWDWLFUHFRUGPRGHLPDJHVKDGLQJ
 3UHVV'21(WZLFHWRUHWXUQWRWKH,PDJH'LUHFWRU\VKRZQRQWKH$&7,9(
6&5((1
 5HSHDWVWHSVWKURXJKIRULPDJHVDQGIRUWKLVUXQ

9HULI\WKDWWKHUHFRUGHGGLIIHUHQFHLQKLJKHVWDQGORZHVWER[YDOXHIRUHDFKLPDJHLQHDFK
UXQOLVWHGLQWKHGDWDWDEOHLVOHVVWKDQOHYHOV
NOTE:&ROXPQV D  E DQG G LQWKHGDWDVKHHWVDUHQRWXVHGIRUWKH')±WHVWLQJ
3UHVV'21(WZLFHWRUHWXUQWRWKHLPDJHGLUHFWRU\VKRZQRQWKH$&7,9(6&5((1
(YDOXDWHWKHILUVWDFTXLVLWLRQUXQWDNHQXVLQJ5(*,212),17(5(670($19$/8(DV
IROORZV
 8VLQJWKH)25:NH\VHOHFWWKHVHFRQGLPDJHLQWKHUXQ
 3UHVV$771WRHQWHUWKH,0$*($1$/<6,6PHQXVHOHFWLRQVFUHHQ
 6HOHFW2SWLRQ5(*,212),17(5(670($19$/8(IROORZHGE\1(;7
(175<
 (GLWWKH5(*,212),17(5(670($19$/8(VFUHHQWRUHIOHFWD%2;
&85625326,7,212)DQGD%2;&85625326,7,212)
 

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG DF VASCULAR IMAGE QUALITY -RE&DUG;30± RI

 3UHVV( H[HFXWH DQGWKHV\VWHPFDOFXODWHVWKHIROORZLQJ5HJLRQRI,QWHUHVW


9DOXHV
0HDQ7KLVWHVW
$YHUDJH
0LQLPXP
0D[LPXP
 5HFRUGWKHGLVSOD\HG³0($17+,67(67´YDOXHIRUWKLVLPDJHLQWKHGDWD
VKHHWVVWDWLFUHFRUGPRGHUHJLRQRILQWHUHVWPHDQYDOXH
 3UHVV'21(WZLFHWRUHWXUQWRWKH,PDJH'LUHFWRU\VKRZQRQWKH$&7,9(
6&5((1
 5HSHDWVWHSVWKURXJKIRUHDFKLPDJHIRUWKHDFTXLVLWLRQUXQ

9HULI\WKDWWKHUHFRUGHG³0($17+,67(67´YDOXHIRUHDFKLPDJHPHHWVWKHIROORZLQJ
FULWHULD
7KHUHFRUGHG0($1YDOXHWHVWHGWKHLPDJHVZLWKLQDUXQPXVWQRWGLIIHUIURPE\
PRUHWKDQOHYHOV
7KHUHFRUGHG0($1YDOXH)257+(/$67)285,0$*(6PXVWQRWGLIIHUIURPRQH
DQRWKHUE\PRUHWKDQOHYHOV
5HWXUQ$OSKDQXPHULF7HUPLQDO*HQHUDWRUDQG2PHJD7DEOHDQG/8WRQRUPDORSHUDWLQJ
FRQGLWLRQV5HFRUGLPDJHVKDGLQJDQG52,PHDQYDOXHVRQGDWDVKHHWV

FOR DF 3000 (BASIC)


 2QWKHVFUHHQRIWKHLQFKPRQLWRUXVHDJUHDVHSHQFLOWRLQVFULEHDFLUFOHLQWKH
DUHDRIWKHWULDOLPDJHZLQGRZ
 $GMXVWWKHFROOLPDWRUVXFKWKDWWKHEODGHVDUH LQFKRXWVLGHWKHJUHDVHSHQFLO
FLUFOHRQWKHPRQLWRU
 2QFRPSOHWLRQRIWKHDFTXLVLWLRQHQWHUUHSURFHVVPRGH
 'LVSOD\WKHWKLUGVXEWUDFWHGLPDJHRIWKHUXQ
 6HWWKHZLQGRZZLGWKWR DGMXVW:,1'2:XSGRZQNH\VXQWLOGLVSOD\HGZLQGRZLV
 DQGPHDVXUHWKHDYHUDJHOHYHORIWKHDUHDRXWVLGHWKHFLUFOHGUDZQRQWKH
VFUHHQ DGMXVW/(9(/XSGRZQNH\VXQWLOWKHDUHDFKDQJHVIURPZKLWHWREODFN 7KH
ORZHUOHYHOVKRXOGEH 5HFRUGWKLVOHYHOLQWKHGDWDVKHHWFROXPQ³G´
 $GMXVWOHYHOXQWLOWKHDUHDLQVLGHWKHFLUFOHMXVWEHFRPHVDOOEODFN5HFRUGWKLVOHYHOLQ
WKHGDWDVKHHWFROXPQ³H´
 $GMXVWOHYHOXQWLOWKHDUHDLQVLGHWKHFLUFOHMXVWEHFRPHVDOOZKLWH5HFRUGWKLVOHYHOLQ
WKHGDWDVKHHWFROXPQ³F´

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG DF VASCULAR IMAGE QUALITY -RE&DUG;30± RI

 :LWKWKHDUHDOOZKLWHDGMXVWWKH/(9(/XSXQWLODQDUHDLQVLGHWKHFLUFOHMXVW
EHFRPHVDSSUR[LPDWHO\HTXDOEODFNDQGZKLWH ³VDOWDQGSHSSHU´FKHFNIRUHTXDO
GLVWULEXWLRQXVLQJWKHLQYHUWNH\ 5HFRUGWKLVOHYHOLQWKHGDWDVKHHWFROXPQ³D´
 &RQWLQXH/(9(/XSXQWLOWKHDUHDLVDOOEODFNWKHQ/(9(/GRZQXQWLODQDUHDLV
DSSUR[LPDWHO\HTXDOZKLWHDQGEODFN ³VDOWDQGSHSSHU´ 5HFRUGWKLVOHYHOLQWKHGDWD
VKHHWFROXPQ³E´
 5HSHDWWKHDERYHSURFHGXUHIRUVXEWUDFWHGLPDJHVDQGRIWKHUXQ
 2EVHUYHWKDWWKHDYHUDJHEULJKWQHVVRIWKHEDFNJURXQGUDVWHU RXWVLGHWKHFLUFOHLV
 OHYHOV
 2EVHUYHWKDWWKHDYHUDJHEULJKWQHVVRIHDFKWHVWLPDJHGRHVQRWGLIIHUIURPWKH
EDFNJURXQGE\PRUHWKDQOHYHOV
 2EVHUYHWKDWWKHDYHUDJHEULJKWQHVVRIHDFKWHVWLPDJHGRHVQRWGLIIHUIURPDQ\
RWKHUWHVWLPDJHE\PRUHWKDQOHYHOV
 2EVHUYHWKDWWKHLPDJHVKDGLQJEHWZHHQWZRUHJLRQOLQHVZLWKLQWKHFLUFOHLVOHVV
WKDQOHYHOV

NOTE:&ROXPQV³'LIIHUHQFHLQ+LJKHVWDQG/RZHVW%R[´DQG³52,0HDQ9DOXH´LQWKHGDWD
VKHHWDUHQRWXVHGRQWKH')±WHVWV

FOR DF 3000 (MARK 1)


 6HOHFWUHSURFHVVZLQGRZRIRQHDQGWKHILUVWVXEWUDFWLRQLPDJH
 9DU\WKHOHYHODQGLGHQWLI\WKHVWHSLQWKHZHGJHZKLFKKDVDPHDQEULJKWQHVVOHYHO
FORVHVWWR5HFRUGWKHOHYHOLQWKHGDWDVKHHWFROXPQ³G´8VLQJWKLVVWHSYDU\
WKHOHYHODQGUHFRUGWKHERXQGDULHVRIWKHEULJKWQHVVHQYHORSHLQWKHGDWDVKHHW
XSSHULQFROXPQ³D´DQGORZHULQFROXPQ³E´
 6HOHFWVXFFHVVLYHLPDJHVDQGLQWKHUXQDQGUHFRUGWKHDYHUDJHXSSHU
DQGORZHUEULJKWQHVVOHYHOVIRUWKHVDPHDUHDVRIWKHSKDQWRPLGHQWLILHGLQVWHS
 7KHDYHUDJHEULJKWQHVVOHYHORIWKHWHVWLPDJHVVKDOOQRWYDU\PRUHWKDQOHYHOV
IURPWKHDYHUDJHEULJKWQHVVOHYHORIWKHILUVWLPDJH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG DF CARDIAC IMAGE QUALITY

VXEDVVHPEO\ ') GDWH

SXUSRVH ')&DUGLDF WLPHPLQ

PREREQUISITES
7RROVUHTXLUHG &9SKDQWRP
+DQG7RROV

TASK DESCRIPTION
Procedure:
6HWXSWKHV\VWHPDVIROORZV
N9S
$XWRP$
'RVH
6PDOOVSRW
I)29
*ULGRXW
&ROOLPDWRUEODGHVIXOORSHQ
&9±,,SKDQWRPFHQWHUHG
1RUPDO79VZHHS
IUDPHVVHF
)RU/8V\VWHPV
/ ±GHJUHHV
8 GHJUHHV
7DEOHWRSIDERYHIRFDOVSRWRUDVFORVHWRIDVSRVVLEOH
6,'I FP 
6HOHFW'RVH'
3XOVHZLGWKPD[OLPLW PV
1RQ±VXEWUDFWHGRUQRQ±GLIIHUHQFH
&LQHFDPHUDUHFRUG 1R
'LVNUHFRUG <HV
,QLWLDWHDSSUR[LPDWHO\VHFRQGVRISXOVHGFDUGLDFDFTXLVLWLRQUXQ
9HULI\WKHVFUHHQGLVSOD\V³%ULJKWQHVV2.´VWDWXV
0RYHWDEOHWRSWRZDUGVWKHKHDGHQGVRWKDWWKHDSH[RIWKH&9,,LVDWWKHWRSRIWKH
LPDJHDQGWKHOXQJDUHDDSSHDUVRQO\LQWKHXSSHUULJKWDUHDRIWKHPRQLWRU
RXWRIWKH$(&ZLQGRZDUHDLOOXVWUDWHGDVIROORZV7KHQUHWXUQWRFHQWHU

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG DF CARDIAC IMAGE QUALITY -RE&DUG;30± RI

ABD

6HOHFWUHSURFHVVPRGHDQGYLHZWKHUXQ
2EVHUYHLPDJHTXDOLW\ LHLPDJHVL]LQJFHQWHULQJFLUFXODUPDVNDQGOXQJ
ILHOGEORRPLQJ
NOTE: ,IVL]LQJFHQWHULQJRUURXQGQHVVLVRIIWXUQXSWKHPRQLWRUEULJKWQHVVWRFKHFN
WKHUDVWHU,IWKHPRQLWRUUDVWHULV2.IXUWKHUWLPHPXVWEHVFKHGXOHGIRUFDPHUD
UHFDOLEUDWLRQ
6HOHFW±IPRGH
3RVLWLRQ&9SKDQWRPLQEHDPDVSUHYLRXVO\LOOXVWUDWHG
2EVHUYHOXQJILHOGSDUWLFXODUO\YLVLELOLW\RISHQHWURPHWHUV7KH\VKRXOGEHHDVLO\
GLVWLQJXLVKHG
/RRNIRUDEQRUPDOEULJKWQHVVYDULDWLRQVEHWZHHQLPDJHV
5HFRUGSXOVHZLGWKGXULQJUXQZKHQSKDQWRPLVFHQWHUHG5HFRUGLQGDWDVKHHWV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG DG/DX/DLX VASCULAR IMAGE QUALITY

VXEDVVHPEO\ '*';'/; GDWH

SXUSRVH 'LJLWDO9DVFXODU,PDJH4XDOLW\ WLPHPLQ

PREREQUISITES
5HIHUHQFHV
5HIHU$GYDQW[2SHUDWLRQ0DQXDOVIRULQVWUXFWLRQVRQERRWLQJXS$GYDQW[$SSOLFDWLRQ
6RIWZDUHDQGVHOHFWLQJ'LJLWDO9DVFXODUVFUHHQVRQWKH$GYDQW[FRQVROH
NOTE: 'LJLWDOYDVFXODUUHVROXWLRQLVFKHFNHGLQ;30±
TASK DESCRIPTION
,WLVQRWWKHLQWHQGHGWKDWWKLVSURFHGXUHYHULI\HYHU\GLJLWDOYDVFXODUFDOLEUDWLRQSDUDPHWHU
$QLQWHUYLHZZLWKWKHFXVWRPHUZLOOLQGLFDWHDQ\NQRZLPDJHTXDOLW\LVVXHVDQG
RSHUDWLRQDOGLIILFXOWLHV,IWLPHGRHVQRWDOORZFRUUHFWLRQRIWKHVHSUREOHPVPDNH
QRWHRIWKHPRQWKHGDWDVKHHWV7KHIROORZLQJWDVNVZLOOFKHFNFRPPRQGLJLWDO
V\VWHPSUREOHPDUHDV
Verify Default Aperture Values (Quick Check)
6HOHFW'LJLWDO9DVFXODUPRGH
3UHSDUHGLJLWDOIRUYDVFXODUDFTXLVLWLRQ
6HOHFWDIUDPHUDWHRILPDJHVHFRQGIRUWKHILUVWVHJPHQW
(VWDEOLVKWKHIROORZLQJFRQGLWLRQVRQ$GYDQW[FRQVROH
NY5HFRUG
6PDOO)RFDO6SRW
P$
´)29
'RVH'
&HQWHU&9±,,3KDQWRPLQ)29 &9ZLWK´$O
7DNHD75,$/H[SRVXUHDQGREVHUYHLPDJHDVLWLVGLVSOD\HGRQFRQVROHPRQLWRUDW
HQGRIH[SRVXUH
7KHEULJKWQHVVRIWKHGLVSOD\HG75,$/LPDJHPD\FKDQJHDIWHUWKHILUVWIUDFWLRQRID
VHFRQGWRLQGLFDWHDFRUUHFWLRQRIWKH79FDPHUDDSHUWXUH$EULJKWQHVVVKLIW
WKDWLVYHU\QRWLFHDEOHLVSUREDEO\LQGLFDWLYHRID'HIDXOW$SHUWXUHYDOXHZKLFK
LVLQFRUUHFW
$GMXVW5HFRUGP$WRPDLQWDLQD75,$/H[SRVXUHWLPHEHWZHHQDQGPV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG DG/DX/DLX VASCULAR IMAGE QUALITY -RE&DUG;30± RI

5HSHDW75,$/EULJKWQHVVVKLIWWHVWIRUHDFKDYDLODEOHGRVHUDWHDQGGLVSOD\PRGH
 
7KHDOWHUQDWHPHWKRGWKDWIROORZVLVDFFRUGLQJWRFDOLEUDWLRQSURFHGXUHLQVHUYLFH
PDQXDODQGPD\EHXVHGWRYHULI\DQGRUFRUUHFWDQ\VXVSHFWDSHUWXUHYDOXHV
5HFRUGDQ\DEQRUPDOLWLHVRQGDWDVKHHWV

Alternate Method/Cal Procedure (refer to cal procedures for details)


6DPHFRQGLWLRQVDVOLVWHGDERYH
5HSODFH&9SKDQWRPZLWKDKRPRJHQHRXVSKDQWRP PP&XRU$O&XDQGSOH[L
IURP&9SKDQWRP
$FFHVVWKH7HFKQLFDO0HQX
3UHSDUH7HFKQLFDO0HQXSDUDPHWHUVWRPHDVXUH52,
$FTXLUHD0$6.LPDJH
$GMXVWP$WRDFKLHYHDQH[SRVXUHWLPHEHWZHHQ±PV
9HULI\WKDW0HDQ9DOXHRIDFTXLUHGLPDJHLVHTXDOWRWKHYDOXHVSHFLILHGIRUV\VWHP
W\SH LHIRU'/;
$FTXLUHD0$6.LPDJHIRUHDFKDYDLODEOHGRVHUDWHDQGGLVSOD\PRGH  
5HFDODQ\'HIDXOW$SHUWXUHYDOXHVWKDWDUHQRWFRUUHFWDQGRUPDNHQRWHRISUREOHPV
RQGDWDVKHHWV

Miscellaneous Tasks
9HULI\DOO9'3FDUGUDFNIDQVDUHZRUNLQJDQGWXUQLQJDWIXOOVSHHG$Q\
QRQ±IXQFWLRQDOIDQRUIDQVFDQOHDGWRLQWHUPLWWHQWSUREOHPVDQGRUERDUG
IDLOXUHV
&KHFNIRUDFXUUHQWGLJLWDOEDFN±XSIORSS\&UHDWHDEDFN±XSLILQGRXEW5HIHUWR
VHUYLFHPDQXDOIRUGHWDLOHGGLUHFWLRQV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION


,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG DG/DX/DLX CARDIAC IMAGE QUALITY

VXEDVVHPEO\ '*';'/; GDWH

SXUSRVH &DUGLDFWHVW WLPHPLQ

PREREQUISITES
'LJLWDO$GYDQW[V\VWHPVZLWFKHGRQ
$SSOLFDWLRQSURJUDPLQLWLDOL]HG
5HIHUHQFH2SHUDWLRQ0DQXDOVLIQHFHVVDU\IRURSHUDWLRQVSHFLILFV
NOTE: 'LJLWDO&DUGLDF'\QDPLFUHVROXWLRQLVFKHFNHGLQ;30±

TOOLS REQUIRED
2VFLOORVFRSH

TASK DESCRIPTION
&RQQHFWVFRSHWRREVHUYHPRQLWRUYLGHR
6HOHFW'LJLWDO&DUGLDFPRGH LH';&$5'
&UHDWHD1HZ3DWLHQWIRU$FTXLVLWLRQ
(QDEOH $FTXLVLWLRQ
(VWDEOLVKWKHIROORZLQJFRQGLWLRQV
N9S)OXRURDQG5$'
6PDOO)RFDO6SRW
$XWRP$
&9±,,FHQWHUHGLQ)29
I)29
*ULG,1

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG DG/DX/DLX CARDIAC IMAGE QUALITY -RE&DUG;30± RI

Verify Cardiac (Dynamic) Video Levels:


±6HOHFW5HFRUG0HGLXP'LVN)LOPLIDYDLODEOH GLVNRQO\LIQRWDYDLODEOH
±6HOHFW5HFRUG'RVH&LQH VHOHFWGRVH$IRUQRQ±FLQHV\VWHPV
±'XULQJIOXRURH[SRVXUHQRWHDPSOLWXGHRIYLGHRZDYHIRUP
±5HFRUGVHYHUDOVHFRQGVRILPDJHV
±'XULQJUHFRUGDFTXLVLWLRQVREVHUYHYLGHRZDYHIRUP
±,IYLGHROHYHOLVQRWZLWKLQPYRIIOXRURYLGHROHYHOUHFRUGSUREOHPRQGDWDVKHHW
±9HULI\YLGHROHYHOVDWDOOGRVHOHYHOVDYDLODEOH&KDQJHVHOHFWLRQRI5HFRUG0HGLXPDQG
5HFRUG'RVHRQ$GYDQW[FRQVROHDVQHHGHG
Verify EDR Calibration:
±6HOHFWWKH&DUGLDF '\QDPLF UHFRUGGRVHPRVWFRPPRQO\XVHG
±'XULQJDFDUGLDFVHTXHQFHPRYHWKHWDEOHWRZDUGVWKHKHDGHQGVRWKDWWKHDSH[RIWKH
&9±,,SKDQWRPLVDWWKHWRSRIWKH79LPDJHDQGWKHOXQJVHFWLRQRIWKHSKDQWRP
DSSHDUVRQO\LQWKHXSSHUULJKWKDQGDUHDRIWKHPRQLWRURXWVLGHWKH$(&ZLQGRZ
DUHDDVLOOXVWUDWHGEHORZ

$%'

±9HULI\WKDWLPDJHH[KLELWVQREXUQ±RXWLQWKHOXQJDUHDDQGWKDWSHQHWURPHWHUVLQOXQJ
DUHDDUHFOHDUO\YLVLEOH
±1RWHDQ\('5SUREOHPVRQGDWDVKHHW

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG MI–10 FORMATTER

VXEDVVHPEO\ GDWH

SXUSRVH 0HFKDQLFDO IXQFWLRQDOFKHFNRIWKH0,± WLPHPLQ


FDPHUD

PREREQUISITES
+DQGWRROV
9DFXXP
&OHDQLQJPDWHULDOV
6HQVLWRPHWHU
/HQVHFOHDQLQJNLW
TASK DESCRIPTION
Mechanical Tests
&KHFNODPSVDQGFRQWUROVRQFDPHUDDQGRSHUDWRU¶VSDQHOV
2SHQWKHUHDUGRRURIWKH0,±
CAUTION: Remove new films prior to opening. Opening the rear door may expose new
films if the system has an auto loader.
9DFXXPWKHLQVLGHRIWKHFDELQHWDQGIDQILOWHURQWKHSRZHUVXSSO\GUDZHU
/RRNIRULQGLFDWLRQVRISRVVLEOHSUREOHPV LHORRVHFRQQHFWLRQVHWF
&OHDQWKH&57IDFHRIWKHPRQLWRU
&KHFNWKHSRZHUVXSSO\IDQRSHUDWLRQ
&KHFNWKHPDJD]LQHGRFNLQJRSHUDWLRQDQGFRQGLWLRQ
)RUV\VWHPVZLWKDXWRORDGHUV21/<
&OHDQWKHILOPIHHGVXFWLRQFXSVDQGUROOHUV
&OHDQWKHILOPVHQVRU
)RUDQ\DGGLWLRQDOFOHDQLQJRUOXEULFDWLRQUHTXLUHGUHIHUWR6HUYLFH1RWHLQ6HFWLRQ
Performance Tests
5HFRUGGHQVLW\DQGFRQWUDVWDGMXVWPHQWVHWWLQJV
5XQDWHVWILOPIURPWKHV\VWHPVVWRUHGLPDJHV
2EVHUYHWKHIROORZLQJSDUDPHWHUV
,PDJHVL]LQJDQGSRVLWLRQLQJIRUVHOHFWHGIRUPDW
,PDJHIRFXVGHQVLW\DQGFRQWUDVWVFDOHIRUDQDFFHSWDEOHUHSURGXFWLRQRILPDJH
VHOHFWHG
&KHFNLQDOOVZHHSUHYHUVDOVDQGYLGHRUHYHUVDOLIDSSOLFDEOH
5XQDVHQVLWRPHWU\WHVWDQGUHFRUGWKHVSHHGDQGFRQWUDVWLQGH[SHUMREFDUG;30±

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG 3M LASER CAMERA

VXEDVVHPEO\ GDWH

SXUSRVH 0HFKDQLFDODQGIXQFWLRQDOFKHFNRIWKH0/DVHU WLPHPLQ


&DPHUD

PREREQUISITES

TASK DESCRIPTION
Mechanical Tests
&KHFNODPSVDQGFRQWUROVRQFDPHUDDQGRSHUDWRU¶VSDQHOV
2SHQILOPVXSSO\DQGH[LWDUHDV
&OHDQWKHILOPVXFWLRQFXSVDQG1,3 ILOPH[LW UROOHUVZLWKDGU\OLQWIUHHFORWK
2SHQILOPH[SRVXUHDUHDDQGFOHDQWKHILOPWUDQVSRUWSODWHVXUIDFHZLWKDOLQWIUHHDOFRKRO
GDPSHQHG FORWK
/RRNIRULQGLFDWRUVRISRVVLEOHSUREOHPV LHORRVHFRQQHFWRUVHWF 
&ORVHXSWKHFDPHUD
/RDGDFOHDQLQJILOPLQWKHVXSSO\PDJD]LQHDQGUXQLWWKURXJKWKHFDPHUD
NOTE: 7KHFXVWRPHUVKRXOGEHUXQQLQJDFOHDQLQJILOPZHHNO\

Performance Tests
5HFRUGGHQVLW\DQGFRQWUDVWVHWWLQJV
5XQDWHVWILOPIURPWKHV\VWHPVVWRUHGLPDJHV
2EVHUYHWKHIROORZLQJSDUDPHWHUV
,PDJHVL]LQJDQGSRVLWLRQLQJIRUVHOHFWHGIRUPDW
,PDJHIRFXVGHQVLW\DQGFRQWUDVWVFDOHIRUDQDFFHSWDEOHUHSURGXFWLRQRILPDJH
VHOHFWHG
&KHFNLQDOOVZHHSUHYHUVDOVDQGYLGHRUHYHUVDOLIDSSOLFDEOH
5XQDVHQVLWRPHWU\WHVWDQGUHFRUGWKHVSHHGDQGFRQWUDVWLQGH[SHUMREFDUG;30±
NOTE:0RQLWRUFDPHUDSHUIRUPDQFH&OHDQLQJPD\EHGRQHPRUHRIWHQLISUREOHPV
RFFXU0UHFRPPHQGVFOHDQLQJEL±ZHHNO\

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG 3M LASER CAMERA -RE&DUG;30± RI

USING THE LASER IMAGER PLUS – CONTROLS AND INDICATORS 5HIHUWR


,OOXVWUDWLRQ
A. Power Switch±&RQWUROVSRZHUWRWKH/DVHU,PDJHU±PRPHQWDU\QRWDUHVHW
B. Remote Keypad±,QFOXGHVLQGLFDWRUVDQGFRQWUROVQRUPDOO\XVHGGXULQJDSULQW
VHTXHQFH±RQRURQ RSWLRQDO 
C. Top Cover Release±$OORZVWKHWRSFRYHUWREHUDLVHGIRUDFFHVVWRWKHILOP
WUDQVSRUWDUHD(OHFWULFDODQGPHFKDQLFDOODVHUE\SDVVHVXVHVPDOOGUDLQSODVWLFVWUDZ
GRQ¶WXVHPHWDOOLFVFUHZGULYHU WRSUHYHQWPHVKGDPDJH
D. Local Panel±,QFOXGHVVWDWXVLQGLFDWRUVDQGWKHFRQWUROVHFWLRQ&RQWUROVHFWLRQ
LQFOXGHVDVWDWXVGLVSOD\FDOLEUDWLRQFRQWUROVUHVHWDQGERUGHUVHOHFWLRQ
E. Docking Lever±3RVLWLRQGLUHFWVILOPWRWKHUHFHLYHPDJD]LQHRUWRDQH[WHUQDOO\
FRQQHFWHGILOPSURFHVVRU /HYHULVRQHQGRILPDJHUQRWYLVLEOHLQ,OOXVWUDWLRQ
F. Unload Button±2SHQVWKHUHFHLYHPDJD]LQHGUDZHU
G. Receive Magazine Drawer±(QDEOHVDFFHVVWRUHFHLYHPDJD]LQH
H. Load Button±2SHQVWKHVXSSO\PDJD]LQHGUDZHU
I. Supply Magazine Drawer±(QDEOHVDFFHVVWRWKHVXSSO\PDJD]LQH

,//8675$7,21 
LASER IMAGER PLUS

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG 3M LASER CAMERA -RE&DUG;30± RI

LOCAL PANEL OPERATOR CONTROLS


5HIHUWR,OOXVWUDWLRQ
1. POWER Light±,QGLFDWHVSRZHUWRWKH/DVHU,PDJHU3OXV
2. READY Light±/LJKWVZKHQWKH/DVHU,PDJHU3OXVLVUHDG\WREHJLQLWVQH[W
RSHUDWLRQ6WDWXVFRGH³´ZLWKRXWUHDG\²!LQGLDJV
3. FILM LOW Light±,QGLFDWHVWKDWWKHILOPVXSSO\LVORZLQWKHVXSSO\PDJD]LQHOHVV
WKDQVKHHWVRIILOPUHPDLQ
4. ALARM Light±,QGLFDWHVDQHUURULQ/DVHU,PDJHU3OXVRSHUDWLRQ

,//8675$7,21 
LOCAL PANEL CONTROLS

Press density and contrast test


simultaneously to open magaĆ
zine drawer with open cassette
(flashing error code).

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG 3M LASER CAMERA -RE&DUG;30± RI

5. RESET Button±5HVWDUWVWKH/DVHU,PDJHU3OXVDIWHU³FHUWDLQ´DODUPVLWXDWLRQVKDYH
RFFXUUHGRURQFHWKH\KDYHEHHQFRUUHFWHG³6RIW´UHVHWSUHYHQWVDFFLGHQWDOUHVHWVLQ
008V\VWHPV
6. STATUS Display±,QGLFDWHVFXUUHQW/DVHU,PDJHU3OXVRSHUDWLRQDQGDODUP
FRQGLWLRQ 7KHVWDWXVFRGHODEHORQWKHFRQWUROGRRUJLYHVDQH[SODQDWLRQRIWKH
VWDWXVGLVSOD\FRGHV
NOTE:,IVWDWXVGLVSOD\OLJKWLVEOLQNLQJRQHRUERWKRIWKHPDJD]LQHVPD\EH
SDUWLDOO\RSHQOHDYLQJWKHILOPYXOQHUDEOHWRH[SRVXUH
7. DENSITY TEST Button±,QGLFDWHVSULQWLQJRIDGHQVLW\WHVWSDWWHUQRQILOP7KLVWHVW
SDWWHUQKHOSVGHWHUPLQHFRUUHFW,PDJHURSHUDWLRQLQGHSHQGHQWRILQSXWYLGHR
8. DENSITY ADJUST Knob±6HOHFWWKHGHQVLW\UDQJH +LJKHUQXPEHUVPHDQPRUH
LPDJHGHQVLW\/RZHUQXPEHUVPHDQOHVVLPDJHGHQVLW\
9. CONTRAST TEST Button±,QGLFDWHVH[SRVXUHRIWKHVDPHLPDJHZLWKGLIIHUHQW
FRQWUDVWYDOXHVRQRQH RUWZR VKHHWVRIILOPGHSHQGLQJRQWKHIRUPDWVHOHFWHG
7KHQXPEHUWKDWDSSHDUVEHORZHDFKLPDJHFRUUHVSRQGVWRWKHDGMXVWPHQWVHWWLQJ
RQWKH&2175$67$'-867NQRE
10. CONTRAST ADJUST Knob ±6HOHFWVWKHFRQWUDVWVHWWLQJ 7KHQXPEHUVFRUUHVSRQG
WRWHVWILOPLPDJHVREWDLQHGE\SUHVVLQJWKH&2175$677(67EXWWRQ 0XVWVWRUHDQ
LPDJH
11. USER SET Button±6WRUHVWKHYDOXHVVHOHFWHGE\WKH'(16,7<DQG&2175$67
$'-867.QREVDQGWKH%25'(5VHOHFWLRQVZLWFKLQWRPLFURSURFHVVRUPHPRU\
7KLVVWDWXVPXVWEH³´DQGWKH5HDG\OLJKWPXVWEHRQ
12. USER CHANNEL Knob±6HOHFWWKHXVHU PRGDOLW\ IRUZKLFKGHQVLW\FRQWUDVWDQG
ERUGHUVHWWLQJVPD\EHVWRUHG
13. BORDER Selection Switch ±(QDEOHVWKHVHOHFWLRQRID&/($5RUD%/$&.ERUGHU
EHWZHHQWKHLPDJHVRQWKHILOP

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG 3M LASER CAMERA -RE&DUG;30± RI

,//8675$7,21 
STAGE 1: FILM PICKUP

Pickup Assemblies

125 Sheets
of Film

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG 3M LASER CAMERA -RE&DUG;30± RI

,//8675$7,21 
STAGE 2: FILM STAGING

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG 3M LASER CAMERA -RE&DUG;30± RI

OPERATOR MAINTENANCE
$&OHDQLQJ.LWDYDLODEOHIURP0SURYLGHVWKHPDWHULDOVIRURSHUDWRUVWRSHUIRUPURXWLQH
PDLQWHQDQFH8VHRIWKLVNLWZLOOPLQLPL]HSRVVLEOHILOPMDPVDQGWKHHIIHFWVGXVWDQG
GHEULVFDQKDYHRQLPDJHTXDOLW\
7KHFOHDQLQJNLWFRQWDLQVWKHIROORZLQJLWHPV
1. FOHDQLQJILOPVKHHWV
2. DOFRKROSDGV
3. GU\OLQW±IUHHFORWKV
0UHFRPPHQGVWKHIROORZLQJFOHDQLQJDFWLYLWLHVEHSHUIRUPHGHYHU\WZRZHHNVLQWKHRUGHU
VKRZQ

Item (See Illustration 5) Cleaning Procedure

1. Suction Cups 5DLVHWKH2SWLFV0RGXOHDQGZLUHWKHIRXUFXSVZLWKWKHOLQW±IUHH


FORWK

NOTE: Do not XVHDOFRKROSDGVRQVXFWLRQFXSVRUUROOHUV

2. Transport Plate :LSHZLWKDOFRKROSDG$OORZSODWHWRDLUGU\

3. Docking Unit Plate 5HPRYHWKH'RFNLQJ8QLWWRSFRYHUWRDFFHVV:LSHZLWKDOFRKRO


SDG$OORZSODWHWRDLUGU\

4. Drive and Nip Rollers &ORVHWKHRSWLFVPRGXOHDQGSRVLWLRQWKH'RFNLQJ8QLWOHYHUWRXVH


WKH5HFHLYH0DJD]LQH,QGDUNURRPFRQGLWLRQVSHHOWKHSURWHFWLYH
SDSHUIURPDFOHDQLQJILOPVKHHW3ODFHWKHVKHHW VWLFN\VLGHXS 
RQWRSRIDQ\H[LVWLQJILOPLQWKHVXSSO\PDJD]LQH

/RDGWKH6XSSO\0DJD]LQHLQWRWKH,PDJHUDQGSUHVVWKH'HQVLW\
7HVW%XWWRQWRWUDQVSRUWWKHFOHDQLQJILOPWKURXJKWKHPDFKLQH
'LVFDUGWKHXVHGFOHDQLQJILOPIURPWKHUHFHLYHPDJD]LQH

5. Exterior Panels 8VHWKHSDGDQGFORWKIURP6WHSVDQGWRFOHDQDQ\GLUWRQ


WKHVHSDQHOV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG 3M LASER CAMERA -RE&DUG;30± RI

,//8675$7,21 
MAINTENANCE LOCATIONS

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

,0$*(6<67(0 -RE&DUG;30± RI

MREFDUG CINE PROJECTORS

VXEDVVHPEO\ ,0$*(6<67(0 GDWH

SXUSRVH &OHDQDQGFKHFNRSHUDWLRQRIFLQHSURMHFWRU WLPHPLQ

PREREQUISITES
7RROVUHTXLUHG 6RIWEULVWOHEUXVK
&RPSUHVVHGDLURUHTXLYDOHQW
/HQVWLVVXH

TASK DESCRIPTION
Clean & Functional Check:
&OHDQILOPSDWKVDQGOHQVDUHDVRIDQ\ILOPSLHFHVDQGGXVWE\XVLQJDVRIWEULVWOH
EUXVKRUFRPSUHVVHGDLU
1RWHFOHDQOLQHVVRIOHQVHVDQGFOHDQHDVLO\DFFHVVLEOHVXUIDFHV,IDGGLWLRQDOFOHDQLQJ
LVQHHGHGVFKHGXOHIRUDGGLWLRQDOVHUYLFHWLPH
9LHZLOOXPLQDWHGVFUHHQVWUDLJKWRQDQGQRWHXQLIRUPLW\RIEULJKWQHVV,IDKRWVSRWLV
YLVLEOHLVLWFHQWHUHG7KLVLVDQLQGLFDWLRQRISURSHUODPSDOLJQPHQW
/RDGILOPDQGUXQDWKLJKORZVSHHGVDQGUHYHUVHZKLOHEHLQJREVHUYDQWRIWUDQVSRUW
SUREOHPV
7UDLOLQJRUVWUHDNLQJRILPDJHVDWWRSDQGRUERWWRPZKLOHWUDQVSRUWLQJILOPDUHQRUPDO
IRUDSURMHFWRUZLWKRXWDVKXWWHU)RUSURMHFWRUVZLWKDVKXWWHU LH9DQJXDUG
WKLVLVDQLQGLFDWLRQRIWLPLQJSUREOHPVDQGVHUYLFHRQWKHXQLWPXVWEH
VFKHGXOHGZLWKWKHFXVWRPHU

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

7+,63$*(,17(17,21$//</()7%/$1.

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MAMMOGRAPHY
TABLE OF CONTENTS

JOB CARD TITLE PAGE

;30± 0$002  ±

;30± ³5´287387  ±

;30± )2&$/63275(62/87,21/,0,7  ±

;30± &$/&8/$7,212)$9(5$*(*/$1'8/$5'26(  ±

;30± *(1(5$725&$/,%5$7,21±0$002  ±

;30± 5$'02%,/(6±3/$11('0$,17(1$1&(  ±

3UHYHQWLYH0DLQWHQDQFHLQVSHFWLRQVDUHQRWDVXEVWLWXWHIRU046$6WDWHRU$&5
LQVSHFWLRQVRUDFFUHGLWDWLRQV+RZHYHUE\URXWLQHWHVWLQJLWLVLQWHQGHGWRNHHSWKH
HTXLSPHQWDWDOHYHORISHUIRUPDQFHWKDWZLOOPHHWRUSDVVDQLQVSHFWLRQRUSURYLGH
DQLQGLFDWLRQWKDWVHUYLFHUHSDLUVKRXOGEHSHUIRUPHGSULRUWRDFHUWLILHGLQVSHFWLRQ

±L
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

7+,63$*(,17(17,21$//</()7%/$1.

±LL
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

0$002*5$3+< -RE&DUG;30± RI

MREFDUG MAMMO

VXEDVVHPEO\ 0$002*5$3+< GDWH

SXUSRVH 7RFKHFNRXWWKHPDPPRJUDSK\XQLWIROORZLQJWKH WLPHKRXUDQGPLQ


JXLGHOLQHVIRXQGZLWKLQWKLVSURFHGXUH

PREREQUISITES
+DQGWRROV 9DFXXP
5DJV 50,± SKDQWRP
/36RU673 OXEULFDQW &DVVHWWH
)RUPXOD FOHDQLQJVROXWLRQ HWF /LJKWILHOGHGJHPDUNHUV
OSPP3KDQWRP VKHHWVRIFP3OH[LJODV
%DWKURRPZHLJKWVFDOH
TASK DESCRIPTION
Safety/Functional
1.0 500T/600T Senix
)RUFRXQWHUZHLJKWFDEOHLQVSHFWLRQUHIHUHQFH,OOXVWUDWLRQVDQG

700T/800T
)RUFRXQWHUZHLJKWEHOWLQVSHFWLRQUHIHUHQFH,OOXVWUDWLRQ

DMR
)RUJDVSLVWRQLQVSHFWLRQUHIHUHQFH,OOXVWUDWLRQ

2.0 Counterweight Cable Safety Latches 500T/600T/Senix


&KHFNVDIHW\GRJUDLOVIRUDQ\VLJQVRIHQJDJHPHQW&KHFNWHHWKRIWKHVDIHW\GRJV
IRUPHWDOFKLSV6HH,WHPRQ,OOXVWUDWLRQZKLFKGHWDLOVWKH6HQJRJUDSK
VDIHW\GRJV
3.0 Safety and Interlock Switches
500T/600T/Senix
9HULI\WKHVDIHW\VZLWFKRSHUDWLRQWKDWLVRQWKHERWWRPRIWKHPRYDEOHFROXPQ

All Units
9HULI\RSHUDWLRQRIWKHPRYDEOHFROXPQHQGRIWUDYHOVZLWFKHVIRUERWK³83´DQG
³'2:1´PRYHPHQWV
9HULI\HPHUJHQF\³2))´VZLWFKRSHUDWLRQVRPHXQLWVKDYHPRUHWKDQRQHVZLWFK
9HULI\FROXPQPRYHPHQWVDUHGLVDEOHGZLWKFRPSUHVVLRQDSSOLHG

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG MAMMO -RE&DUG;30± RI

4.0 Electrical Cables and Harnesses


&KHFNDOOH[SRVHGFDEOHVDQGKDUQHVVHVIRUVWUDLQUHOLHIFXWVDQGSURSHUURXWLQJ
NOTE:2Q6HQRYLVLRQSD\VSHFLILFDWWHQWLRQWRWKHGHWHFWRUFDEOHIRUEHQGVNLQNV
DQGFRXSOLQJ
5.0 Lead Glass Shield Condition
&KHFNIRUFUDFNVDQGYHULI\VHFXUHPRXQWLQJ

6.0 Transport Modification “MOBILE VANS ONLY”


9HULI\WKDWDOOSDUWVDUHSUHVHQWDQGIXQFWLRQDO
9HULI\WKHWUXFNLVRODWLRQLQVWUXFWLRQVDUHFOHDUO\GLVSOD\HG

7.0 Lock Operation


9HULI\DOOVZLWFKHVDQGORFNVDUHIXQFWLRQDO
9HULI\SURSHURSHUDWLRQRIWKH'05JDQWU\DUPIRUWKH6WHUHRW[DQJOHPRYHPHQWV
2QWKH'05YHULI\SURSHURSHUDWLRQRIWKHJULGORFNLQJOHYHU
2QWKH77'05YHULI\SURSHURSHUDWLRQRIWKH0DJSODWIRUPODWFK

8.0 Column Drive Operation


9HULI\VPRRWKPRYHPHQWRIWKHFROXPQGULYH$VFHQWDQGGHVFHQWWRWDOWUDYHOWLPHV
VKRXOGEHHTXDOZLWKLQVHFRQGV

9.0 Compression Paddle Condition


&KHFNWKHSDGGOHVIRUDQ\VLJQVRIFUDFNVRUIUDFWXUHV&KHFNHDFKSDGGOHIRU
PHFKDQLFDOWLJKWQHVVRQLWVPRXQWLQJEUDFNHW

10.0 Compression Operation


500T/600T/Senix
9HULI\ZLWKPD[LPXPFRPSUHVVLRQDSSOLHGWKHJDXJHUHDGVEDUVRUFXVWRPHU¶V
VHWWLQJ
9HULI\SQHXPDWLFFRPSUHVVLRQJDXJHFRQWDLQVIOXLGDQGWKHUHDUHQRVLJQVRI
OHDNDJH

500T/TS PDQXDOFRPSUHVVLRQ
9HULI\HDVHRIPRYHPHQWIXOO\XSDQGIXOO\GRZQ
9HULI\WKHDELOLW\WRKROGDPLQLPXPIRUFHRIFRPSUHVVLRQRIOEV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG MAMMO -RE&DUG;30± RI

700T/800T/DMR
9HULI\DFFXUDF\RIWKHIRUFHRIFRPSUHVVLRQGLVSOD\XWLOL]LQJEDWKURRPZHLJKWVFDOH
NOTE: GHFDQHZWRQ OEV

All Units
9HULI\EUHDVWWKLFNQHVVVFDOHRULQGLFDWRUIRUDFFXUDF\
9HULI\PD[LPXPIRUFHRIFRPSUHVVLRQGRHVQRWH[FHHGWKH046$RUORFDOOLPLWV

11.0 Operator Controls, Lamps and Indicators


All Senographe Units
,QVSHFWDOOYLVXDOGLVSOD\VDQGLQGLFDWRUVIRUEXUQWODPSVDQGIRUGHIHFWLYHGLVSOD\
VHJPHQWV
9HULI\RSHUDWRUZDUQLQJODEHOLVSUHVHQW
9HULI\SURSHURSHUDWLRQRIWKHSUHSDQGH[SRVXUHVZLWFKHV

Dataflash
9HULI\SURSHURSHUDWLRQE\IODVKLQJDILOPDQGFKHFNLQJIRUOHJLEOHFKDUDFWHUV

Stereotx
,QVSHFWODPSVDQGLQGLFDWRUV
,QVSHFWFRQWURONQREVWRHQVXUHWKHUHLVQRPHFKDQLFDOVOLSSDJH

Senovision
9HULI\836LQGLFDWRUVDUHIXQFWLRQDO
,QVSHFWGHWHFWRUZDWHUFLUFXODWLRQV\VWHPVUHVHUYRLUIRUSURSHUZDWHUOHYHO

12.0 Bucky Operation


9HULI\JULGPRYHPHQWGXULQJDQH[SRVXUHIRUDOOEXFN\V
9HULI\FDVVHWWHLQSODFHVWRSVDUHVHFXUHGDQGIXQFWLRQDOIRUHYHU\EXFN\DQG
FDVVHWWHKROGHU
&KHFNDOOEXFN\VIRUDQ\VLJQVRIFUDFNHGEURNHQORRVHRUPLVVLQJSDUWV
&KHFNIRUDEVHQFHRIJULGOLQHDUWLIDFWVE\H[SRVLQJDILOPXWLOL]LQJFPRI3OH[LJODV
DQGDWHFKQLTXHRIN9SLQ$(&PRGHRIRSHUDWLRQ5HSHDWIRUQGEXFN\

13.0 Collimation
9HULI\WKDWDQH[SRVXUHLVLQKLELWHGZKHQWKHFROOLPDWLRQGLDSKUDJPLVUHPRYHG
2Q776HQL[YHULI\WKDW02DQG$/LQGLFDWRUVDUHOLWZKHQ02DQG$/ILOWHUV
DUHVHOHFWHGUHVSHFWLYHO\
9HULI\H[SRVXUHLVLQKLELWHGZKHQWKH02ILOWHULVLQWKHEHDPDQGN9SRUDERYHLV
VHOHFWHG2QWKH'05YHULI\WKDWWKH02ILOWHUFDQQRWEHVHOHFWHGZLWK
N9SRUKLJKHUGLVSOD\HGRQWKHFRQVROH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG MAMMO -RE&DUG;30± RI

9HULI\[±UD\ILHOGFRLQFLGHQFHZLWKWKHOLJKWILHOGXVLQJD5$7SDWWHUQRUDVDQ
DOWHUQDWHPHWKRGVWULSVRIVROGHURU$OOHQZUHQFKHVWRPDUNWKHHGJHVRIWKH
OLJKWILHOGRQWRSRIDFDVVHWWH7DNLQJDQH[SRVXUHRIWKHFDVVHWWHDQG
SURFHVVLQJWKHILOPZLOOVKRZDQ\HUURUV
9HULI\[±UD\EHDPFHQWHULQJWRWKHEXFN\E\REVHUYLQJWKHOLJKWILHOG7KLVVKRXOGEH
GRQHIRUHDFKEXFN\DQGFDVVHWWHKROGHU

14.0 AEC Performance (Benchmark Test)


0DNHDQ$(&H[SRVXUHRIWKH50,±SKDQWRPZLWKWKHSKRWRWLPHUVHQVRUFHOOLQ
WKHPLGGOHSRVLWLRQZKLFKVKRXOGFHQWHULWXQGHUWKHFHQWHURIWKHSKDQWRP
8VHWKHWHFKQLTXHIDFWRUVWKDWWKHFXVWRPHUZRXOGQRUPDOO\XVHIRUDFP
EUHDVW,IXQDEOHWRGHWHUPLQHZKDWWHFKQLTXHIDFWRUVWKHFXVWRPHUQRUPDOO\
XVHVVHOHFWN9S5HFRUGWKHWHFKQLTXHIDFWRUVN9SDQGP$VRQWKH'DWD
5HFRUG
'HWHUPLQHWKHQXPEHURIYLVXDOL]HG6SHFNV)LEULOVDQGPDVVHVDQGUHFRUGWKH
UHVXOWVRQWKH0DPPRJUDSK\'DWD5HFRUG0LQLPXPYLVXDOL]DWLRQ
UHTXLUHPHQWVDUHQRWHGRQWKH'DWD5HFRUG
0HDVXUHWKHRSWLFDOGHQVLW\RIWKH50,±SKDQWRPE\PHDVXULQJPPLQIURP
WKHFKHVW±ZDOOHGJHRIWKHILOP5HFRUGWKLVGDWDRQWKH0DPPRJUDSK\'DWD
5HFRUG
7DNH$(&H[SRVXUHVXWLOL]LQJWKHVDPHFDVVHWWHHDFKWLPHDWWKHIROORZLQJ
WHFKQLTXHVWRGHWHUPLQHSURSHUFDOLEUDWLRQRIWKH5HFLSURFLW\/DZRI)DLOXUH
DQGN9SFRPSHQVDWLRQFLUFXLWU\5HFRUGWKHUHVXOWVRQWKH0DPPRJUDSK\
'DWD5HFRUG

25 kVp with 4cm of Plexiglas


28 kVp with 2cm of Plexiglas
28 kVp with 4cm of Plexiglas
28 kVp with 6cm of Plexiglas
31 kVp with 4cm of Plexiglas

7KHWRWDOYDULDWLRQRIRSWLFDOGHQVLW\RQWKHDERYHILOPVVKRXOGQRWH[FHHG
RSWLFDOGHQVLW\

NOTE 1: )RU77WKUHHSKDVHV\VWHPVFPRUFPRI3OH[LJODVPD\EH
XVHGLQSODFHRIWKHFPH[SRVXUHGXHWRWKHP$VEDFNXSWLPHOLPLWDWLRQ
NOTE 2: For non–GE systemsUHIHUWR2(0WHFKQLFDOGRFXPHQWDWLRQ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG MAMMO -RE&DUG;30± RI

,//8675$7,21 
SENOGRAPHE SENIX HF

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG MAMMO -RE&DUG;30± RI

,//8675$7,21 
SENOGRAPHE SENIX HF

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG MAMMO -RE&DUG;30± RI

,//8675$7,21 
SENOGRAPHE SENIX HF

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG MAMMO -RE&DUG;30± RI

,//8675$7,21 
COUNTERWEIGHT BELT

<
; <

; <

<

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG MAMMO -RE&DUG;30± RI

,//8675$7,21 
GAS PISTON

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

0$002*5$3+< -RE&DUG;30± RI

MREFDUG “R” OUTPUT

VXEDVVHPEO\ 0$002*5$3+< GDWH

SXUSRVH &KHFNWXEHFRQGLWLRQDQGWKH³5´RXWSXW WLPHPLQ

PREREQUISITES
7RROVUHTXLUHG ³5´PHWHU
IOHDG

TASK DESCRIPTION
Setup:
6HOHFW QRQ±SKRWRWLPH
N9S
P$V
0RO\ILOWHU
,QVWDOOE\FPGLDSKUDJP
3ODFHIOHDGRYHUSKRWRGHWHFWRUDUHD
3ODFHWKH5$'SUREHRQILOPKROGHUODWHUDOO\FHQWHUHGDQGFPIURPWKHIURQW
&RPSUHVVLRQSDGGOHUHPRYHG
NOTE: 3HUIRUPWKHFDOLEUDWLRQVHFWLRQXPM 706EHIRUHWHVWLQJWKH³5´RXWSXW

Procedure:
7DNHDQH[SRVXUHDQGWDNHQRWHRIWKH³5´RXWSXW:DLWRQHPLQXWHEHWZHHQH[SRVXUHV
7DNHDVHFRQGH[SRVXUH7DNHQRWHRIWKH³5´RXWSXW7KHRXWSXWVKRXOGEHZLWKLQ
5EHWZHHQH[SRVXUHV&RPSDUHWKH³5´RXWSXWZLWKWKHRULJLQDOYDOXHDWWKHWLPH
WKHWXEHZDVLQVWDOOHGRUIURPWKHILUVW30'DWD5HFRUGVKHHWDIWHUWKHWXEHZDV
LQVWDOOHG&DOFXODWHGWKHWXEHRXWSXWGURSRII
% tube output drop off =
(original tube output – actual tube output)/original tube output
,IWKH% tube output drop off LVJUHDWHUWKDQ WKH;±UD\WXEHVKRXOGEHUHSODFHG
5HFRUGWKHRXWSXWYDOXHLQWKHGDWDVKHHW
NOTE: For non–GE systemsUHIHUWR2(0WHFKQLFDOGRFXPHQWDWLRQ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

0$002*5$3+< -RE&DUG;30± RI

MREFDUG FOCAL SPOT RESOLUTION LIMIT

VXEDVVHPEO\ 6(12*5$3+(7$1'7 GDWH

SXUSRVH 0HDVXUHWKHUHVROXWLRQOLPLWRIWKHIRFDOVSRWVDQG WLPH±PLQ


FRPSDUHYDOXHVREWDLQHGZLWKWKHUDWHGYDOXHV

PREREQUISITES
7RROVUHTXLUHG 'HQVLWRPHWHU
7HVWFDVVHWWH
7HVWGLDSKUDJP
776HQL[IRUPPIRFDOVSRW &* 
77IRUPPIRFDOVSRW 
7HVWGLDSKUDJP
776HQL[IRUPPIRFDOVSRW &* 
77IRUPPIRFDOVSRW 
7HVWGLDSKUDJPIRUWKH'05PPDQGPP 
6WDUSDWWHUQIRUPPIRFDOVSRW  ±3
6WDUSDWWHUQIRUPPIRFDOVSRW  ±3
FPUXOH
&DOFXODWRU
FP3OH[LJODVEORFN XSWRUHTXLUHG ±3
OSPPWHVWSDWWHUQ 

NOTE:$VSHU046$UHFRPPHQGDWLRQVXQWLOVWDUSDWWHUQUHVROXWLRQ
PHDVXUHPHQWPHWKRGVFDQEHXWLOL]HGDIWHUWKHOSPPWHVWSDWWHUQWHVWLQJ
PHWKRGVKRXOGEHXVHGDOWKRXJKVWDUSDWWHUQPHDVXUHPHQWVFDQEHXWLOL]HGWRLVRODWHFDXVH
RISRRUOSPPUHVROXWLRQ
TASK DESCRIPTION lp/mm TEST PATTERN
Description of Operations
)RFDO6SRW:LGWK
3ODFHWKHOSPPWHVWSDWWHUQFPDERYHWKHLPDJHUHFHSWRUHLWKHUE\SODFLQJWKHSDWWHUQ
RQFPRI3OH[LJODVRUE\SODFLQJWKHSDWWHUQRQWKHFRPSUHVVLRQSODWHDQG
SRVLWLRQLQJWKHFRPSUHVVLRQSODWHLQRUGHUWRDFKLHYHDFPGLVWDQFH3RVLWLRQWKH
OLQHSDLUSDWWHUQZLWKLQFPRIWKHFKHVWZDOOHGJHRIWKHLPDJHUHFHSWRUDQG
FHQWHUHGODWHUDOO\:LWKWKHOLQHSDLUVUXQQLQJSDUDOOHOWRWKHDQRGHFDWKRGHD[LV
H[SRVHDILOPWRSURGXFHDEDFNJURXQGGHQVLW\RIEHWZHHQDQG7KLVZLOO
UHSUHVHQWWKHOLPLWLQJVSDWLDOUHVROXWLRQIRUWKHZLGWKRIWKHIRFDOVSRWDQGVKRXOGEH
JUHDWHUWKDQOSPP0HDVXUHDQGUHFRUGWKHUHVXOWVLQWKH0DPPRJUDSK\'DWD
5HFRUGVKHHWIRUDOOODUJHIRFDOVSRWDQGWDUJHWPDWHULDOFRPELQDWLRQV5HSHDWWKH
DERYHWHVWRQDPDJQLILFDWLRQVWDQGRIPDJIRUDOOWDUJHWDQGVPDOOIRFDOVSRW
FRPELQDWLRQV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG FOCAL SPOT RESOLUTION LIMIT -RE&DUG;30± RI

)RFDO6SRW/HQJWK
2EVHUYHWKHVHWXSSURFHGXUHIRUWKHIRFDOVSRWZLGWKZLWKWKHH[FHSWLRQRISRVLWLRQLQJWKH
SDWWHUQOLQHVUXQQLQJSHUSHQGLFXODUWRWKHDQRGHFDWKRGHD[LV([SRVHDILOPWR
SURGXFHDEDFNJURXQGGHQVLW\RIEHWZHHQDQG7KLVZLOOUHSUHVHQWWKHOLPLWLQJ
VSDWLDOUHVROXWLRQIRUWKHOHQJWKRIWKHODUJHIRFDOVSRWDQGVKRXOGEHJUHDWHUWKDQ
OSPP0HDVXUHDQGUHFRUGWKH5HVXOWVLQWKH0DPPRJUDSK\'DWD5HFRUGVKHHWIRU
DOOODUJHIRFDOVSRWDQGWDUJHWPDWHULDOFRPELQDWLRQV5HSHDWWKHDERYHWHVWRQD
PDJQLILFDWLRQVWDQGRIPDJIRUDOOWDUJHWDQGVPDOOIRFDOVSRWFRPELQDWLRQV
NOTE:2QWKH'05UHSHDWWKHDERYHSURFHGXUHVIRUWKH5KRGLXPWUDFNDQGUHFRUGWKH
UHVXOWVLQWKH0DPPRJUDSK\'DWD5HFRUGVKHHW

TASK DESCRIPTION STAR PATTERN


Description Of Operations

 ,IWKLVLVWKHILUVWPDLQWHQDQFHLQVSHFWLRQ UHIHUHQFHWHVW RULIWKHWXEHKDVMXVWEHHQ


FKDQJHGJRWRWKHQH[WSDUDJUDSK  

,IWKLVLVDSHULRGLFPDLQWHQDQFHFKHFNJRWRSDUDJUDSK
'HWHUPLQLQJ &RQVWDQWV
 ,QVHUWWKHWHVWGLDSKUDJPIRUWKHPPIRFDOVSRW ZLWKRXWWKHWHVWSDWWHUQ DQG
VHOHFWWKHIRFDOVSRW
 5HPRYHWKHEXFN\
 3ODFHWKHWHVWFDVVHWWHHTXLSSHGZLWKDILOPRQWRSRIWKHILOPKROGHUDVVHPEO\ DQG
QRWLQWKH%XFN\ DQGFHQWHULWZLWKUHVSHFWWRWKHOLJKWLPDJHIURPWKHGLDSKUDJP
RSHQLQJ
 'LVSOD\DKLJKYROWDJHYDOXHRIN9DQGP$VWKHQPDNHDQH[SRVXUH$GMXVWWKH
P$VRUN9SIRUDQDFFHSWDEOHGHQVLW\LQRUGHUWRYLVXDOL]HWKHEOXUULQJDUHD
 3RVLWLRQWKHWHVWGLDSKUDJPIRUDPPIRFDOVSRW ZLWKRXWWKHWHVWSDWWHUQ DQG
VHOHFWWKHIRFDOVSRW
 3ODFHWKHWHVWFDVVHWWHHTXLSSHGZLWKDILOPRQWRSRIWKHILOPKROGHUDVVHPEO\DQG
FHQWHULWZLWKUHVSHFWWRWKHOLJKWLPDJHIURPWKHGLDSKUDJPRSHQLQJ
 'LVSOD\DKLJKYROWDJHRIN9DQGP$VWKHQPDNHDQH[SRVXUH$GMXVWWKHP$V
RUN9SIRUDQDFFHSWDEOHGHQVLW\LQRUGHUWRYLVXDOL]HWKHEOXUULQJDUHD

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG FOCAL SPOT RESOLUTION LIMIT -RE&DUG;30± RI

0DJQLILFDWLRQ 0HDVXUHPHQW
 &DUHIXOO\PHDVXUHWKHGLDPHWHURIWKHLPDJHRIWKHFLUFXODURSHQLQJRIHDFKWHVW
FDVVHWWHRQWKHH[SRVXUHVREWDLQHG
 &DOFXODWHPDJQLILFDWLRQ0
LPDJHGLDPHWHU
0
RSHQLQJ GLDPHWHU
6WDU3DWWHUQ([SRVXUHV
 3RVLWLRQWKHWHVWGLDSKUDJPIRUDPPIRFDOVSRWHTXLSSHGZLWKWKHFRUUHVSRQGLQJ
VWDUSDWWHUQ  LQVXFKDZD\WKDWWKHEHDPD[HVDUHSDUDOOHOWRWKHVLGHVRIWKH
LPDJHUHFHSWRUVXSSRUW
NOTE: ,IWKHVXSSRUWDQGSDWWHUQDVVHPEO\GRHVQRWILWWKURXJKWKHRSHQLQJLQ
WKHKRXVLQJLWZLOOEHQHFHVVDU\WRUHPRYHWKHVSDFHUPRYHWKHGLDSKUDJPWR
WKHKDOI±ZD\WUDYHOSRLQWXQGHUWKHSDWWHUQLQVHUWWKHSDWWHUQWKURXJKWKHQRZ
XQREVWUXFWHGRSHQLQJXQGHUWKHPLUURUDQGVOLGHWKHSDWWHUQDORQJWKHWRSRI
WKHGLDSKUDJPWRLWVLQVHUWLRQSRLQW
WARNING: Be careful not to touch the mirror.

 0DNHDQH[SRVXUHLQWKHVDPHFRQGLWLRQVDVEHIRUHDQGZLWKWKHVDPHWHFKQLTXH
IDFWRUVDVLQWKHUHIHUHQFHWHVW
 3RVLWLRQWKHWHVWGLDSKUDJPIRUDPPIRFDOVSRWHTXLSSHGZLWKWKHFRUUHVSRQGLQJ
VWDUSDWWHUQ  DQGPDNHDQH[SRVXUHLQWKHVDPHFRQGLWLRQVDVEHIRUHDQGZLWK
WKHVDPHWHFKQLTXHIDFWRUVDVLQWKHUHIHUHQFHWHVW
)RFDO6SRW0HDVXUHPHQW
 0HDVXUHGLDPHWHU'LQWKHPLGGOHRIGLVWRUWLRQDUHDRQHDFKRIWKHWZRH[SRVXUHV
NOTE: 7KHGLVWRUWLRQ RUEOXUULQJ DUHDRQWKHSDWWHUQLPDJHLVWKHDUHDZKHUH
WKHSDWWHUQVHFWRUFRQWUDVWVDUHUHYHUVHG
,IVHYHUDODUHDVRIWKLVW\SHH[LVWRQWKHVDPHD[LVWKHGLDPHWHUWREH
PHDVXUHGFRUUHVSRQGVWRWKHDUHDIXUWKHVWIURPWKHFHQWHU
$VWKHHIIHFWLYHIRFDOVSRWLVQRWDSHUIHFWVTXDUHWKHGLDPHWHUYDOXHLVQRW
WKHVDPHRQERWKD[HV7KHKLJKHUYDOXHVKRXOGEHUHWDLQHG
 1RWHWKH'YDOXHVWREHDSSOLHGWRWKHIROORZLQJIRUPXODV VWHSVWKURXJK 

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG FOCAL SPOT RESOLUTION LIMIT -RE&DUG;30± RI

&DOFXODWLQJ)RFDO6SRW'LPHQVLRQV
 8VHWKHIRUPXODEHORZWRFDOFXODWHWKHGLPHQVLRQRIWKHPPIRFDOVSRW 
SDWWHUQ
'
)   
[ 0±
DQGUHFRUGWKHUHVXOWREWDLQHGLQ0DPPR'DWD6KHHW
 &DOFXODWHWKHGLPHQVLRQVRIWKHPPIRFDOVSRWLQWKHVDPHZD\ SDWWHUQ
'
)   
[ 0±
DQGUHFRUGWKHUHVXOWREWDLQHGLQ0DPPR'DWD6KHHW
 ,Q_6WDU3DWWHUQXVHWKHIROORZLQJIRUPXOD
'
)   
[ 0±
DQGUHFRUGWKHUHVXOWREWDLQHGLQ0DPPR'DWD6KHHW
7KHJHQHULFIRUPXODZKHUH
) IRFDOVSRWVL]H
' EOXUULQJGLDPHWHU
0 PDJQLILFDWLRQIURPSDWWHUQWRILOP
 VWDUSDWWHUQDQJOHLQGHJUHHV
'
) 
  ; 0±
p

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG FOCAL SPOT RESOLUTION LIMIT -RE&DUG;30± RI

'HFLVLRQV $OO6\VWHPV
 /DUJHIRFDOVSRW PP LIWKHHIIHFWLYHIRFDOVSRWGLPHQVLRQPHDVXUHGH[FHHGV
PPFRQVXOWZLWKFXVWRPHUDERXWUHSODFHPHQWRI;±UD\WXEH
 6PDOOIRFDOVSRW PP LIWKHHIIHFWLYHIRFDOVSRWGLPHQVLRQPHDVXUHGH[FHHGV
PPFRQVXOWZLWKFXVWRPHUDERXWUHSODFHPHQWRI;±UD\WXEH
 %HORZLVDFKDUWUHIHUHQFLQJIRFDOVSRWOHQJWKFRUUHFWLRQVQHHGHGZKHQPHDVXULQJ
WKHIRFDOVSRWZLWKWKHWHVWLQJDSSDUDWXVSODFHGDWWKHFKHVWZDOO LHSLQKROH
FDPHUDVOLWFDPHUDRUVWDUSDWWHUQSODFHGDWWKHFKHVWZDOOZKHQQRWXWLOL]LQJWKHVWDU
SDWWHUQKROGHU 7KHVHFRUUHFWLRQIDFWRUVGRQRWDSSO\WRWKHIRFDOVSRWZLGWK
PHDVXUHPHQW

System Focal Spot A B T Correct Factor


'05 /DUJH    
'05 6PDOO    
 /DUJH    
 6PDOO ±   

$ WDUJHWDQJOH
% UHIHUHQFHD[LVDQJOH
7 WLOWDQJOH
Note: For non–GE systemsUHIHUWR2(0VSHFLILFDWLRQVDQGWROHUDQFHV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

0$002*5$3+< -RE&DUG;30± RI

MREFDUG CALCULATION OF AVERAGE GLANDULAR DOSE

VXEDVVHPEO\ 0$002*5$3+< GDWH

SXUSRVH 3HUIRUPRQO\LIUHTXLUHGE\VWDWHUHJXODWLRQV WLPHPLQ

TOOLS REQUIRED
50,3KDQWRP
5DGLDWLRQPHWHUZLWKPDPPRSUREH
P$VPHWHU
$OXPLQXPILOWHUNLW±*

TASK DESCRIPTION
&$/&8/$7,212)$9(5$*(*/$1'8/$5'26(
7KHIROORZLQJWDEOH 7DEOH WDNHQIURPWKH$&50DPPRJUDSK\4XDOLW\&RQWURO0DQXDO
SDJHVKDOOEHXVHGWRFDOFXODWHWKHHVWLPDWHGDYHUDJHJODQGXODUGRVHIRUWKH
FUDQLGFDXGDGSURMHFWLRQLQ\RXUIDFLOLW\DIWHUWKHIUHH±LQ±DLUH[SRVXUHPHDVXUHPHQWV
KDYHEHHQPDGH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG CALCULATION OF AVERAGE


GLANDULAR DOSE -RE&DUG;30± RI

7$%/(
GLANDULAR DOSE (IN MRAD) FOR 1 ROENTGEN ENTRANCE EXPOSURE
4.2 CM BREAST THICKNESS – 50% ADIPOSE/50% GLANDULAR BREAST TISSUE
Mo/Mo Target–Filter X–Ray Tube Voltage (kVp) W/Al Target-
g
Filt
Filter
HVL 23 24 25 26 27 28 29 30 31 32 33 Combination

 
  
   
    
     
      
       
         
          
            
            
            
           
          
         
        
       
      
     
    
   
  
 

([DPSOH
 7KHIUHH±LQ±DLUH[SRVXUHPHDVXUHPHQWDWFPZDVPHDVXUHGWREHP5DW
N9S
 7KHV\VWHPKDVDPRO\EGHQXPWDUJHWDQGDQ+9/HTXLYDOHQF\RIPP$O
 7KHFRPSUHVVHGEUHDVWWKLFNQHVVLVFP
 7DEOHVKRZVWKHUHODWLRQVKLSEHWZHHQDYHUDJHJODQGXODUGRVHSHUXQLWH[SRVXUH
LQDLU UDG5RHQWJHQ 7KHUHIRUH
5 UDG P5DGSURMHFWLRQLVWKHDYHUDJH
P5; ; JODQGXODUGRVHUHFHLYHGE\WKHSDWLHQW
P5 5

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG CALCULATION OF AVERAGE


GLANDULAR DOSE -RE&DUG;30± RI

'(7(50,1,1*$9(5$*(*/$1'8/$5'26(21$(&(48,33('6<67(06
Equipment set–up:
,QVWDOOWKH[EXFN\ ZLWKWKH[GLDSKUDJPLIDSSOLFDEOH 
)RUWKH'05DQG77GLVDEOHDXWRGHFRPSUHVVLRQ
3ODFHWKHLPDJHUHFHSWRUDWPD[LPXP6,'
3RVLWLRQWKHSKRWRFHOOXQGHUWKHFHQWHURIWKH50,SKDQWRPZLWKWKHSKDQWRPVKLIWHGVOLJKWO\
WRWKHOHIWRIWKHLPDJHUHFHSWRUWRDOORZSURSHUSODFHPHQWRIWKHUDGLDWLRQSUREH
(QVXUHWKDWWKHSKDQWRPLVFRYHULQJWKH$(&VHQVRU VHH,OOXVWUDWLRQ 
3ODFHWKHPDPPRUDGLDWLRQSUREHFPLQIURPWKHFKHVWZDOOHGJHRIWKHLPDJHUHFHSWRU
ZLWKWKHUHGOLQHRIWKHSUREHFHQWHUHGWRWKHWRSRIZD[LQVHUW DSLHFHRIIRDPFDQ
EHXVHGWRSODFHXQGHUWKHSUREHIRUHDVHRIVHWXS %ULQJSDGGOHLQWRFRQWDFWZLWK
WKHSUREH VHH,OOXVWUDWLRQ 
7XUQFROOLPDWRUODPSRQWRHQVXUHWKHOLJKWILHOGLVFRYHULQJWKHHQWLUHSKDQWRPDQGSUREH
)RUV\VWHPVQRWHTXLSSHGZLWKDP$VPHWHULQVWDOODPHWHULQRUGHUWRUHFRUGWKHP$V
&DOFXODWHWKHKDOIOD\HURIWKH[±UD\EHDPXWLOL]LQJWKHDOXPLQXPILOWHUNLWDQGZLWKN9S
DQG0202WDUJHWILOWHUFRPELQDWLRQ7KLVLVGHWHUPLQHGE\WKHDPRXQWRIDGGLWLRQDO
DOXPLQXPILOWUDWLRQSODFHGLQWKH[±UD\EHDPWRUHGXFHWKHRXWSXWH[SRVXUHUDWHE\
5HFRUGWKHUHVXOWVLQWKH0DPPRJUDSK\'DWD5HFRUGVKHHW
&RPPDQGDQH[SRVXUHDWWKHQRPLQDON9SWRGHWHUPLQHWKHH[SRVXUHUDWHYDOXHRID
DYHUDJHFRPSUHVVHGFPEUHDVW 50,SKDQWRP 
8VH7DEOHDQGWKHIRUPXODLQWKH([DPSOHDERYHWRFDOFXODWHWKHDYHUDJHJODQGXODUGRVH
5HFRUGWKHUHVXOWVLQWKH0DPPRJUDSK\'DWD5HFRUGVKHHW
,//8675$7,21 
BREAST ENTRANCE EXPOSURE

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

*(1(5$725&$/,%5$7,21 -RE&DUG;30± RI

MREFDUG GENERATOR CALIBRATION – MAMMO

VXEDVVHPEO\ 0$002 GDWH

SXUSRVH *HQHUDWRUFDOLEUDWLRQ WLPHKRXU

PREREQUISITES
7RROVUHTXLUHG 6WRUDJHVFRSH
)OXNH'90
P$VPHWHU
.HLWKOH\'LYLGHURUHTXLYDOHQWQRQ±LQYDVLYHN9SGHYLFH
50,0DPPR'LYLGHURUHTXLYDOHQWQRQ±LQYDVLYHN9SGHYLFH
&RD[LDOFDEOH
%1&WREDQDQDMDFNDGDSWHU IRU)OXNH
TASK DESCRIPTION
KVP
9HULI\.93¶VXWLOL]LQJHLWKHUProcedure # 150,0DPPR'LYLGHURUProcedure # 2SHU
.HLWKOH\DSSOLFDWLRQQRWH.±
NOTE:,IDQ\SUREOHPVDUHHQFRXQWHUHGRUWKHUHVXOWVDUHTXHVWLRQHGUHIHUWRWKH
DSSURSULDWHVHUYLFHPDQXDOXVLQJWKH+9EOHHGHU

MA/MAS
2QWKH6HQL['05FRQQHFWWKHP$VPHWHULQSODFHRIWKHP$MXPSHUORFDWHGRQWKH+9
7UDQVIRUPHU3&%RDUG
2QWKH77FRQQHFWWKHP$VPHWHUWR73DQG73HQVXULQJWRUHPRYHVWUDS
6.RQ3&%RDUG3/
2QWKH77SKDVHV\VWHPVFRQQHFWWKHP$VPHWHULQWKHP$PDNHEUHDNMDFNV
ORFDWHGLQWKHFKDVVLVRQWKHIURQWRIWKHXQLW
6HOHFWN9SDQGSHUIRUPH[SRVXUHVDWP$VP$VP$VP$VDQGP$V
5HFRUGWKHUHVXOWVLQWKH0DPPRJUDSK\'DWD5HFRUG6KHHW
Specifications:
SENOGRAPH 3 PHASE
±N93 N9S
±P$V P$V
SENIX HF / 700T / 800T / DMR
±N9S N9S
±P$V P$V

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG GENERATOR CALIBRATION – MAMMO -RE&DUG;30± RI

PROCEDURE # 1
KVP MEASUREMENTS WITH RMI 232
RMI 232 Setup:

 ,QVWDOOPHWHUDVSHU,OOXVWUDWLRQ
 3HUIRUPH[SRVXUHVDWDQGN9SP$VDQGUHFRUGWKHUHVXOWVLQWKH
30'DWD5HFRUG6KHHW

PROCEDURE # 2
Application Note
KVP MEASUREMENTS WITH THE KEITHLEY MODEL 35080
1R.±5(9
7KHIROORZLQJSURFHGXUHLVGHWDLOHGVRWKHILUVW±WLPHXVHUFDQDFKLHYHJRRGUHVXOWV$Q
H[SHULHQFHGXVHUZLOOEHDEOHWRWDNHPDQ\VKRUWFXWV7KHZLWKWKHPDPPR
N9SRSWLRQLVIRUXVHRQPRO\EGHQXPDQRGHEHU\OOLXPZLQGRZWXEHVRQO\
,//8675$7,21  ,//8675$7,21 
SETUP 35080 REPOSITION 35080

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG GENERATOR CALIBRATION – MAMMO -RE&DUG;30± RI

K–EDGE MEASUREMENT
35080 Divider Setup

 5HPRYHWKHFRQH
 5HPRYHWKHFRPSUHVVLRQSDGGOHWXUQLWXSVLGHGRZQDQGUH±LQVWDOO
 2QWKH77DQG'05GLVDEOHWKHDXWRGHFRPSUHVVLRQLQWKHPDLQWHQDQFHPHQX
 3ODFHWKH ZLWK.±HGJHILOWHUSDFN RQWRSRIWKHFRPSUHVVLRQSDGGOHDVFORVHDV
SRVVLEOHWRWKH;±UD\WXEH
 /HYHOWKH 7KHPXVWEHDWULJKWDQJOHVWRWKHWXEHD[LV6HH,OOXVWUDWLRQ

Oscilloscope Setup

 &RQQHFWWKHWRWKHVFRSHXVLQJDVKLHOGHGFDEOH
 6HWWKHYHUWLFDOVHQVLWLYLW\WRYROWVSHUGLYLVLRQ
 :LWKWKHLQSXWLQWKH*5281'SRVLWLRQDGMXVWWKHYHUWLFDOSRVLWLRQFRQWUROWRSODFHWKH
WUDFHRQWKHERWWRPJUDWLFXOHOLQH
 6HWWKHVFRSHXSLQWKHVLQJOHWUDFHVWRUDJHPRGH
 3ODFHWKHLQSXWVHOHFWRUVZLWFKLQWKH'&SRVLWLRQ

Fluke 87 DVM Setup


 &RQQHFWWKHWRWKH)OXNHYROWDJHLQSXWXVLQJD%1&WREDQDQDMDFNDGDSWHUDQGD
VKLHOGHGFDEOH
 6HOHFWWKHYROWUDQJHRQWKH)OXNH'90 do not use the auto range function 
 6HWWKH)OXNHLQWRPVUHFRUGPRGH SXVKDQGKROGWKHPLQ±PD[EXWWRQXQWLODWRQHLV
KHDUG 
 3UHVVWKHPLQ±PD[EXWWRQLQRUGHUWRGLVSOD\WKHPD[IXQFWLRQRQWKH'90GLVSOD\
NOTE: :KHQXVLQJWKH)OXNH'90LQWKHPLQ±PD[IXQFWLRQHDFKSURJUHVVLYH
UHDGLQJPXVWEHJUHDWHUWKDQWKHSULRULQRUGHUIRUWKHPHWHUWRFDSWXUHDKLJKHUPD[
LQSXW7KHUHIRUHLIDQH[SRVXUHLVUHSHDWHGDWWKHVDPH.93RUWKHQH[WH[SRVXUHLVDWD
ORZHU.93WKDQWKHSULRUH[SRVXUHWKHPVUHFRUGPRGHPXVWEHH[LWHGWKHQ
UHHQWHUHGRQWKH)OXNHPHWHUDJDLQHQVXUHWKHPHWHULVQRWLQWKHDXWRUDQJHPRGH
K–Edge Measurement Procedure
Part A

 6HWWKH;±UD\JHQHUDWRUIRUN9SDQG±P$V
 6HOHFWWKH0R PRO\EGHQXP ILOWHU
 0DNHDQH[SRVXUH
 0HDVXUHWKHSHDNYROWDJHDQGUHFRUGLQER[$RQWKHDFFRPSDQ\LQJGDWDVKHHW

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG GENERATOR CALIBRATION – MAMMO -RE&DUG;30± RI

Part B

 6HWWKHJHQHUDWRUIRUN9SDQGPDNHDQH[SRVXUH
 5HFRUGWKLVYROWDJHYDOXHLQER[%RQWKHGDWDVKHHW 7KHYROWDJHYDOXHV$DQG%
VKRXOGEHHTXDOWRZLWKLQ9LIVRWKLVZLOOEH\RXU³%$6(92/7$*(´LIQRWWKHQ
UHSHDWWKHDERYHVWHSVDWRQHN9SORZHU

Part C

 6HWWKHJHQHUDWRUIRUN9SPDNHDQH[SRVXUH
 0HDVXUHWKHSHDNYROWDJH ,IWKLVYROWDJHLVJUHDWHUWKDQWKH³%$6(92/7$*(´E\9
EXWQRWJUHDWHUWKDQ9DERYHWKH³%$6(92/7$*(´UHFRUGLQER[&,IWKHYROWDJH
LVJUHDWHUWKDQYROWVDERYHWKH³%$6(92/7$*(´UHSHDWWKLVVWHSDWRQHN9SORZ
HU,IWKHYROWDJHLVQRWJUHDWHUWKDQWKH³%$6(92/7$*(´E\YROWVUHSHDWWKLVVWHS
DWRQHN9SKLJKHU

Part D
5HSHDWWKHODVWPHDVXUHPHQWWRYHULI\WKDWWKHJHQHUDWRULVUHSHDWDEOH7KHYROWDJHUHDGLQJ
VKRXOGUHSHDWWRZLWKLQ9,IWKHUHDGLQJLVQRWUHSHDWDEOHWKHJHQHUDWRUQHHGV
VHUYLFH

Part E

 6XEWUDFWWKH³%$6(/,1(´YROWDJHIURPWKHYROWDJHPHDVXUHGLQ3DUW&VWHS ER[& 
 0XOWLSO\WKLVYROWDJHE\DGGWRDQGUHFRUGLQER[' 7KLVLVWUXHN9SIRUWKLVVWD
WLRQ
PROCEED TO LINEAR MEASUREMENT –
DO NOT CHANGE THE GENERATOR SETTINGS

LINEAR MEASUREMENT
35080 Divider Setup

 5HSODFHWKH.±('*(ILOWHUSDFNZLWKWKH/,1($5ILOWHUSDFN
 5HSRVLWLRQWKHWRDSSUR[LPDWHO\LQFKHVIURPWKHIRFDOVSRW VHH,OOXVWUDWLRQ 

Oscilloscope Setup

 6HWWKHYHUWLFDOVHQVLWLYLW\WRYROWVSHUGLYLVLRQ
 :LWKWKHLQSXWVZLWFKLQWKH*5281'SRVLWLRQXVHWKHYHUWLFDOSRVLWLRQFRQWUROWRSODFH
WKHWUDFHRQWKHERWWRPJUDWLFXOHOLQH
 6HWVFRSHIRUVLQJOHVZHHSVWRUDJHPRGH
DQGLQWKH'&LQSXWPRGH ,OOXVWUDWLRQVDQGVKRZKRZWRUHDGWKHZDYHIRUPV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG GENERATOR CALIBRATION – MAMMO -RE&DUG;30± RI

,//8675$7,21  ,//8675$7,21 

,//8675$7,21  ,//8675$7,21 

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG GENERATOR CALIBRATION – MAMMO -RE&DUG;30± RI

Fluke 87 DVM Setup

 &RQQHFWWKHWRWKH)OXNHYROWDJHLQSXWXVLQJD%1&WREDQDQDMDFNDGDSWHUDQGD
VKLHOGHGFDEOH
 6HOHFWWKHYROWUDQJHRQWKH)OXNH'90 Do not use the auto range function 
 6HWWKH)OXNHLQWRPVUHFRUGPRGH SXVKDQGKROGWKHPLQ±PD[EXWWRQXQWLODWRQHLV
KHDUG 
 3UHVVWKHPLQ±PD[EXWWRQLQRUGHUWRGLVSOD\WKHPD[IXQFWLRQRQWKH'90GLVSOD\
NOTE::KHQXVLQJWKH)OXNH'90LQWKHPLQ±PD[IXQFWLRQHDFKSURJUHVVLYHUHDG
LQJPXVWEHJUHDWHUWKDQWKHSULRULQRUGHUIRUWKHPHWHUWRFDSWXUHDKLJKHUPD[LQSXW
7KHUHIRUHLIDQH[SRVXUHLVUHSHDWHGDWWKHVDPHN9SRUWKHQH[WH[SRVXUHLVDWDORZHU
N9SWKDQWKHSULRUH[SRVXUHWKHPVUHFRUGPRGHPXVWEHH[LWHGWKHQUHHQWHUHGRQ
WKH)OXNHPHWHU$JDLQHQVXUHWKHPHWHULVQRWLQWKHDXWRUDQJHPRGH

Linear Measurement Procedure


Part A

 :LWKWKHJHQHUDWRUVHWWLQJVXVHGIRU.±('*(PHDVXUHPHQWDERYHPDNHDQH[SRVXUH
 5HFRUGWKHYROWDJHLQER[(WKHQPXOWLSO\WKHYROWDJHLQER[(E\DQGUHFRUGDV
.93LQER[)
Part B

 6XEWUDFWWKHN93LQER[)IURPWKH.93LQER[' 7KLVZLOOEHWKH³&255(&7,21
9$/8(´DSSOLHGWRDOO.93PHDVXUHPHQWVPDGHZLWKWKH/,1($5),/7(5SDFN
 ,QVHUWWKLVYDOXHLQDOOVSDFHVLQWKHFROXPQODEHOHG³&255(&7,219$/8(´
127(7KLVYDOXHPD\EHHLWKHUSRVLWLYHRUQHJDWLYH
Part C

 0HDVXUHRWKHU.93YDOXHVDVGHVLUHG
 (QWHUWKHYROWDJHLQWKH³/,1($592/7$*(´FROXPQRQWKHGDWDVKHHWPXOWLSO\E\
 (QWHUWKH.93YDOXHLQWKH³/,1($5.93´FROXPQ
 $SSO\WKH&255(&7,219$/8(WRDOON9S¶VE\HLWKHUDGGLQJWRRUVXEWUDFWLQJIURPWKH
³/,1($5.93´FROXPQDQGUHFRUGWKHUHVXOWVLQWKH³&255(&7('.93´FROXPQ 7KLV
FROXPQQRZKDVWKHWUXHN9SYDOXHIRUDOON9S¶VPHDVXUHG
Part D

,IWKHSRVLWLRQRIWKHFKDQJHVGXULQJWKHOLQHDUN9SPHDVXUHPHQW\RXPXVWUHSHDW
WKHPHDVXUHPHQWVWDUWLQJZLWK3DUW&VRPHRIWKHFRUUHFWLRQYDOXHLVSRVLWLRQDOGHSHQ
GHQW

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG GENERATOR CALIBRATION – MAMMO -RE&DUG;30± RI

Model 35080 Mammographic Worksheet


(Example)

Set K Edge
K–Edge True Linear Linear Correction Corrected
kVp Voltage kVp Voltage kVp Value kVp
 ² ²    
 ² ²    
 ² ²    
 (A)     
 (B)  ²    
 ² ²    
 ² ²    
 (C)  (D)  (E)  (F)   
 ² ²    
 ² ²    
 ² ²    
 ² ²    
 ² ²    
 ² ²    
 ² ²    

NOTE: For non–GE systemsXVH2(0VSHFLILFGRFXPHQWDWLRQLIUHTXLUHG

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG GENERATOR CALIBRATION – MAMMO -RE&DUG;30± RI

Model 35080 Mammographic Worksheet

Set K Edge
K–Edge True Linear Linear Correction Corrected
kVp Voltage kVp Voltage kVp Value kVp
 ² ²
 ² ²
 ² ²
 (A) ²
 (B) ²
 ² ²
 ² ²
 (C) (D) (E) (F)

 ² ²
 ² ²
 ² ²
 ² ²
 ² ²
 ² ²
 ² ²

NOTE: For non–GE systemsXVH2(0VSHFLILFGRFXPHQWDWLRQLIUHTXLUHG

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

5$'02%,/(6 -RE&DUG;30± RI

MREFDUG RAD MOBILES – PLANNED MAINTENANCE

VXEDVVHPEO\ GDWH

SXUSRVH 7RSHUIRUPD3ODQQHG0DLQWHQDQFHRQD WLPH


UDGLRJUDSKLFSRUWDEOH[±UD\XQLW

Applies to:
5$'02%,/(6 3257$%/(6
Special Tools / Supplies:
+DQGWRROV9DFXXP5DJV'90/36RU673 OXEULFDQW 6FRSH)RUPXOD
 FOHDQLQJVROXWLRQ +9%OHHGHURU.HLWKOH\P$VPHWHURVFLOORVFRSH
UHIHUWR;30±
PREREQUISITES
1RQH
TASK DESCRIPTION
1.0 Brakes
9HULI\WKDWWKHEUDNHVRSHUDWHFRUUHFWO\DQGWKDWWKH\GRQRWJUDERUSXOOWKHXQLWWRRQHVLGH
ZKHQWKH\HQJDJH
2.0 Bumpers
9HULI\WKDWWKHUXEEHUEXPSHUPDWHULDOLVLQSODFHDQGWKDWLWLVLQJRRGFRQGLWLRQDURXQGWKH
XQLW
9HULI\WKDWWKHFROOLVLRQLQWHUORFNLVRSHUDWLRQDO
3.0 Safety
Care must be taken when working inside the column or with counterweight
CAUTION cables.

&RXQWHUZHLJKWFDEOHLQVSHFWLRQ
 5HPRYHWKHFDEOHLQVSHFWLRQSRUWFRYHUDWWKHEDVHRIWKHFROXPQLIDSSOLFDEOH
 5HPRYHWKHWULPFRYHUDWWKHWRSRIWKHFROXPQLIDSSOLFDEOH
 0RYHWKHKRUL]RQWDOPHPEHUFDUULDJHIURPRQHHQGRIWKHFROXPQWRWKHRWKHU&KHFN
ZLWKDUDJRIVRIWFORWKIRUIODZVLQWKHFDEOH$IWHUYHULI\LQJWKHFRQGLWLRQRIWKH
FDEOHVOXEULFDWH,IWKHUHDUHDQ\TXHVWLRQVFRQFHUQLQJFRXQWHUZHLJKWFDEOHVUHIHUWR
6HUYLFH1RWHLQ7DERIWKLVPDQXDO
 9HULI\FDEOHUHSODFHPHQWLIVSHFLILHGLQVHUYLFHPDQXDO
 &KHFNWKHPRXQWLQJEROWVIRUVHFXULW\WKDWKROGVWKHYHUWLFDOFROXPQLQSODFH
 &KHFNDOODVVHPEO\KDUGZDUHDQGEROWV
 &KHFNVDIHW\PHFKDQLVPRUVHFRQGDU\XQORDGHGFDEOHDVDSSOLFDEOH
 &KHFNFROXPQSDUNLQJODWFKDVVHPEO\DQGDQ\GULYHRUH[SRVXUHLQWHUORFNV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD MOBILES – PLANNED MAINTENANCE -RE&DUG;30± RI

4.0 Check drawer mounting


9HULI\WKDWWKHPRXQWLQJKDUGZDUHWKDWKROGVWKHGUDZHULQSODFHLVVHFXUHDQGDGMXVWHG
FRUUHFWO\VRWKDWWKHGRRURSHQVDQGFORVHVHDVLO\DQGZLOOQRWLQDGYHUWHQWO\IDOORXW
5.0 Verify motor drive
9HULI\WKDWWKHXQLWGULYHVSURSHUO\LQDOOGLUHFWLRQVIRUZDUG±UHYHUVHDQGWKDWLWWXUQVIUHHO\WR
WKHULJKWRUWKHOHIW
6.0 Inspection of the wheels and castors
&KHFNIRUQLFNVDQGRUIODWVSRWVRQWKHZKHHOVDQGFDVWHUVWKDWDUHH[FHVVLYH$OVRFKHFN
WKHZKHHOVIRUDQ\VWULQJFORWKRURWKHUPDWHULDOWKDWPD\KDYHEHFRPHZUDSSHG
DURXQGWKHP
&KHFNDOOPRXQWLQJKDUGZDUHWKDWKROGVWKHZKHHOVLQSODFHIRUWLJKWQHVV
/XEULFDWHLIQHFHVVDU\
7.0 Inspect handswitch
9HULI\WKDWDOOH[SRVXUHVZLWFKHVDUHIXQFWLRQDO
9HULI\WKDWUHOHDVLQJWKHH[SRVXUHVZLWFKWHUPLQDWHVWKHH[SRVXUH
8.0 Batteries
1L±&DG%DWWHULHV
&KHFNWKDWWKHEDWWHULHVKDYHKDGDQDQQXDOHTXDOL]DWLRQDQGFKHFNWKHIOXLGOHYHO
VHPL±DQQXDOO\9HULI\WKDWWKHEDWWHU\FKDUJHUWXUQVRIIDWWKHFRUUHFWYROWDJHVWDWHGLQ
WKHVHUYLFHPDQXDO
/HDG±$FLGDQG*HO&HOO%DWWHULHV
*HO&HOOEDWWHULHVGRQRWUHTXLUHDQQXDOHTXDOL]DWLRQDQGFKDUJHUVKXWRIIYROWDJHLV
HVWDEOLVKHGLQILUPZDUHRUVKRXOGEHFKHFNHGDFFRUGLQJWRWKHVHUYLFHPDQXDO6RPH
FKDUJHUVZRUNFRQWLQXRXVO\ZKHQSOXJJHGLQ
 &KHFNEDWWHU\WHUPLQDOVDQGZLUHV&OHDQDQ\FRUURVLRQWLJKWHQDQ\ORRVH
FRQQHFWLRQV
 &KHFNYROWDJHRIHDFKEDWWHU\DOOYROWDJHVVKRXOGEHQHDUO\WKHVDPHDEDWWHU\ZLWK
ORZHUYROWDJHPD\LQGLFDWHDVKRUWHGFHOORUIDLOLQJEDWWHU\
 3HUIRUPDFKDUJHUFDOLEUDWLRQVHTXHQFHDVGLUHFWHGLQWKHVHUYLFHPDQXDO&KHFNIRU
WKHRSHUDWLRQRIWKHH[KDXVWIDQGXULQJDEDWWHU\UHFKDUJHLVWKHXQLWKDVDIDQ
 ,IWKHEDWWHULHVDUHLQTXHVWLRQSHUIRUPDORDGWHVWDVGLUHFWHGLQWKHVHUYLFHPDQXDO
 .HHSXQLWSOXJJHGLQZKHQQRWLQXVH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD MOBILES – PLANNED MAINTENANCE -RE&DUG;30± RI

9.0 kVp and mAs

 ,QVWDOOWKH+9EOHHGHU RU.HLWKOH\ DQGYHULI\WKHN9SDWDQGRUKLJKHVW


VHOHFWDEOHN9S
 9HULI\WKHP$P$VE\LQVWDOOLQJDP$PHWHU RUP$VPHWHU LQWKHXQLWDQGUHDGLQJWKH
P$ RUP$V DVDSSOLFDEOH
 &KHFNWKHH[SRVXUHWLPHZLWKDVFRSHDQGYHULI\LWLVZLWKLQWKHDFFHSWDEOHOLPLWV,IWKHUH
DUHDQ\TXHVWLRQVUHIHUWRWKHVHUYLFHPDQXDO
 9HULI\WKDWWKHILODPHQWYROWDJHLVRSWLPL]HGDVVKRZQLQ,OOXVWUDWLRQ
MA WAVEFORM
Upper Trace: Filament voltage too high
and regulator pulling down or filament
voltage normal but regulator pulling
down improperly.
Center Trace: Filament voltage correct
and mA regulator adjusted correctly.

Lower Trace: Filament voltage too low


and mA regulator pulling up or
filament voltage normal but regulator
pulling up improperly.

NOTE:2QVRPHV\VWHPVP$DQGWLPHDUHQRWPHDQLQJIXOWRPHDVXUH9HULI\WKHP$V
PHWHU P$VWLPHU FDOLEUDWLRQDVGLUHFWHGLQWKHVHUYLFHPDQXDO

10.0 Phototimer

 3RVLWLRQWKH[±UD\WXEHLQFKHVDERYHWKHIORRU
 3ODFHWKHFDVVHWWHRQWKHIORRUFHQWHUHGLQWKHH[SRVXUHDUHDZLWKRQHVKHHWRIFRSSHU
DQGRQHVKHHWRIDOXPLQXP DOWHUQDWHO\HLWKHULQFKHVRIZDWHURULQFKHVRIDFU\OLF
DERYHWKHSUREHRQWRSRIWKHFDVVHWWH
 6HOHFWN9SDQGP$VDVDEDFNXS
 ([SRVHWKHFDVVHWWHDQGSURFHVVWKHILOP
 5HFRUGWKHGHQVLW\LQWKHGDWDVKHHWV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD MOBILES – PLANNED MAINTENANCE -RE&DUG;30± RI

OEM additional procedures:

 6LHPHQVSURGXFWV0RELOHWW0RELOHWW,,3OXV;7 1.0v = 15 kV 
 9HULI\WKHUXEEHUEXPSHUPDWHULDOLVLQWDFWZKLFKKROGVWKH[±UD\WXEHDVVHPEO\LQSDUN
SRVLWLRQ
 &KHFNH[SRVXUHWLPHDWRIKLJKWHQVLRQPHDVXUHGRQ'ERDUGWHVWSRLQW³.9´
&KHFNWKHIROORZLQJVHWWLQJV
.9 P$V 7 PV
40 10.0 27
85 8.0 28
90 100.0 640
133 3.2 19
 &KHFNDQGWLJKWHQDOOWHUPLQDOVWULSFRQQHFWLRQV
 &KHFNVZLYHOORFNPHFKDQLVPDWWKH[±UD\WXEHDVVHPEO\IRUSURSHURSHUDWLRQ
 CAUTION: When within proximity of capacitor discharge banks – contained within
the main body – use the discharge switch S10 to discharge these capacitors. The
capacitors will hold a charge indefinitely. Turn S10 discharge to normal position
(OFF) after service, otherwise error #16.
Unit Capacitor banks discharge in 12 minutes. Measure at TP.D7 + and –.
$IWHUFDSDFLWRUVDUHGLVFKDUJHGSXOORXWWKHPRGXOHVDQGFKHFNIRUEORZQFDSDFLWRUIXVHV
CAUTION: If a capacitor fuse is blown, the capacitor section is fully charged.
 &DOLEUDWLRQRIJHQHUDWRULVSHUIRUPHGDFFRUGLQJWR,QVWDOODWLRQDQG$GMXVWPHQWLQVWUXF
WLRQV 5± DQG 6HUYLFH LQVWUXFWLRQV 5±

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD MOBILES – PLANNED MAINTENANCE -RE&DUG;30± RI

Notes:

LVHUYLFHVZLWFKDVVHPEO\XQGHU&38FRYHURQ'ERDUG
1RUPDOFRQILJXUDWLRQ

On Off
1 16
service switch 1 normally off
switch 2 on
switch 3 on
tryout switch 4 normally off
i16 switch 5 on
switch 6 off
switch 7 off
switch 8 off

8 9

6HUYLFHVZLWFK7U\RXWSURJUDPV Most useful


SURJUDPLVILODPHQWFLUFXLW checks CPU function
SURJUDPLV$±'FRQYHUWHUDQG08;GHFLPDO
SURJUDPLV$±'FRQYHUWHUDQG08;KH[DGHFLPDO
SURJUDPLVFDSDFLWRUFKDUJLQJDQGPHDVXULQJFLUFXLW checks ca.p charging
SURJUDPLVGLVSOD\FLUFXLW checks displays
SURJUDPLVPRQLWRULQJFLUFXLWIRUGLVSOD\ checks displays
SURJUDPLVUHDGRXWRI5$0GDWD
SURJUDPLVPHPRU\IRUHUURUDQGV\PEROFRGHV error codes for service
SURJUDPLVHUDVLQJWKHHUURUPHPRU\FRQWHQWV error erase after
service
SURJUDPLVFDSDFLWRUIRUPDWLRQ CAUTION – see below
do not use program 10 unless unit has been out of service for a long time
NOTE:(QVXUHVHUYLFHDQGDUHVZLWFKHGEDFNWRQRUPDODIWHUVHUYLFH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD MOBILES – PLANNED MAINTENANCE -RE&DUG;30± RI

7KLVSDJHLQWHQWLRQDOO\OHIWEODQN

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

RADIOGRAPHIC PORTABLES
TABLE OF CONTENTS

JOB CARD TITLE PAGE

;30± 5$'02%,/(6  ±

;30± )/825202%,/(6  ±

±L
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

7+,63$*(,17(17,21$//</()7%/$1.

±LL
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

5$',2*5$3+,&3257$%/(6 -RE&DUG;30± RI

MREFDUG RAD MOBILES

VXEDVVHPEO\ 5$'02%,/(6 GDWH

SXUSRVH 7RSHUIRUPD30RQDUDGLRJUDSKLFSRUWDEOH WLPHKRXUV

PREREQUISITES
+DQGWRROV 9DFXXP
5DJV '90
/36RU673 OXEULFDQW 6FRSH
)RUPXOD FOHDQLQJVROXWLRQ +9%OHHGHU

TASK DESCRIPTION
1.0 Brakes
9HULI\WKDWWKHEUDNHVRSHUDWHFRUUHFWO\DQGWKDWWKH\GRQRWJUDERUSXOOWKHXQLWWR
RQHVLGHZKHQWKH\HQJDJH

2.0 Bumpers
9HULI\WKDWWKHUXEEHUEXPSHUPDWHULDOLVLQSODFHDQGWKDWLWLVLQJRRGFRQGLWLRQ
DURXQGWKHXQLW
9HULI\WKDWWKHFROOLVLRQLQWHUORFNLVRSHUDWLRQDOZKHUHDSSOLFDEOH

3.0 Safety
CAUTION: Care must be taken when working inside the column or with
counterweight cables. For non–GE systems, refer to XPM–750 para 3.0.
&RXQWHUZHLJKWFDEOHLQVSHFWLRQ$0;±,, ,,,6WHSV $0;±
$0;±6WHSV 
 5HPRYHWKHFDEOHLQVSHFWLRQSRUWFRYHUDWWKHEDVHRIWKHFROXPQ
 5HPRYHWKHWULPFRYHUDWWKHWRSRIWKHFROXPQLIDSSOLFDEOH
 0RYHWKHKRUL]RQWDOPHPEHUFDUULDJHIURPRQHHQGRIWKHFROXPQWRWKHRWKHU
&KHFNZLWKDUDJRUVRIWFORWKIRUIODZVLQWKHFDEOH$IWHUYHULI\LQJWKH
FRQGLWLRQRIWKHFDEOHVOXEULFDWH,IWKHUHDUHDQ\TXHVWLRQVFRQFHUQLQJ
FRXQWHUZHLJKWFDEOHVUHIHUWR6HUYLFH1RWHLQ6HFWLRQ
 9HULI\FDEOHUHSODFHPHQW\HDULQWHUYDOIRU$0;±,,,,,
 9HULI\FDEOHUHSODFHPHQW\HDULQWHUYDOIRU$0;± $0;±
 &KHFNWKHPRXQWLQJEROWVIRUVHFXULW\WKDWKROGVWKHYHUWLFDOFROXPQLQSODFH
2QWKH$0;±,,DQG,,,WKHUHDUHVL[EROWVXQGHUQHDWKWKHXQLWWKDWKHOS
KROGWKHYHUWLFDOFROXPQLQSODFHWKDWPXVWEHFKHFNHG
 &KHFNVDIHW\PHFKDQLVPRQ$0;±,, ,,,
 &KHFNVHFRQGDU\XQORDGHGFDEOHRQ$0;± $0;±

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD MOBILES -RE&DUG;30± RI

4.0 Check drawer mounting (where applicable)


9HULI\WKDWWKHPRXQWLQJKDUGZDUHWKDWKROGVWKHGUDZHULQSODFHLVVHFXUHDQG
DGMXVWHGFRUUHFWO\VRWKHGRRURSHQVDQGFORVHVHDVLO\DQGZLOOQRW
LQDGYHUWHQWO\IDOORXW
5.0 Verify motor drive
9HULI\WKDWWKHXQLWGULYHVSURSHUO\LQDOOGLUHFWLRQVIRUZDUG±UHYHUVHDQGWKDWLWWXUQV
IUHHO\WRWKHULJKWRUWKHOHIW
1RWDSSOLFDEOHWR90;DQGRWKHUPDQXDOO\SURSHOOHGPRELOHXQLWV

6.0 Inspection of the wheels and casters


&KHFNIRUQLFNVDQGRUIODWVSRWVRQWKHZKHHOVDQGFDVWHUVWKDWDUHH[FHVVLYH$OVR
FKHFNWKHZKHHOVIRUDQ\VWULQJFORWKRURWKHUPDWHULDOWKDWPD\KDYH
EHFRPHZUDSSHGDURXQGWKHP
&KHFNDOOPRXQWLQJKDUGZDUHWKDWKROGVWKHZKHHOVLQSODFHIRUWLJKWQHVVOXEULFDWHLI
QHFHVVDU\
9HULI\WKHIURQWFDVWHUVRIWKH$0;±DUHOXEULFDWHG

7.0 Inspect handswitch


9HULI\WKDWDOOH[SRVXUHVZLWFKHVDUHIXQFWLRQDO
9HULI\WKDWUHOHDVLQJWKHH[SRVXUHVZLWFKWHUPLQDWHVWKHH[SRVXUH
,QVSHFWKDQGVZLWFKFDEOHIRUFRQGLWLRQVFKHGXOHUHSODFHPHQWDVQHFHVVDU\

8.0 Batteries
NOTE: For non–GE systemsUHIHUWR;30±SDUD
1RWDSSOLFDEOHWR90;DQGRWKHUPDLQVSRZHUHGPRELOHXQLWV
$0;±,,DQG,,,ZLWK1L±&DG%DWWHULHV
&KHFNWKDWWKH\KDYHKDGDQDQQXDOHTXDOL]DWLRQDQGFKHFNWKHIOXLGOHYHO
VHPL±DQQXDOO\9HULI\WKDWWKHEDWWHU\FKDUJHUWXUQVRIIDW9'&
$0;± $0;±
*HOFHOOEDWWHULHVGRQRWUHTXLUHDQQXDOHTXDOL]DWLRQDQGFKDUJHUVKXWRIIYROWDJHLV
HVWDEOLVKHGLQILUPZDUH
3HUIRUPDFKDUJHUFDOLEUDWLRQVHTXHQFHLQWKHVHUYLFHPRGH
(QWHUVHUYLFHPRGHYLDWKHVHUYLFHVZLWFKDQGF\FOLQJSRZHU
(1'6(59&02'(VKRXOGEHGLVSOD\HG
3UHVV.93XSXQWLOFDOLEUDWHV\VWHPLVGLVSOD\HG
3UHVV0$6GRZQWKHQ.93XSXQWLOFDOEDWFKDUJHULVGLVSOD\HG
)ROORZWKH$0;±FDOLEUDWLRQGLUHFWLRQIRUFKDUJHUFDOLEUDWLRQSURFHGXUH±RQWKH
IROORZLQJSDJH
&KHFNIRUWKHRSHUDWLRQRIWKHH[KDXVWIDQGXULQJDEDWWHU\UHFKDUJHLIWKHXQLWKDVD
IDQ
,IWKHEDWWHULHVDUHLQTXHVWLRQSHUIRUPDORDGWHVWDVIROORZV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD MOBILES -RE&DUG;30± RI

$0;±,, ,,,ZLWK*(*HO&HOO.LWV
*HOFHOOEDWWHULHVGRQRWUHTXLUHDQQXDOHTXDOL]DWLRQ
5HIHUWRXSJUDGHGLUHFWLRQVIRUYHULILFDWLRQRISURSHUFKDUJHUVKXW±RII
.HHSXQLWSOXJJHGLQZKHQQRWLQXVH
&KHFNEDWWHU\FDSDFLW\XVLQJWKH$0;±EDWWHU\FDSDFLW\WHVWRQIROORZLQJSDJHV

Calibrate Charger (AMX–4 & AMX–4+)


DO NOT FDOLEUDWHFKDUJHUZKHQEDWWHULHVDUHIXOO\FKDUJH
7KLVSURFHGXUHVHWVWKHEDWWHU\FKDUJLQJUDWH&KDUJHUDWHLVVHWDWWZRYROWDJHVPHDVXUHG
DFURVVUHVLVWRU$0;$55HIHUHQFH$SSHQGL[RI'LUHFWLRQ±IRUVLGH
FRYHUUHPRYDO

 3UHVVHLWKHU kVp Y RUkVp B XQWLOWKHSURPSWCAL BATT CHARGER


GLVSOD\VWKHQSUHVV mAs B
7KHSURPSWFKDQJHVWR PLUG IN CHARGER LQGLFDWLQJWKDWWKHEDWWHU\FKDUJH
PXVWEHSOXJJHGLQWRDFRQYHQLHQFHRXWOHW
 7RH[LWCAL BATT CHARGER ZLWKRXWFKDQJLQJDQ\YDOXHVSUHVV mAs Y
7KHSURPSWFKDQJHVWR EXITING------ WKHQWR CAL BATT
CHARGER LQGLFDWLQJFKDUJHUFDOLEUDWLRQLVQRWDFWLYHDQGDQRWKHUVHOHFWLRQ
PD\EHPDGHIURPWKHPDLQFDOLEUDWLRQPHQX
 6HH,OOXVWUDWLRQ&RQQHFWDGLJLWDOYROWPHWHUDFURVVUHVLVWRU$0;$56HOHFWD
UDQJHWKDWGLVSOD\VYROWV'&

,//8675$7,21 

AMX1A3
J8J9 J2

9
TS1
J11
J5 J6
J3 J7J6
1
AMX1
A3R1 T2
T3 T1

L2
L1
R1

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD MOBILES -RE&DUG;30± RI

 3OXJFKDUJHUFRUGLQWRDFRQYHQLHQFHRXWOHW7KHSURPSWFKDQJHVWR
CONVERTINGWKHQWRENTER VALUE, LQGLFDWLQJWKDWWKHEDWWHU\FKDUJHUDWH
PD\EHVHW
 0DWFKWKHYROWDJHGLVSOD\HGRQWKHN9SDQGP$VGLVSOD\ZLWKWKHUHDGLQJRQWKH
PHWHU
S 3UHVVLQJ kVp Y LQFUHDVHVPHWHUYROWDJHUHDGLQJ
S 3UHVVLQJ kVp B GHFUHDVHVPHWHUYROWDJHUHDGLQJ

 3UHVVmAs B ZKHQWKHGLVSOD\HGYROWDJHLVWKHVDPHDVYROWPHWHUYROWDJH
'LVSOD\FKDQJHVWR CONVERTINGWKHQFKDQJHVWR ENTER VALUE. 7KHYROW
PHWHUUHDGLQJZLOOFKDQJHVHYHUDOWLPHVGXULQJWKHFRQYHUWLQJF\FOH
 5HSHDWVWHSDQGIRUWKHVHFRQGVHWSRLQW'LVSOD\FKDQJHVWRCONVERTING
WKHQFKDQJHVWR REMOVE CHRG CORD7KHYROWPHWHUUHDGLQJZLOOFKDQJH
VHYHUDOWLPHVGXULQJWKHFRQYHUWLQJF\FOH5HPRYHFKDUJHUFRUG7KHSURPSW
FKDQJHVWR CAL BATT CHARGER LQGLFDWLQJWKDWFKDUJHUFDOLEUDWLRQLVFRPSOHWH
DQGDQRWKHUVHOHFWLRQPD\EHPDGHIURPWKHPDLQFDOLEUDWLRQPHQX
NOTE: ,IDQHUURUPHVVDJHLVGLVSOD\HGGXULQJCAL BATT CHARGERUHFRUGWKHPHVVDJH
IRU\RXUUHIHUHQFHDQGSUHVVmAsYWRFRQWLQXH

AMX–4 & AMX4+ BATTERY CAPACITY TEST


7RYHULI\WKHEDWWHULHVVWRUHHQRXJKHQHUJ\WRRSHUDWHZLWKLQVSHFLILFDWLRQV
,WHPVUHTXLUHG2VFLOORVFRSHRUD)OXNHW\SH'90ZLWKPLQPD[VWRUDJHFDSDELOLW\
NOTE: %DWWHU\YROWDJHPXVWEHYROWVRUOHVVWRGRORDGWHVW
Set–up:
&RQQHFWDQRVFLOORVFRSHIURPWKHFLUFXLWEUHDNHUWRJURXQG
$)OXNHZLWKWKHPLQPD[VHWWLQJPD\DOVREHXVHGLQSODFHRIWKHVFRSH
Procedure:
 0DNHH[SRVXUHDWDQGN9SDWDERXWP$V
 5HDGEDWWHU\YROWDJHDQGDYHUDJHWKHULSSOHDWWKHERWWRP
 %DWWHU\YROWDJHVKRXOGGURSDERXW9'& DWN9S
 %DWWHU\YROWDJHVKRXOGGURSDERXW9'& DWN9S
 ,IYROWDJHGURSLVWRRKLJKUHSODFHWKHEDWWHULHV

BATTERY CAPACITY CHECK (AMX–I, II & III)


1RWQHFHVVDU\WRSHUIRUPDWLQVWDOODWLRQ
7XUQPDLQSRZHUFLUFXLWEUHDNHU±21
7XUQ;±UD\JHQHUDWRUNH\VZLWFK±&+$5*(
&RQQHFWFKDUJHUERDUG

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD MOBILES -RE&DUG;30± RI

Operation Results Expected Service Reference


D &KDUJHEDWWHU\XQWLOFKDUJHFRPSOHWH
ODPSOLJKWV
E $OORZEDWWHU\WRUHVWPLQXWHVEHIRUH
WHVW
F &RUUHFWGLJLWDOYROWPHWHU7%± 
DQG7%± ± 5HFRUGEDWWHU\YROWDJH
G 6HOHFWN9SP$V&ORVHFROOL
PDWRUEODGHVDQGVKLHOGZLWKOHDG
H 7DNHRQHH[SRVXUHHYHU\PLQXWHIRU %DWWHU\YROWDJHVKRXOGEHDW ,IEDWWHU\YROWDJHLVOHVVWKDQ
PLQXWHV'RQRWUXQURWRUPRUHWKDQ OHDVW9'&DIWHUH[SR 9'&WKHEDWWHU\VKRXOG
VHFRQGVSHUH[SRVXUH5HFRUGEDWWHU\ VXUHVZLWKD±PLQXWHWHVW EHUHFRQGLWLRQHGDVGH
YROWDJHDIWHUHDFKH[SRVXUHDQGDIWHU VFULEHGLQ&K6HF
WKH:DLWOLJKWWXUQVRII
D 6HOHFWN9SP$V5HFRUGEDW ,IYROWDJHGURSLVH[FHVVLYH
WHU\YROWDJH EDWWHU\PD\UHTXLUHUHFRQGL
WLRQLQJRUPD\KDYHKLJKUH
VLVWDQFHWHUPLQDOFRQQHFWLRQ
E 7DNHDQH[SRVXUHDQGQRWHEDWWHU\YROW %DWWHU\YROWDJHGURSGXULQJ
DJHGXULQJWKHH[SRVXUH WKHH[SRVXUHVKRXOGEHDS
SUR[LPDWHO\WRYROWV

9.0 KVp and mA/mAs for CMX, AMX I, II, III


,QVWDOOWKH+9EOHHGHUDQGYHULI\WKHN9SDWDQGN9S5HIHUWR,OOXVWUDWLRQ
IRUWKHDSSURSULDWHWROHUDQFHV
.HLWKOH\ZLWKPRELOHILOWHUSDFNPD\DOVREHXVHGSODFHGDVFORVHDVSRVVLEOHWRWKH
ERWWRPRIWKHFROOLPDWRU
9HULI\WKHP$P$VE\LQVWDOOLQJDP$PHWHULQWKHXQLWDQGUHDGLQJWKHP$
&KHFNWKHH[SRVXUHWLPHZLWKDVFRSHDQGYHULI\LILWLVZLWKLQWKHDFFHSWDEOHOLPLWV,I
WKHUHDUHDQ\TXHVWLRQVUHIHUWR,OOXVWUDWLRQIRUWROHUDQFHV
9HULI\WKDWWKHILODPHQWYROWDJHLVRSWLPL]HGE\UHIHUULQJWR,OOXVWUDWLRQIRU$0;
DQG$0;,,
7RYHULI\WKDWILODPHQWYROWDJHDQGP$UHJXODWRULVRSWLPXPUHIHUWR,OOXVWUDWLRQ
$GMXVWPHQWVRI$5DQG$5DUHFRUUHFWLIWKHFHQWHUVFRSHWUDFHLV
REWDLQHGZKHQWKHWHPSRUDULO\LQVWDOOHGP$PHWHUUHDGVP$GXULQJDQ
H[SRVXUH,IPRUHRUOHVVWKDQP$LVREWDLQHGZLWKWKHWUDFHDVVKRZQDW
WKHFHQWHURI,OOXVWUDWLRQUH±DGMXVW$5WKHQUH±DGMXVW$5WR
REWDLQWKHFHQWHUWUDFH5HSHDWWKLVSURFHGXUHXQWLOWKHFHQWHUWUDFHLV
REWDLQHGZKHQWKH[±UD\WXEHFXUUHQWLVP$5HFRUGLQ)7HVW
DQG)

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD MOBILES -RE&DUG;30± RI

,//8675$7,21 

352%(7RSRI$&
*1'%RWWRPRI$&
+PVGLY
9YGLY[ 3UREH
75,*,17'&6HW3RLQW
8SSHU7UDFH)LODPHQWYROWDJHWRRKLJKDQG
UHJXODWRUSXOOLQJGRZQRUILODPHQWYROWDJH
QRUPDOEXWUHJXODWRUSXOOLQJGRZQLPSURSHUO\
&HQWHU7UDFH)LODPHQWYROWDJHFRUUHFWDQG
P$UHJXODWRUDGMXVWHGFRUUHFWO\
/RZHU7UDFH)LODPHQWYROWDJHWRRORZDQG
P$UHJXODWRUSXOOLQJXSRUILODPHQWYROWDJH
QRUPDOEXWUHJXODWRUSXOOLQJXSLPSURSHUO\

:KHQXVLQJD.HLWKOH\WRPHDVXUHN9SDQGWLPH\RXPXVWLQVWDOOWKHPRELOHILOWHU
SDFNDVFORVHDVSRVVLEOHWRWKHERWWRPRIWKHFROOLPDWRUIRUDFFXUDWHUHVXOWV

VMX

'LVFRQQHFWVWUDSDFURVVWSFDQGWFS
&RQQHFWPHWHUDFURVVWFSDQGWFS
9HULI\P$YDOXHV
mAs kVp w/fluke min max
   
   
   
   

5HVWRUHVWUDSZKHQILQLVKHG

9.1 KVp and mA/mAs for AMX–4 & AMX–4+


,QVWDOOWKH+9EOHHGHU Z¶%HOGHQFDEOH WRYHULI\WKHN9SDWN9S
5HIHUWRWKH$FFXUDF\7DEOHVDWWKHHQGRI;30±
.HLWKOH\ZLWKPRELOHILOWHUSDFNPD\DOVREHXVHGLQVWHDGRIWKH+9EOHHGHU:KHQ
XVLQJD.HLWKOH\WRPHDVXUHN9S\RXPXVWLQVWDOOWKHPRELOHILOWHUSDFNDV
FORVHDVSRVVLEOHWRERWWRPRIFROOLPDWRUIRUDFFXUDWHUHVXOWV
0$DQGWLPHDUHQRWPHDQLQJIXOWRPHDVXUHRQWKH$0;±RU$0;±,QVWHDG
SHUIRUPWKHP$VFDOLEUDWLRQ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD MOBILES -RE&DUG;30± RI

Calibrate mAs (AMX–4 & AMX–4+)

,//8675$7,21 

C6 L3 R5 1 3
R4 R6 R1 K1 5
+
6 2 4

K7 Q3 1 3
T1 K2 5
T2
C4 6 2 4
R3
K3
J2 C3 R2 5 1 3
4 2 6
TP 3 L1 8 6 2 4
7
Q1 3 1 5 5 1 3
Q2 K6 K4 7
8
6 2 4
TP 4
R7 5 1 3
7
R8
CR4 8
6 2 4
AMX1A4 K5

 3UHVVHLWKHUkVp Y RUkVp B XQWLOWKHSURPSWCALIBRATE MAS


GLVSOD\VWKHQSUHVVmAs B7KHSURPSWFKDQJHVWRINSTALL METER
LQGLFDWLQJWKDWP$VPD\EHFDOLEUDWHG
CAUTION: When installing meter in step 2, make the connection to TP–4
first to prevent shorting TP–3 to ground and tripping the circuit breaker.
 6HH,OOXVWUDWLRQ,QMHFWDSSUR[LPDWHO\P$LQWRWKHYROWDJHWRIUHTXHQF\
FRQYHUWHUE\LQVWDOOLQJDQP$PHWHUEHWZHHQ$0;$$73±DQG73±
6HOHFWUDQJHWRGLVSOD\P$'&<RXUPHWHUVKRXOGUHDGEHWZHHQDQG
P$
3UHVVmAs Y7KHSURPSWFKDQJHVWRCALIBRATINGWKHQWRENTER
VALUE
 0DWFKWKHGLVSOD\HGP$VYDOXHZLWKWKHP$UHDGLQJRQWKHPHWHULQVWDOOHGLQ
VWHS
 3UHVVLQJkVp Y LQFUHDVHVGLVSOD\LQP$VLQFUHPHQWV
 3UHVVLQJkVp B GHFUHDVHVGLVSOD\LQP$VLQFUHPHQWV
 :KHQGLVSOD\HGP$VDQGPHDVXUHGP$DJUHHSUHVVmAs B7KHSURPSW
FKDQJHVWRREMOVE METER indicating mAs is set.
 &RQILUPP$VPHWHULQJDFFXUDF\E\UHSHDWLQJWKLVSURFHGXUH5HDGLQJVLQ
VWHSVKRXOGDJUHHZLWKLQ P$

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD MOBILES -RE&DUG;30± RI

 5HPRYHP$PHWHUE\UHPRYLQJ73±FRQQHFWLRQILUVWWRSUHYHQWVKRUWLQJ
73±WRJURXQGDQGWULSSLQJWKHFLUFXLWEUHDNHU3UHVVmAs Y7KHSURPSW
FKDQJHVWRCALIBRATE MAS LQGLFDWLQJWKDWDQRWKHUVHOHFWLRQPD\EHPDGH
IURPWKHJHQHUDWRUFDOLEUDWLRQPHQX

10.0 Phototimer
3RVLWLRQWKH[±UD\WXEHIDERYHWKHIORRU
3ODFHWKHFDVVHWWHRQWKHIORRUFHQWHUHGLQWKHH[SRVXUHDUHDZLWKRQHVKHHWRI
FRSSHUDQGRQHVKHHWRIDOXPLQXPDERYHWKHSUREHRQWRSRIWKHFDVVHWWH
6HOHFWN9SDQGP$VDVDEDFNXS
([SRVHWKHFDVVHWWHDQGSURFHVVWKHILOP
5HFRUGWKHGHQVLW\LQWKHGDWDVKHHWV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG RAD MOBILES -RE&DUG;30± RI

Accuracy Tables
CMX, AMX110, AMX2
P$V 7ROHUDQFHV
  P$V  P$V
  P$V  P$V
  P$V  P$V
WR  P$V  P$V
WR   P$V  P$V
   P$V  P$V
WR ±WR
N9S
WR  N93
± N9S RIGLDOUHDGLQJDIWHUILUVWPLOOLVHFRQGVRIH[SRVXUH
WR  N9S
± N9S RIGLDOUHDGLQJGXULQJILUVWPLOOLVHFRQGVRIH[SRVXUH
WR  N9S
± N9S RIGLDOUHDGLQJGXULQJILUVWPLOOLVHFRQGVRIH[SRVXUH
AMX3
P$V
WR  
WR  
WR  
N9S
WRN9S  N9
WRN9S  N9
AMX–4 & AMX–4+
N9S
 IRUILUVWPVRIYDOXHGLVSOD\HG DIWHU
P$V
 RIVHOHFWHG
VMX
N9S
 RIWKHVHOHFWHGYDOXHSOXVPHWHUWROHUDQFH JOREDOO\
P$V
VHHWDEOHLQ6HFWLRQRIWKLV;30

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

)/8252 -RE&DUG;30± RI

MREFDUG FLUORO MOBILES

VXEDVVHPEO\ )/825202%,/(6 GDWH

SXUSRVH 7RSHUIRUPDFRPSOHWH30RQPRELOHIOXRURXQLWV WLPHKRXUVPLQ

PREREQUISITES
7RRONLW  WUHVLVWRUDQGWUHVLVWRU
5DJV .HLWKOH\N9SPHWHU
&OHDQLQJPDWHULDOV 6FRSH

TASK DESCRIPTION
1.0 Safety/Functional
&KHFNWKHEUDNHVPDNLQJVXUHWKDWWKH\ORFNDQGUHOHDVHFRUUHFWO\&KHFNWKDWWKH
VWHHULQJOLQNDJHZRUNVFRUUHFWO\DQGGRHVQRWKDYHH[FHVVLYHSOD\LQLW
&KHFNWKHFRQGLWLRQRIWKHZKHHOVORRNLQJIRUIODWVSRWVRUFKLSVRQWKHUROOLQJ
VXUIDFHVWKDWFRXOGFDXVHWKHXQLWWREHKDUGWRPRYH$OVRFKHFNWKHZKHHOV
IRUDQ\VWULQJFORWKRURWKHUPDWHULDOWKDWPD\KDYHEHFRPHZUDSSHGDURXQG
WKHP
9HULI\WKDWWKHXQLWDQGWKHPRQLWRUFDUWERWKPRYHHDVLO\
9HULI\WKDWWKHYHUWLFDOVXSSRUWPRWRUGULYHGULYHVWKHVXSSRUWFROXPQ³XS´DQG³GRZQ´
VPRRWKO\DQGXQLIRUPO\:KLOHGULYLQJWKHVXSSRUWOLVWHQIRUDQ\VRXQGVWKDW
FRXOGLQGLFDWHWKDWDEHDULQJRUFRYHULVGUDJJLQJ
9HULI\WKDWDOOWKHORFNVRQWKHSRVLWLRQLQJDUPZRUNSURSHUO\$OVRFKHFNDOORIWKH
PRYHPHQWVZLJZDJLQ±RXWURWDWLRQRIKRUL]RQWDOD[LVDQGRUELWDOD[LV

2.0 Skin Guard


9HULI\WKDWLVLVVHFXUHGWRWKHXQLWDQGQRWHLWVFRQGLWLRQ
Performance
3.0 Ground Fault (if equipped)
Polarix
9HULI\JURXQGIDXOWGHWHFWRUE\FRQQHFWLQJWKHJURXQGIDXOWOHDGWRWKHXQLWWKURXJKD
RKPUHVLVWRU7KHGHWHFWRUVKRXOGQRWWULS
&RQQHFWWKHIDXOWOHDGWRWKHXQLWWKURXJKDRKPUHVLVWRU7KHIDXOWGHWHFWRU
VKRXOGWULS
5HVHWWKHGHWHFWRU

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG FLUORO MOBILES -RE&DUG;30± RI

Stenoscop
1RJURXQGIDXOWFKHFN

Accent
1RJURXQGIDXOW

4.0 Collimator
5HPRYHWKHFRYHURQWRSRIWKHWXEHDVVHPEO\&OHDQDQGLQVSHFWWKHFROOLPDWRUDQG
VSRW±ILOPPHFKDQLFV
$WWDFKWKHVSRW±ILOPWUD\WRWKHLQWHQVLILHUEXWGRQRWFRQQHFWWKHLQWHUORFNFDEOH
,QVHUWDFDVVHWWHDQGIOXRUR$VVRRQDVDQLPDJHLVYLVLEOHRQWKH79PRQLWRU
UHOHDVHWKHIRRWVZLWFK
3URFHVVWKHILOPDQGPHDVXUHWKHGLDPHWHURIWKHH[SRVHGDUHDDWWKHFXUYHGHGJHG
DUHD7KHGLDPHWHUPXVWEHOHVVWKDQWKHGLDPHWHURIWKHLPDJHWXEH
5.0 Generator Calibration
9HULI\DQGUHFRUGWKHIOXRURN9SVSRW±ILOPN9SDQGVSRW±ILOPP$IRUHDFKP$VWDWLRQ
DWN9S IRU6WHQRVFRSDQG$FFHQWYHULI\P$V 3RVLWLRQWKH.HLWKOH\RQWKH
WRSRIWKHWXEHVNLQJXDUGDQGIOXRURWRYHULI\WKDWWKHILOWHUSDFNLVFHQWHUHGLQ
WKHH[SRVXUHDUHD5HIHUWRWKH.HLWKOH\VHWXSVHFWLRQ;30±IRU
UHIHUHQFH
5HFRUGWKHGDWDLQWKHGDWDVKHHWV

6.0 Spot–Film
9HULI\WKHVSRW±ILOPRSHUDWLRQ
&KHFNWKDWVSRW±ILOPVDUHQRWPDGHZKHQWKHVSRW±ILOPLQWHUORFNFDEOHLV
GLVFRQQHFWHGDQGWKHV\VWHPUHWXUQVWRIOXRUR FKHFN6WHQRVFRSDQG$FFHQW
RQO\LIRSWLRQDOFDVVHWWHKROGHULVSUHVHQW 

7.0 Video Storage


9HULI\WKHVWRUDJHRSHUDWLRQE\UHFRUGLQJDQLPDJHDQGYLHZLQJWKHLPDJH
2EVHUYHWKDWWKHLPDJHGLVSOD\VSURSHUO\ZLWKRXWWHDULQJ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

7+,63$*(,17(17,21$//</()7%/$1.

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MISCELLANEOUS
TABLE OF CONTENTS

JOB CARD TITLE PAGE

;30± .(,7+/(<  ±

;30± 67$53$77(510$18$/  ±

;30± 6(59,&(6833/,(6  ±

;30± 722/65(48,5('  ±

±L
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

7+,63$*(,17(17,21$//</()7%/$1.

±LL
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

.(,7+/(< -RE&DUG;30± RI

MREFDUG KEITHLEY

VXEDVVHPEO\ 121±,19$6,9( 0(7(5.(,7+/(< GDWH

SXUSRVH 6HW±XS WLPHPLQ

PREREQUISITES
7RROVUHTXLUHG .HLWKOH\N9SPHWHU±RU$
6FRSH
&RD[FDEOH

TASK DESCRIPTION
Battery Check
7XUQ.HLWKOH\NQREWR³BAT CHECK´SRVLWLRQ
7KHRXWSXWWRWKHVFRSHVKRXOGUHDGQROHVVWKDQYROWV,IVRUHSODFHWKHEDWWHU\

Cal Check
,QVWDOOWKH³test pack´DQGWXUQWKHPHWHUWRWKH³&$/´SRVLWLRQ
7KHRXWSXWWRWKHVFRSHVKRXOGUHDGSOXVRUPLQXVSHUFHQW$RQHSHUFHQWHUURUZLOO
FDXVHDPD[LPXPN9SUHDGLQJHUURURISHUFHQW7KLVLVDFKHFNRIWKH.HLWKOH\
FDOLEUDWLRQ
Set–up
%HVXUHWRXVHDFRD[FDEOHWRHOLPLQDWHQRLVH7KLVZLOOPDNHLWPXFKHDVLHUWRUHDGWKHN9S
RQWKHVFRSH
/HDYHWKH³test pack´LQWKH.HLWKOH\
3RVLWLRQ.HLWKOH\SHUSHQGLFXODUWRWKHD[LVRIWKH[±UD\WXEHZLWKWKHILOWHUSDFNIDFLQJWKH
[±UD\WXEH6HH6HW±8SGLDJUDP
&HQWHUWKHILOWHUSDFNLQWKHH[SRVXUHDUHDDQGFROOLPDWHWRDQDUHDLQFKJUHDWHUWKDQ
WKHILOWHUSDFN
6HWWKH6,'WRDSSUR[LPDWHO\LQFKHV QROHVVWKDQLQFKHV 
6ZLWFKWKH.HLWKOH\WR³RUN´PRGH
7DNHDQH[SRVXUHDWP$N9S
7KHRXWSXWVKRXOGEHDSSUR[LPDWHO\YROWVZLWKWKH³test pack´7KLVWKUHHYROWVLV
LQGHSHQGHQWRIWKHWHFKQLFXVHGDQGLVXVHGWRFKHFNWKHFDOLEUDWLRQRIWKHVFRSH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG KEITHLEY -RE&DUG;30± RI

Measure kVp
,QVWDOODILOWHUSDFNZLWKDUDQJHDSSOLFDEOHIRUWKHN9S\RXDUHWHVWLQJ

35080 & 35080–1

N9 N9S ±N9SDFN =HUR N9S


±N9  N9S ±N9SDFN =HUR N9S
!N9 N9S ±N9SDFN =HUR N9S

35080A

WRN9S WRN9SSDFN=HUR N9S


Scope Setting: 9GLY²N9GLY
9GLY²N9GLY
9GLY²N9GLY

3URSHUO\SRVLWLRQWKH.HLWKOH\HDFKWLPHWKHILOWHUSDFNLVFKDQJHG
)LQG\RXUEDVHOLQHRQWKHVFRSH7KLVZLOOEHWKHEDVHN9SRU]HURN9SWKDWDOOUHDGLQJVDUH
DGGHGWR(LWKHUJURXQGWKHVFRSHLQSXWRUWXUQRIIWKH.HLWKOH\ZKHQVHWWLQJWKLV
YDOXHRQWKHVFRSH)RUWKHQHZ$WKH]HURYDOXHLVN9S
(DFKILOWHUSDFNKDVD³&$/´YROWDJHWKDWLWZLOORXWSXWZKHQWKH.HLWKOH\LVVZLWFKWRWKH
³&$/´PRGH7KHYROWDJHIRUWKH$LVYROWVZKLFKUHSUHVHQWVN9S<RX
FDQXVHWKLVWRFKHFNFDOLEUDWLRQRIWKHVFRSHJDLQ7KLVFDQDOVREHXVHGWRVHWD
NQRZQEDVHOLQHRQWKHVFRSHWRPDNHUHDGLQJN9SVHDVLHUDWWKHKLJKHUHQG LH
%DVHOLQH N9S 
7DNHDQH[SRVXUHDQGDGGWKH³=(52´YDOXHSULQWHGRQWKHILOWHUSDFNWRWKHVFRSHUHDGLQJ
WRJHWWKHDFWXDON9SYDOXH7KLVLVWKHEDVHOHYHORQWKHVFRSHIROORZLQJWKH
H[SRVXUH
8VLQJWKHFXUVRUVRQWKHVWRUDJHIXQFWLRQRIWKHVFRSHPDNHVUHDGLQJWKHN9SHDV\
)RUPD[LPXPDFFXUDF\\RXVKRXOGXVHWKHOLQHDULW\FRUUHFWLRQFXUYHVDVSULQWHGLQWKH
PDQXDO(DFKSDFNKDVLWVRZQFRUUHFWLRQFXUYH$GGRUVXEWUDFWWKLVYDOXHIURPWKH
VFRSHUHDGLQJ
NOTE:2QWKH&0; $0;WKH.HLWKOH\PXVWEHXVHGZLWKDVSHFLDO0RELOH)LOWHU3DFNDQG
SODFHGDVFORVHDVSRVVLEOHWRWKHERWWRPRIWKHFROOLPDWRUIRUDFFXUDWHUHVXOWV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG KEITHLEY -RE&DUG;30± RI

DO’S AND DON’TS

 Don’t forget to add the baseline!! (DFKILOWHUSDFNKDVDEDVHN9SWKDWPXVWEH


DGGHGWRWKHPHDVXUHGYDOXH)RUWKHWKLVLVGLIIHUHQWIRUHDFKSDFN)RUWKH
$WKHEDVHYDOXHLVDOZD\VN9S
 Do SODFHWKHDWULJKWDQJOHVRUSHUSHQGLFXODUWRWKHWXEHD[LV DQRGHWR
FDWKRGH 7KLVLVWRPLQLPL]HRUHOLPLQDWHWKHKHHOHIIHFW
 Don’t IRUJHWWRVHWWKH³VFRSHLQSXWWR*1'´RUWXUQ2))WKHZKHQ\RXVHWWKH
EDVHOLQHRU]HURSRLQW
 DoXVHWKHOLQHDULW\FRUUHFWLRQFXUYHVZKHQPD[LPXPDFFXUDF\LVGHVLUHG(DFKILOWHU
SDFNKDVLWVRZQFRUUHFWLRQFXUYH
 Don’tEHDODUPHGLI\RXVHHDVSLNHRQWKHOHDGLQJRUWUDLQLQJHGJHRIDFLQHSXOVHDV
LWPD\EHDQDUWLIDFW7RWHVWIRUDUWLIDFWVFKDQJHWKHVRXUFH±WR±GHWHFWRUGLVWDQFH,I
WKHVSLNHKHLJKWFKDQJHVLW¶VQRWUHDO
 Don’tXVHWKHHQGVRIWKHILOWHUSDFNUDQJHVLILWFDQEHDYRLGHGDVWKHJUHDWHVW
OLQHDULW\FRUUHFWLRQLVUHTXLUHGDWWKHHQGVRIWKHUDQJHV6HOHFWDQRWKHUILOWHUSDFN
DQGXVHWKHFHQWHURILWVUDQJH,IZDYHIRUPGHWDLOVDUHLPSRUWDQWWKHQXVHWKHORZHVW
UDQJHILOWHUSDFNDYDLODEOH
 Don’t XVHWKHPDPPRILOWHUSDFNRQD;HURJUDSK\PDFKLQHDVLWKDVDWXQJVWHQ
WDUJHW DQGWKHPDPPRILOWHUSDFNLVGHVLJQHGIRUPRO\EGHQXPWDUJHWV 
 DoFKHFNWKHEDWWHU\YROWDJHRFFDVLRQDOO\WKHEDWWHU\YROWDJHVKRXOGEH
JUHDWHUWKDQYROWV5HSODFHWKHEDWWHU\LIWKHYROWDJHIDOOVEHORZYROWV
 DoXVHDVKLHOGHGFDEOHWRFRQQHFWWKHWRWKHVFRSHWRPLQLPL]HQRLVH7KLVLV
HVSHFLDOO\LPSRUWDQWZLWKPDPPR
 DoEHVXUHWKDW\RXKDYHDWOHDVWP$WXEHFXUUHQWZKHQ\RXPHDVXUHPDPPR
N9S
 Don’tIRUJHWWRFKHFNWKHVFRSH¶VFDOLEUDWLRQXVLQJWKH¶VFDOYROWDJH
 Don’tIRUJHWWRWXUQRIIWKHZKHQ\RXDUHILQLVKHGWRFRQVHUYHWKHEDWWHU\

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

;±5$<67$53$77(516 -RE&DUG;30± RI

MREFDUG STAR PATTERN MANUAL

VXEDVVHPEO\ GDWH

SXUSRVH )RFDOVSRWPHDVXUHPHQW WLPHPLQ

PREREQUISITES
TASK DESCRIPTION
3K\VLFDO'HVFULSWLRQ
7KH0RGHO±FRQVLVWVRIVSRNHSDLUVGLYLGHGLQWRIRXU_VHFWRUV(DFKVSRNH
GLYHUJHVDWDQDQJOHRI_
7KH0RGHO±FRQVLVWVRIVSRNHSDLUVGLYLGHGLQWRIRXU_VHFWRUVDQGGLYHUJLQJDW
DQDQJOHRI_IRUHDFKVSRNH
7KH0RGHO±LVGLYLGHGLQWRVSRNHSDLUVHDFKVSRNHGLYHUJHVDWDQDQJOHRI_
7KH0RGHO±FRQVLVWVRIVSRNHSDLUVGLYLGHGLQWRIRXU_VHFWRUVDQGGLYHUJLQJDW
DQDQJOHRI_SHUVSRNH
7KH0RGHO±FRQVLVWVRIVSRNHSDLUVGLYLGHGLQWRIRXU_VHFWRUV(DFKVSRNH
GLYHUJHVDWDQDQJOHRI±_
,QVWUXFWLRQVIRU8VH
)RFDOVSRWVL]HFDQEHGHWHUPLQHGZLWKWKH±±±±DQG±
WHVWSODWHVE\REVHUYLQJWKHUHJLRQVRIEOXUULQJZKLFKRFFXUZKHQWKHVWDUSDWWHUQLV
UDGLRJUDSKHGE\DQ;±UD\VRXUFHRIILQLWHGLPHQVLRQV5DGLDWLRQIURPGLIIHUHQWDUHDV
RIWKHIRFDOVSRWZLOOFDXVHDSHULRGLFEOXUULQJRIWKHSDWWHUQGXHWRSHQXPEUDHIIHFWV
.QRZOHGJHRIWKHJHRPHWULFIDFWRUVDQGWKHGLVWDQFHIURPWKHFHQWHURIWKHSDWWHUQWR
WKHUHJLRQZKHUHEOXUULQJRFFXUVZLOOSHUPLWWKHFDOFXODWLRQRIWKHIRFDOVSRWVL]HZLWK
WKHVDPHDFFXUDF\DVPHDVXUHPHQWVPDGHZLWKDSLQKROHFDPHUD
NOTE: 7KHPLQLPXPIRFDOVSRWVL]HPHDVXUDEOHZLWKWKH_VWDULVFP)RU
VLPLODUIRFDOVSRWVD_VWDU ± D_VWDU ± RUD_VWDU ±
VKRXOGEHXVHG
3URFHGXUH
 0RXQWWKHVWDUWHVWSODWHVRWKDWWKHUDGLRJUDSKLFFHQWUDOUD\LVSHUSHQGLFXODUWRWKH
VWDUSDWWHUQDQGSDVVHVWKURXJKWKHFHQWHURIWKHVWDU,WLVXVXDOO\FRQYHQLHQWWRWDSH
WKHSODWHGLUHFWO\WRWKHIDFHRIWKHFROOLPDWRU,IDQXQGHU±WKH±WDEOHWXEHLVEHLQJ
FKHFNHGWKHWHVWSODWHFDQEHSODFHGRQWKHWDEOHDQGDWHVWILOPWDNHQ

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG STAR PATTERN MANUAL -RE&DUG;30± RI

 3ODFHDUDGLRJUDSKLFILOH 'LUHFW)LOP([SRVXUH DWDERXWWKHVDPHGLVWDQFHIURPWKH


WHVWSODWHDVWKHSODWHLVIURPWKHIRFDOVSRW WKLVZLOOJLYHDPDJQLILFDWLRQRIWZR DQG
DOLJQLWVRWKDWWKHFHQWUDOUD\VWULNHVWKHFHQWHURIWKHILOP7KHILOPVKRXOGEHSDUDOOHO
WRWKHWHVWSODWH,IWKHEOXUSDWWHUQLVWRRVPDOOPDJQLILFDWLRQFDQEHLQFUHDVHGE\
PRYLQJWKHILOPIDUWKHUIURPWKHWHVWSODWH,IWKHEOXUSDWWHUQLVWRRODUJH
PDJQLILFDWLRQFDQEHGHFUHDVHGE\PRYLQJWKHILOPFORVHUWRWKHWXEH7KHILOPFDQEH
XVHGZLWKDVFUHHQRULQDFDUGERDUGKROGHU7KHN9DQGP$VKRXOGEHFRPSDUDEOH
WRWKDWXVHGFOLQLFDOO\WRJHWWKHWUXHIRFDOVSRWVL]HZKLFKLVVRPHZKDWGHSHQGHQW
XSRQWKHHOHFWULFDOIDFWRUVHPSOR\HG5HFRPPHQGHGWHFKQLTXHVKRXOGEHRQH±KDOI
WKHPD[LPXPP$DWN9S([SRVXUHWLPHZLOOYDU\DFFRUGLQJWRWKHILOPVSHHG
XVHG7KHGHQVLW\RIWKHLPDJHVKRXOGEHDERXW
 'HYHORSWKHILOP6WDQGDUGILOPSURFHVVLQJSURFHGXUHVVKRXOGEHIROORZHG
 'HWHUPLQHWKHPDJQLILFDWLRQ 0 E\GLYLGLQJWKHGLDPHWHURIWKHUDGLRJUDSKLFLPDJHRI
WKHVWDUSDWWHUQE\WKHWUXHGLDPHWHU PP 
 6FDQWKHVWDUSDWWHUQRQWKHUDGLRJUDSKLQZDUGIURPWKHSHULSKHU\WRILQGWKH
RXWHU±PRVWUHJLRQLQZKLFKWKHLPDJHRIWKHVHFWRUVGLVDSSHDUV7KLVLVWKHUHJLRQRI
]HURFRQWUDVW0HDVXUHWKHGLDPHWHURIWKLVUHJLRQDFURVVLWVJUHDWHVWH[WHQWDQGDOVR
LQSHUSHQGLFXODUGLPHQVLRQ/HWWKHVHGLDPHWHUVEHFDOOHG'DQG'

7<3,&$/5$',2*5$3+,&2) =(52&2175$67$5($6
)2&$/63270($685(0(17

$12'(
$;,6

)6

'

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG STAR PATTERN MANUAL -RE&DUG;30± RI

 7KHIRFDOVSRWVL]HFRUUHVSRQGLQJWRWKHLQGLYLGXDOGLDPHWHUGLPHQVLRQVFDQEH
GHWHUPLQHGE\IRUPXOD
1 '
) ²²² ²²²
 0±
:KHUH) LVWKHIRFDOVSRWVL]HLQPP
1 LVWKHDQJOHRIWKHVWDUSDWWHUQOLQH ZKLFKLVPDUNHGRQWKHWHVWSODWHV
± _±__RU_ 
' LVWKHGLDPHWHURIWKH]HURFRQWUDVWUHJLRQLQPP
0 LVWKHPDJQLILFDWLRQ
 )RUWKHUDGLRJUDSKVKRZQ
1 '
) ²²² ²²²
 0±
1 
 PP
0DJQLILFDWLRQ0 ²²²²² 
PP
0±  
)RUWKH$QRGH±&DWKRGH'LDPHWHU
'X±G PP
 PP
)X±G ²²² ²²²²
 

)X±G PP
)RUWKH7UDQVYHUVH'LDPHWHU
'D±F PP
 
)D±F ²²² ²²²² PP
 

)X±G PP
7KHUHIRUHWKH)RFDO6SRWLVPP[PPDWWKHN9SDQGP$6(77,1*86('

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG STAR PATTERN MANUAL -RE&DUG;30± RI

D 6HYHUDOUHJLRQVRI]HURFRQWUDVWPD\EHIRXQGRQDVLQJOHILOP,WLVH[WUHPHO\
LPSRUWDQWWKDWWKHODUJHVWRQHEHXVHG,IWKHUHLVDQ\GRXEW LHWKHIRFDOVSRW
FDOFXODWLRQ\LHOGVORZYDOXHV WKHQDVHFRQGH[SRVXUHZLWKDORZHUPDJQLILFDWLRQ
VKRXOGEHWDNHQ
E ,IWKHWHVWSODWHLVQRWSURSHUO\FHQWHUHGWKHSDWWHUQRIWKHVWDUZLOODSSHDUGLVWRUWHG
7KHSDWWHUQVKRXOGEHUHDOLJQHGDQGWKHH[SRVXUHUHSHDWHG
F )RUPXODDQGGDWDSUHVHQWHG\LHOGVWKHHTXLYDOHQWKRPRJHQHRXVIRFDOVSRWVL]H

5(62/87,2196',$0(7(5

Diameter (mm)

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

&200213$576/,67 -RE&DUG;30± RI

MREFDUG SERVICE SUPPLIES

VXEDVVHPEO\ GDWH

SXUSRVH /LVWRIFRPPRQ30SDUWVDQGVXSSOLHV WLPH

SERVICE SUPPLIES
ITEM NAME PART NUMBER
9LGHR%1&³7´FRQQHFWRU ±3
%1&WHUPLQDWRU ±3
&93KDQWRP ±*
&ROOLPDWRUDGDSWHUZUHQFK ±3
&ROOLPDWRU7±KDQGOHKH[ZUHQFK ±3
±VDIHW\VSULQJJDXJH ±3
+HZUXOHU ±3
++6WHVWNLW ±*
+9VSDQQHUZUHQFK KH[KDQGOH ±3
+9VSDQQHUZUHQFK EDUKDQGOH $*
79RYHUOD\ IPRQLWRU ±3
6LOLFRQHJUHDVH ±3
+9WUDQVIRUPHURLO 72&
/XEULSODWH $$ ±3
0RO\NRWH*±1 
%XFN\VWULQJV TXDQWLW\ /)/
7DSHDVVHPEO\ FROOLPDWRU ±* ZLGH
7DSHDVVHPEO\ FROOLPDWRU ±*
+35KHDGFOHDQHU ±
%OHHGHUFDEOHV &$

/RFWLWHVHDODQW ±3
/RFWLWH IRUK\GUDXOLFV ±3
+\GUDXOLFIOXLG ±3
2LO $QGHUROIRUODVHUFDP ±3
7\±UDSV ±3
(SR[\ ±3
7HIORQWDSH ±3
579VHDODQW ±3
&RQWDFWFHPHQW ±3
2\VWHUJUH\SDLQW ±3
0LVWJUH\SDLQW ±3
3HDUOJUH\SDLQW ±3
$0;±JUH\SDLQW 

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG SERVICE SUPPLIES -RE&DUG;30± RI

ITEM NAME PART NUMBER


/DVHUFDPFOHDQLQJNLW ±3
2QH\HDUVXSSO\RIFOHDQLQJILOPV
OLQWIUHHFORWKSDGVDOFRKROSDGV
)LHOGVHUYLFHFOHDQLQJNLW ±*
.LWFRQWDLQVWKHIROORZLQJ
)UHRQ7) ±3
.LPZLSHV ±3
2SWLFSDG ±3
:HWDQGGU\ ±3
*ROGZLSHV ±3
LQFKVZDEV ±3
%UXVK ±3
$FLGEUXVK ±3
$OFRKROERWWOHSHUFHQW ±3

Lamps
)OXRULFRQ
2SHUDWRUSXVKEXWWRQV ±3
'LDOODPSV 
³/LQH´ODPS 
6HQWU\FROOLPDWRU
)LHOGODPS 
6SRW±)LOP
&DVVHWWHSRVLWLRQLQGLFDWRUV ±3
7UDQVIHUOLJKW 
6SRW±)LOP
&DVVHWWHSRVLWLRQLQGLFDWRUV ±3
3XVKEXWWRQODPSV   "
6SRW±)LOP
3XVKEXWWRQODPSV ±3
03;
8SSHUGLVSOD\ ±3
/RZHUSXVKEXWWRQ 
06,067
06706,³WHFKRO´ ±*
067³UHDG\´067³VHOWHFK´DQG³UHDG\´ ±*
0673RZHU8QLW ±*
06,3RZHU8QLW ±*
06,³JHQRO´³TXDQWUHVHW´ ±*
06,³VHORSHU´ ±*
06,³UG\´³VHOWHFK´³VHORS´ ±*
06,³WHFKRO´ ±*

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG SERVICE SUPPLIES -RE&DUG;30± RI

ITEM NAME PART NUMBER


Lamps
06,³JHQRO´³TXDQWUHVHW´ ±*
067³TXDQWUHVHW´³ROUHVHW´ ±3
06,ORQJIOXRUHVFHQWODPS 
06,VKRUWIOXRUHVFHQWODPS 
067³VHORS´ 
06706,³OLQH´ 

7XEHLQGLFDWRUODPS ±*
$0;ODPSV ±3
&DSEXOE ('%

6WHQHVFRSH 6HQL[/DPSV
&ROOLPDWRU &*&
3XVKEXWWRQODPS &*&
N9SODPS &*

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

30722//,67 -RE&DUG;30± RI

MREFDUG TOOLS REQUIRED

VXEDVVHPEO\ GDWH

SXUSRVH /LVWRI30WRROV WLPH

TOOLS REQUIRED
7KHIROORZLQJWRROVDUHUHTXLUHGLQDGGLWLRQWRWKHEDVLFKDQGWRROVQRUPDOO\FDUULHGE\WKH
ILHOGHQJLQHHU
5$'6<67(06
6WRUDJHVFRSH
'90
.HLWKOH\RUHTXLYDOHQW
&93KDQWRP QHHG&XDQG$O
'HQVLWRPHWHU
6HQVLWRPHWHU
7RPR3KDQWRP 7RPRV\VWHPVRQO\
9DFXXP
&OHDQLQJVXSSOLHV UDJVVWDWHRLOHWF
I[ISDSHUFDVVHWWHRUHTXLYDOHQW
5 )$1'9$6&8/$56<67(06
$OOLWHPVLQWKH5$'V\VWHPDUHUHTXLUHGLQDGGLWLRQWRWKHIROORZLQJ
'LJLWDOSKDQWRP GLJLWDOV\VWHPVRQO\
5DGLDWLRQPHWHU
+LFRQWUDVWPHVKSKDQWRP UHVROXWLRQPHVKSDWWHUQ
2SWLFVFOHDQLQJVXSSOLHV OHQVWLVVXHEUXVKFRPSUHVVHGDLURUHTXLYDOHQWHWF
I[ISDSHUFDVVHWWH
'DOHOHDNDJHPHWHU
0$002*5$3+<
5DJVVRIWFORWKRUHTXLYDOHQW
673:D\PDWRLORURWKHUKLJKYLVFRVLW\OXEULFDQW
6WDU3DWWHUQGHJUHH²±3
6WDU3DWWHUQGHJUHH²±3
.HLWKOH\QRQ±LQYDVLYHN9SPHWHU
'90 PP)RFDO6SRW7HVW'LDSKUDJP²&*
PP)RFDO6SRW7HVW'LDSKUDJP²&*
³5´0HWHUZLWK0DPPRJUDSK\3UREH
50,± 3KDQWRP
'HQVLWRPHWHU
6HQVLWRPHWHU
6WRUDJH 6FRSH
'DOHOHDNDJHPHWHU

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAYPLANNED MAINTENANCE
PLANNEDMAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

MREFDUG TOOLS REQUIRED -RE&DUG;30± RI

237,21$/722/6
*UD\VFDOHJHQHUDWRU 
9,&H[WHQGHUERDUG ±*
06DGDSWHU  IRUJUD\VFDOHJHQHUDWRU
,467SKDQWRP 
,467FPKROGHU ±
,467FPKROGHU ±
,467FPKROGHU 
,4676)'KROGHU 
'90OHDGVHW ±3
03;GDWDWUDQVIHUWRRO 

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY COMPANY X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

SERVICE NOTES
TABLE OF CONTENTS

NO. TITLE PAGE

61 08/7,)250$7&$0(5$  ±

61 *(1(5$/7$%/(6 78%(67$1'6  ±

61 527$7,1*$12'(;±5$<78%(6  ±

61 0$&$/,%5$7,21±;±5$<*(1(5$72563+$6(  ±


)LODPHQW'DWDIRU0D[LUD\E±_  ±
)LODPHQW'DWDIRU0D[LUD\±±KH[  ±
&LQH)LODPHQW'DWDIRU0D[LUD\J±J±  ±
)LODPHQW'DWDIRU0D[LUD\+7&*±*_  ±

61 5);6);7$%/(75$16/$7,21&+$,1,163(&7,21
$1'$'-8670(17  ±

±L
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY TO X–RAY
REV 15
16
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

7+,63$*(,17(17,21$//</()7%/$1.

±LL
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 1 of 17

FILE TITLE Multiformat Camera SN 80001

MI–10 PERIODIC MAINTENANCE PROCEDURES

EQUIPMENT: 0,±&DPHUDDQG$XWRORDGHU2SWLRQ

MATRIX SERVICE 


NOTE:

MATRIX SERVICE 3UHYHQWLYH 0DLQWHQDQFH 3URFHGXUHV IRU 0,± &DPHUD DQG $XWRORDGHU
NOTE TITLE: 2SWLRQ

MATRIX SERVICE ±±


NOTE TITLE:

/DUU\%DUQHWW
&76\VWHPV,QWHJUDWLRQ(QJLQHHULQJ

&RS\ULJKW EE\*HQHUDO(OHFWULF&R

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 2 of 17

FILE TITLE Multiformat Camera SN 80001

$WWDFKHG DUH SHULRGLF PDLQWHQDQFH SURFHGXUHV ZKLFK VXSSRUW WKH &DPHUD$XWRORDGHU 0DLQWHQDQFH
6FKHGXOH 0DWUL[GRFXPHQW±± $OORIWKHV\VWHPPDLQWHQDQFHSURFHGXUHVDUHLQFOXGHGLQWKH
0,±8VHUDQG6HUYLFH0DQXDO±±9HUVLRQVDQGKLJKHU$OORIWKH$XWRORDGHUPDLQWHQDQFH
SURFHGXUHVDUHLQFOXGHGLQWKH$XWRORDGHU6HUYLFH0DQXDO±±9HUVLRQVDQGKLJKHU

:LWKWKLV6HUYLFH1RWH\RXFDQSHUIRUPDOORIWKHVSHFLILHGSHULRGLFPDLQWHQDQFHSURFHGXUHVHYHQLI\RX
GRQRWKDYHWKHODWHVWUHYLVLRQV\VWHPDQG$XWRORDGHUPDQXDOV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 3 of 17

FILE TITLE Multiformat Camera SN 80001

1. CLEANING THE SUCTION CUPS


WHEN?: <RXVKRXOGFOHDQDOOILYHRIWKHUXEEHUVXFWLRQFXSV HYHU\WKUHHPRQWKV

WHY?: 7KLVUHPRYHVGXVWDQGVLOYHUHPXOVLRQSDUWLFOHVZKLFKPD\DFFXPXODWHGXULQJQRU
PDORSHUDWLRQRIWKH$XWRORDGHU

POSSIBLE ,IVXFKDEXLOGXSRFFXUVILOPPD\QRWDGKHUHWRWKHVXFWLRQFXSV7KLVPD\UHVXOW
SYMPTOMS: LQWKHIROORZLQJSUREOHPV

D 7KHVXFWLRQFXSVPD\QRWUHWULHYHDVKHHWRIILOPIURPWKH6HQG0DJD]LQH HV
SHFLDOO\ZKHQWKHILOPVXSSO\LVGRZQWRWKHODVWIHZVKHHWV 

D 7KH6XFWLRQ$UPPD\QRWGHOLYHUDVKHHWRIILOPWRWKHILUVWVHWRIVXSSO\UROOHUV
7KHILOPVHSDUDWRUVGHVLJQHGWRSUHYHQWPRUHWKDQRQHVKHHWRIILOPIURPOHDY
LQJWKH6HQG0DJD]LQHDWRQHWLPHPD\VWULSWKHILOPIURPWKHGLUW\VXFWLRQFXSV
EHIRUHLWUHDFKHVWKHVXSSO\UROOHUV

HOW?: 7RFOHDQWKHVXFWLRQFXSV\RXPXVWDFFHVVWKHPE\UHPRYLQJHLWKHURIWKH0,±¶V
VLGHSDQHOV7KHILYHVXFWLRQFXSVDUHORFDWHGRQWKH6XFWLRQ)UDPHZKLFKUXQV
DFURVVWKHZLGWKRIWKH$XWRORDGHUGLUHFWO\DERYHWKH6HQG0DJD]LQH VHH,OOXVWUD
WLRQ 

'DPSHQDVRIWOLQW±IUHHFORWKZLWKZDWHUDQGZLSHWKHXQGHUVLGHRIHDFKVXFWLRQ
FXS'U\HDFKFXSHQVXULQJWKDWQRPRLVWXUHUHPDLQV

Never use alcohol to clean the suction cups as this will cause
CAUTION deterioration of the rubber and result in premature failures of
the suction cups.

,//8675$7,21 
LOCATION OF THE SUCTION CUPS

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 4 of 17

FILE TITLE Multiformat Camera SN 80001

2. CLEANING THE FILM SENSOR


WHEN?: <RXVKRXOGFOHDQWKHILOPVHQVRU HYHU\WKUHHPRQWKV

WHY?: 7KLVUHPRYHVGXVWDQGVLOYHUHPXOVLRQSDUWLFOHVZKLFKPD\DFFXPXODWHGXULQJQRU
PDORSHUDWLRQRIWKH$XWRORDGHU

POSSIBLE ,IWKHILOPVHQVRUEHFRPHVEORFNHGZLWKGLUWLWPD\QRWGHWHFWILOPOHDYLQJWKHILOP
SYMPTOMS: SODQHGXULQJWKHUHFHLYHF\FOH7KLVZLOOUHVXOWLQDMISFED HUURUPHVVDJHEHLQJ
GLVSOD\HGRQWKH0,±¶VFRQWUROFRQVROH

HOW?:
D 7KHILOPVHQVRULVORFDWHGEHORZWKH$XWRORDGHUILOPSODQHDWWKHHQGQHDUHVW
WKH UHYHUVLEOH UROOHU VHW <RX PD\ DFFHVV LW E\ RSHQLQJ WKH UHDU GRRU RI WKH
0,±

D 8VHDVRIWFRWWRQVZDEWRZLSHDQ\GLUWRIIWKHILOPVHQVRU

,//8675$7,21 
CLEANING THE FILM SENSOR

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 5 of 17

FILE TITLE Multiformat Camera SN 80001

3A. CLEANING THE METAL ROLLER SETS


WHEN?: <RXVKRXOGFOHDQWKHWKUHHPHWDOUROOHUVHWV HYHU\WKUHHPRQWKV

WHY?: 7KLVUHPRYHVGXVWDQGVLOYHUHPXOVLRQSDUWLFOHVZKLFKPD\DFFXPXODWHGXULQJQRU
PDORSHUDWLRQRIWKH$XWRORDGHU

HOW?: 5HIHUWR,OOXVWUDWLRQV³$XWRORDGHU/HIW6LGH9LHZ´DQG³$XWRORDGHU5LJKW6LGH9LHZ
LQ6HFWLRQRI±±7KHVHVKRZ\RXWKHORFDWLRQRIWKHILUVWVHFRQGDQG
WKLUGUROOHUVHWV

D 5HPRYH WKH 6HQG DQG 5HFHLYH 0DJD]LQHV IURP WKH $XWRORDGHU 'DPSHQ D
VHFWLRQ RI VRIWOLQW±IUHHFORWKZLWKZDWHUDQGUHPRYHDQ\GXVWRUGHEULVIURP
HDFKUROOHU'U\WKHUROOHUFRPSOHWHO\ZLWKDGU\VHFWLRQRIFORWK8VHLVRSURS\O
DOFRKROWRUHPRYHJUHDVHDQGRWKHUWRXJKVWDLQV

D %HFHUWDLQWRNHHSWKHDOFRKRODZD\IURPUXEEHUDQGSODVWLF$XWRORDGHUFRPSR
QHQWV

,//8675$7,21 
CLEANING THE ROLLERS

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 6 of 17

FILE TITLE Multiformat Camera SN 80001

3B. CLEANING THE RUBBER ROLLER SET


WHEN?: <RXVKRXOGFOHDQWKHIRXUWKUROOHUVHW HYHU\WKUHHPRQWKV

WHY?: 7KLVUHPRYHVGXVWDQGVLOYHUHPXOVLRQSDUWLFOHVZKLFKPD\DFFXPXODWHGXULQJQRU
PDORSHUDWLRQRIWKH$XWRORDGHU

HOW?: 7KHIRXUWKUXEEHUUROOHUVHWIHHGVWKHH[SRVHGILOPLQWRWKH5HFHLYH0DJD]LQH5H
IHUWRWKHLOOXVWUDWLRQ³$XWRORDGHU5LJKW6LGH9LHZ´LQ6HFWLRQRI±±IRU
H[DFWORFDWLRQRIWKHIRXUWKUROOHUV

D 5HPRYH WKH 6HQG DQG 5HFHLYH 0DJD]LQHV IURP WKH $XWRORDGHU 'DPSHQ D
VHFWLRQ RI VRIWOLQW±IUHHFORWKZLWKZDWHUDQGUHPRYHDQ\GXVWRUGHEULVIURP
HDFKUROOHU'U\WKHUROOHUFRPSOHWHO\ZLWKDGU\VHFWLRQRIFORWK8VHDPLOGOLTXLG
GHWHUJHQWVROXWLRQWRUHPRYHJUHDVHDQGRWKHUWRXJKVWDLQV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 7 of 17

FILE TITLE Multiformat Camera SN 80001

4. AUTOLOADER LUBRICATION
WHEN?: <RXVKRXOGOXEULFDWHWKH$XWRORDGHU HYHU\PRQWKV

WHY?: 7KLVHQVXUHVVPRRWKDQGTXLHWRSHUDWLRQRIWKH$XWRORDGHUDQGPLQLPL]HVPHFKDQ
LFDOZHDU

WHERE? <RXVKRXOGOXEULFDWHSRLQWVLQWKH$XWRORDGHUZKHUHPRYLQJPHWDOSDUWVFRQWDFWRWK
HUPHWDOSDUWV7KLVLQFOXGHVUROOHUVKDIWVDQGEXVKLQJVWKHWZRGULYHFKDLQVDQG
WKHVXFWLRQDUPGULYHPHFKDQLVP

WHICH $PLFUR±RLOHUZLWKOLJKWJUDGHPDFKLQHRLOLVUHFRPPHQGHGIRUOXEULFDWLQJDOOPRYLQJ
LUBRICANTS?: SDUWVH[FHSWZKHUHLQGLFDWHGLQWKHIROORZLQJVWHSV7KLVDOORZV\RXWRFRQWUROSUH
FLVHO\ZKHUHDQGKRZPXFKRLOLVDSSOLHG$OZD\VXVHDYHU\OLJKWFRDWLQJRIRLODQG
ZLSH DZD\ DQ\ H[FHVV 7KH $XWRORDGHU UXQV DW ORZ 530 DQG GRHV QRW UHTXLUH
KHDY\ OXEULFDWLRQ 'U\ VLOLFRQH EDVHG OXEULFDQWV DUH DOVR DFFHSWDEOH +RZHYHU
WKHVHXVXDOO\FRPHLQDHURVROVSUD\FDQVDQG\RXPXVWEHH[WUHPHO\FDUHIXOQRW
WRFRQWDPLQDWHWKHLQWHULRURIWKH$XWRORDGHUZLWKOXEULFDQW$OZD\VPDVNRIIWKH
DUHD\RXLQWHQGWRVSUD\

D $YRLG XVLQJ KHDY\ JUHDVH RU ZHW OXEULFDQWV VXFK DV :'± 7KHVH FDQ EH
PHVV\DQGFDQDWWUDFWGXVWDQGRWKHUGHEULVDIWHUSURORQJHGXVDJH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 8 of 17

FILE TITLE Multiformat Camera SN 80001

4. AUTOLOADER LUBRICATION (CONT.)


HOW?: $SSO\DOLJKWFRDWLQJRIWKHRLODWWKHSRLQWVLQGLFDWHGLQWKHIROORZLQJLOOXVWUDWLRQV

,//8675$7,21 
AUTOLOADER LUBRICATION, LEFT SIDE

$5ROOHU%XVKLQJVDQG6KDIWV

%&KDLQDQG6XFWLRQ$UP

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 9 of 17

FILE TITLE Multiformat Camera SN 80001

4. AUTOLOADER LUBRICATION (CONT.)


HOW?: $SSO\DOLJKWFRDWLQJRIWKHRLODWWKHSRLQWVLQGLFDWHGLQWKHIROORZLQJLOOXVWUDWLRQV

,//8675$7,21 
AUTOLOADER LUBRICATION, RIGHT SIDE

&5ROOHU%XVKLQJVDQG6KDIWV

'&KDLQDQG6XFWLRQ$UP

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 10 of 17

FILE TITLE Multiformat Camera SN 80001

5. AUTOLOADER ALIGNMENT
$XWRORDGHUDOLJQPHQWSURFHGXUHVDUHSURYLGHGLQ6HFWLRQRI±±5HIHUWRWKDWGRFXPHQWIRU
VSHFLILFLQVWUXFWLRQVRQDOLJQLQJWKH$XWRORDGHU

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 11 of 17

FILE TITLE Multiformat Camera SN 80001

6. MAGAZINE INSPECTION
WHEN?: <RX VKRXOG SHUIRUP D YLVXDO LQVSHFWLRQ RI WKH $XWRORDGHU PDJD]LQHV HYHU\ VL[
PRQWKV

WHY?: 7KLVHQVXUHVWKDWWKHPDJD]LQHVDUHFOHDQDQGIXQFWLRQDO

HOW?: 3HUIRUPWKHIROORZLQJFKHFNVRQ\RXU6HQGDQG5HFHLYHPDJD]LQHV

D (PSW\WKHILOPRXWRIWKHPDJD]LQHVDQGLQVSHFWWKHLULQWHULRUVIRUDFFXPXOD
WLRQVRIGXVWDQGHPXOVLRQSDUWLFOHV+ROGWKHPDJD]LQHYHUWLFDOO\ZLWKWKHGDUN
VOLGH RSHQ DQG WKH KDQGOH VLGH IDFLQJ GRZQ *HQWO\ VKDNH WKH PDJD]LQH WR
HPSW\LWRIDQ\ORRVHGHEULV

D &KHFNWKDWWKHGDUNVOLGHRSHQVVPRRWKO\DQGFORVHVFRPSOHWHO\DQGWKDWWKH
GDUNVOLGHUHOHDVHOHYHU PDUNHG³SXVK´ SURYLGHVSRVLWLYHORFNLQJRIWKHGDUN
VOLGHLQWKHFORVHGSRVLWLRQ

D (QVXUHWKDWWKHPDJD]LQHVFDQEHLQVHUWHGDOOWKHZD\LQWRWKHLUUHVSHFWLYHVORWV
LQWKH$XWRORDGHUDQGWKDWWKH\ORFNLQWRSODFHZKHQ\RXRSHQWKHGDUNVOLGHV

D &KHFNWKHILOPVL]HVHOHFWRUNQRERQWKH5HFHLYHPDJD]LQH5RWDWHWKHNQRE
WKURXJKDOOWKUHHSRVLWLRQVWRHQVXUHWKDWLWORFNVSRVLWLYHO\IRUHDFKRIWKHWKUHH
ILOPVL]HV

D ,QVSHFWWKHHQWLUHPDJD]LQHIRUHYLGHQFHRIGHQWVHVSHFLDOO\DURXQGWKHKDQ
GOH$GHQWLQWKH6HQGPDJD]LQHPLJKWSUHYHQWWKH$XWRORDGHU¶VVXFWLRQDUP
IURPSLFNLQJXSWKHILOPFRQVLVWHQWO\

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 12 of 17

FILE TITLE Multiformat Camera SN 80001

7. CLEANING THE CRT FACE


&OHDQWKH&57IDFHHYHU\VL[PRQWKV8VHJODVVFOHDQHUDQGDFOHDQFORWK3HUIRUPWKHIROORZLQJVWHSV
WRSRVLWLRQWKH&57DQGEHOORZVDVVHPEO\VRWKDWLWLVDFFHVVLEOH

 7XUQWKHSRZHU21E\SUHVVLQJWKHSRZHUVZLWFKRQWKHIURQWRIWKHFDPHUD7KHPHVVDJH³6(/67´
6HOHFW6WDWLRQ ZLOODSSHDULQWKHPHVVDJHZLQGRZ
 3UHVVWKH67$VZLWFK7KHFRQVROHPHVVDJHZLQGRZZLOOGLVSOD\WKHFXUUHQWPRGHRIWKH0,±
 3UHVVWKH/2&.VZLWFKWRXQORFNWKHFDPHUD7KH/2&.OLJKWZLOOWXUQRII
 3UHVVWKH)07 )RUPDW VZLWFKWRJHWDUHDGRXWRIWKHFXUUHQWIRUPDW
 3UHVVWKH SOXV RU± PLQXV VZLWFKVRWKDW³)7&$/´DSSHDUVLQWKHPHVVDJHZLQGRZ
 3UHVVWKH567VZLWFKWRUHVHWWKHFDPHUDWRWKH&$/IRUPDW
 :KHQWKHVWDWHILQLVKHVUHVHWWLQJSRZHUWKHFDPHUD2))DQGXQSOXJWKHSRZHUFRUGIURPWKHUHDU
SDQHORIWKHFDPHUD2SHQWKHUHDUGRRU
 /LIWWKHEHOORZVVOLGHODWFKDQGVOLGHWKHEHOORZVWRZDUGWKHIURQWRIWKHFDELQHWWRDFFHVVWKH&57
 'DPSHQWKHFORWKZLWKJODVVFOHDQHUDQGZLSHWKH&57XQWLOLWLVFRPSOHWHO\GU\$YRLGVWUHDNLQJ
 6OLGHWKHEHOORZVFORVHGXQWLOWKHEHOORZVVOLGHODWFKFDWFKHV
,//8675$7,21 
CRT ACCESS FOR CLEANING

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 13 of 17

FILE TITLE Multiformat Camera SN 80001

8. LUBRICATING THE MOTOR DRIVES


<RXVKRXOGOXEULFDWHWKHIRXUVWHSSHUPRWRUOHDGVFUHZVDQQXDOO\LQRUGHUWRHQVXUHFRQWLQXHGVPRRWKDQG
TXLHWRSHUDWLRQ8VHDOLJKWFRDWLQJRI/LWKLXPJUHDVH 0DWUL[SDUWQXPEHU±± 

 6HOHFWWKH&$/PRGHRQWKH0,±¶VIURQWSDQHOFRQVROH7KLVZLOOH[WHQGWKHPRQLWRUEHOORZVLQVLGH
WKHFDPHUDDVIDUDVLWFDQJR2QFHWKHVWDJHKDVUHVHWWRWKH&$/SRVLWLRQSRZHUWKHFDPHUD2))
DQGUHPRYHWKHDFOLQHFRUGIURPLWVUHFHSWDFOHRQWKH3RZHUDQG6LJQDO,QSXW3DQHO

 5HPRYHWKH0,±¶VOHIWVLGHSDQHOE\ORRVHQLQJWKHWZRWXUQ'=86IDVWHQHUVRQWKHERWWRP/LIH
WKHSDQHOXQWLOLWGLVHQJDJHVDQGVWRUHLWZKHUHLWZLOOQRWJHWGDPDJHG

 7KH;DQG<D[LVOHDGVFUHZVDUHORFDWHGQHDUWKHWRSRIWKHXQLW,QVSHFWWKHVHIRUDQ\DFFXPXODWLRQ
RIGLUWRUGHEULVDQGZLSHWKHPFOHDQZLWKDOLQW±IUHHFORWK$SSO\DOLJKWFRDWLQJRI/LWKLXPJUHDVHWR
HDFKOHDGVFUHZDQGZLSHRIIDQ\H[FHVV

 7KH0DQG=OHDGVFUHZVDUHORFDWHGLQVLGHWKHPRQLWRUVWDJHDVVHPEO\<RXFDQDFFHVVWKHPIURP
WKHEDFNGRRUVLGHRIWKHFDPHUDE\OLIWLQJWKHEHOORZVVOLGHODWFKQHDUWKH&57IDFHDQGVOLGLQJWKH
EHOORZVWRZDUGWKHIURQWRIWKH0,±%RWKWKH0DQG=OHDGVFUHZVZLOOEHH[SRVHGZKHQWKHEHOORZV
LVRSHQHGXS

 ,QVSHFWERWKOHDGVFUHZVIRUDQ\DFFXPXODWLRQRIGLUWRUGHEULVDQGZLSHWKHPFOHDQZLWKDOLQW±IUHH
FORWK$SSO\DOLJKWFRDWLQJRI/LWKLXPJUHDVHWRHDFKOHDGVFUHZDQGZLSHRIIDQ\H[FHVV

 6OLGHWKHEHOORZVFORVHGXQWLOWKHEHOORZVVOLGHODWFKFDWFKHV

 5HSODFHWKHOHIWVLGHSDQHODQGFORVHWKHUHDUGRRU

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 14 of 17

FILE TITLE Multiformat Camera SN 80001

9. CLEANING THE INTAKE FAN FILTER


7KHLQWDNHIDQLVORFDWHGRQWKHRXWVLGHRIWKHSRZHUVXSSO\GUDZHU<RXPD\DFFHVVLWE\RSHQLQJWKH
UHDUGRRURIWKH0,±

WHEN?: ,QVSHFWWKHIDQILOWHUIRUGXVWEXLOGXS HYHU\WKUHHPRQWKV<RXPD\KDYHWRFOHDQ


WKHILOWHUDWVKRUWHURUORQJHULQWHUYDOVGHSHQGLQJXSRQWKHRSHUDWLQJHQYLURQPHQW

WHY?: 7KLVSUHYHQWVGXVWDQGGHEULVIURPFORJJLQJWKHLQWDNHILOWHUDQGEORFNLQJWKHIORZ
RIFRRODLULQWRWKHSRZHUVXSSO\GUDZHU

HOW?: 3RZHUWKH0,±2))DQGRSHQWKHUHDUGRRU8VHDYDFXXPFOHDQHUWRFOHDUWKH
GXVWIURPWKHRXWVLGHOD\HURIVFUHHQLQJRQWKHILOWHU7KHUHDUHDWRWDORIIRXUVFUHHQV
LQWKHILOWHUHOHPHQW,IWKHILOWHULVVHYHUHO\FORJJHGWKHQJHQWO\SUHVVGRZQRQWKH
IDQKRXVLQJDQGUHPRYHWKHRXWHUFDSWLYHSODWH<RXPD\QRZYDFXXPHDFKRIWKH
VFUHHQVLQGLYLGXDOO\'RQRWLPPHUVHWKHILOWHULQZDWHU5HSODFHWKHFOHDQILOWHU

,//8675$7,21 
CLEANING THE INTAKE FAN FILTER

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 15 of 17

FILE TITLE Multiformat Camera SN 80001

10. CHECKING THE POWER SUPPLIES


<RXVKRXOGYHULI\WKDWWKHV\VWHPSRZHUVXSSOLHVDUHZLWKLQWKHLUUDWHGVSHFLILFDWLRQHYHU\WZHOYHPRQWKV
&KHFNWKHVHDJDLQVWWKHWDEOHSURYLGHGEHORZ,IDQ\RIWKHDGMXVWDEOHVXSSOLHVDUHRXWRIWROHUDQFHWKHQ
SHUIRUPSURFHGXUHV3RZHU6XSSO\$OLJQPHQWLQ±±)RUWKHV\VWHP999DQG
±9 8OWUD+LJK/LQH5DWHPRQLWRUVRQO\ XVH73 *1' RQWKH0RQLWRU0RWKHU%RDUGDV\RXUJURXQG
UHIHUHQFHIRUWKH'90

<RXPD\JDLQDFFHVVWRWKHFRQVROHDQGXQUHJXODWHGPRWRUSRZHUVXSSOLHVE\ORRVHQLQJWKHWZRNQXUOHG
FDSWLYHVFUHZVZKLFKKROGWKHSRZHUVXSSO\GUDZHUFORVHGDQGSXOOLQJWKHGUDZHUDOOWKHZD\RXW7KHQ
ORRVHQWKHIRXU']XVWXUQIDVWHQHUVZKLFKVHFXUHWKHSRZHUVXSSO\GUDZHUFRYHUDQGUHPRYHWKHFRY
HU3RZHUWKHFDPHUD21DQGDOORZLWWRZDUPXSIRUVHYHUDOPLQXWHV

Voltage Description Allowable Range Measure At (Across)


9GF &RQVROH36 9GF P9GF 287±287WHUPLQDOVRQ&RQVROH36
9GF 6\VWHP9GF 9GF P9GF 3SLQRQ0RQLWRU0RWKHU%RDUG
9'& 6\VWHP9GF 9GF P9GF 3SLQRQ0RQLWRU0RWKHU%RDUG
±9'& 6\VWHP±9GF ±9GF P9GF 3SLQRQ0RQLWRU0RWKHU%RDUG
9'& 0RQLWRU9GF 9GF P9GF 3SLQRQ0RQLWRU0RWKHU%RDUG
±9'& 0RQLWRU±9GF 9GF P9GF -SLQRQ+RUL]RQWDO%RDUG
)±) &57)LODPHQW 9GF P9GF -SLQ ) DQG-SLQ ±) RQ&57%RDUG
9GF 8QUHJ9 9GF P9GF 287DQG±287WHUPLQDOVRQ0RWRU36
$$
8VHGLQXOWUDKLJKOLQHUDWHPRQLWRUDSSOLFDWLRQVRQO\
1RWDGMXVWDEOHIRUYHULILFDWLRQSXUSRVHVRQO\

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 16 of 17

FILE TITLE Multiformat Camera SN 80001

11. CLEANING THE MI–10’S OPTICS


7KH0,±¶VRSWLFVDUHFRQWDLQHGZLWKLQWKH&57EHOORZVDVVHPEO\7KHRSWLFHOHPHQWVLQFOXGHWKHOHQV
DQGLQVRPHFDVHVDEHDPVSOLWWHUPRXQWHGRQWKHOHQVSODWHDWWKHERWWRPRIWKHEHOORZV7KHEHDPVSOLW
WHULVSUHVHQWRQO\RQWKRVHXQLWVZKLFKKDYHWKHRSWLFDOPPFDPHUDEDFN

WHEN?: ,QVSHFWWKHRSWLFVIRUGXVWEXLOGXS HYHU\WZHOYHPRQWKV6LQFHWKH\DUHHQFORVHG


ZLWKLQWKHEHOORZVDQ\DFFXPXODWLRQVRIGXVWVKRXOGEHOLJKW

WHY?: 7KLVDOORZV\RXWRUHPRYHGXVWDQGGHEULVZKLFKFRXOGUHVXOWLQGURS±RXWVLQWKH
UHFRUGHGLPDJHV

HOW?:
D $SSO\SRZHUWRWKH0,±DQGVHOHFWWKH&$/IRUPDW

E 3RZHUWKH0,±2))DQGUHPRYHWKHDFSRZHUFRUGIURPLWVUHFHSWDFOHRQ
WKH3RZHUDQG6LJQDO,QSXW3DQHO

F 5HPRYHWKHULJKWVLGHSDQHORIWKH0,±¶VFDELQHWE\ORRVHQLQJWKHWZR']XV
WXUQIDVWHQHUVDWWKHERWWRP/LIWWKHSDQHOXQWLOLWGLVHQJDJHVDQGVWRUHLW
ZKHUHLWZLOOQRWJHWGDPDJHG

G 5HIHUWR,OOXVWUDWLRQ5HPRYHWKHIRXUVFUHZV$DQGDFFRPSDQ\LQJKDUGZDUH
%&ZKLFKVHFXUHWKHOHQVKRXVLQJDVVHPEO\WRWKHOHQVSODWH

H /LIWWKHOHQVKRXVLQJDVVHPEO\DQGWKHDWWDFKHGEHOORZV3RVLWLRQWKHPVRWKDW
\RXFDQDFFHVVWKHWRSRIWKHOHQVSODWHDQGWKHV\VWHPRSWLFV

I *HQWO\ZLSHWKHVXUIDFHRIWKHOHQV DQGEHDPVSOLWWHU ZLWKRSWLFDOOHQVSDSHU

WARNING ON SOME SYSTEMS THERE MAY BE AN ADHESIVE OPTICAL


“DOT” FIXED ON THE LENS. THIS IS INSTALLED AT THE FAC-
TORY AND YOU SHOULD NEVER REMOVE IT. DO NOT USE
HOUSEHOLD BRAND GLASS CLEANERS ON THE LENS AND
BEAM SPLITTER. THESE CAN DESTROY THE SPECIAL COAT-
INGS ON THE OPTICS ELEMENTS. USE A PROFESSIONAL
GRADE OPTICS CLEANER TO REMOVE FINGER PRINTS AND
OTHER TOUGH STAINS. DO NOT USE AEROSOL SPRAY CANS
OF COMPRESSED AIR; THESE CONTAIN PROPELLANTS
WHICH CAN ATTACK THE COATINGS ON THE OPTICS.

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 4, 1988 SERVICE NOTES Page 17 of 17

FILE TITLE Multiformat Camera SN 80001

J &DUHIXOO\RSHQWKHVKXWWHUEODGHZLWK\RXUKDQGDQGFOHDQWKHXQGHUVLGHRIWKH
OHQV

K 3RVLWLRQWKHOHQVKRXVLQJDVVHPEO\RQWKHOHQVSODWHDQGVHFXUHLWZLWKWKHKDUG
ZDUHWKDW\RXUHPRYHGLQVWHSGDERYH

L 5HSODFHWKHULJKWVLGHSDQHODQGWKHDFOLQHFRUG

,//8675$7,21 
CLEANING THE OPTICS

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

May 5, 1969 SERVICE NOTES Page 1 of 7

FILE TITLE General, Tables & Tube Stands SN 1625

COUNTERWEIGHT CABLE INSPECTION

6WHHOFRXQWHUZHLJKWFDEOHVDVXVHGLQPDQ\RIRXUSURGXFWVKDYHORDGFDUU\LQJFDSDELOLWLHVPDQ\WLPHV
WKDWRIWKHORDGVFDUULHGSURYLGHGRQO\WKDWWKHFDEOHLVLQJRRGFRQGLWLRQDQGSURSHUO\LQVWDOOHG:LWKXVH
ZHDULVLQHYLWDEOHQRUPDOO\WKRXJKLWLVUHDVRQDEO\VORZ+RZHYHULIDQ\DEQRUPDOFRQGLWLRQLVSUHVHQW
GHWHULRUDWLRQRIWKHFDEOHPD\EHJUHDWO\DFFHOHUDWHG0DQ\6(59,&(127(6KDYHVWUHVVHGWKHLPSRU
WDQFHRISHULRGLFLQVSHFWLRQDQGKDYHGHVFULEHGKRZWRGRLW

7KHIROORZLQJ³,QVSHFWLRQ5HFRPPHQGDWLRQV´ZHUHSUHSDUHGIRUXVE\WKH:LUH5RSH(QJLQHHULQJ'HSDUW
PHQWRIWKH$PHULFDQ&DEOH'LYLVLRQRIWKH$PHULFDQ&KDLQ &DEOH&RPSDQ\,QF:LONHV±%DUUH3HQQ
V\OYDQLD ,I DQ\RQH NQRZV WKH FKDUDFWHULVWLFV RI VWHHO FDEOHV WKHVH SHRSOH VKRXOG 5HDG WKH UHSRUW
FDUHIXOO\WKHQVLJQDQGUHWXUQWKHILQDOSDJHWR+HDGTXDUWHUVE\-XQH

;;;;;;;

“WIRE ROPE REPORT NO. 1448

,QVSHFWLRQ 5HFRPPHQGDWLRQV

)RU

*HQHUDO(OHFWULF&RPSDQ\
;±5D\'HSDUWPHQW

)HEUXDU\

³7KLVUHFRPPHQGDWLRQUHSRUWFRYHULQJLQVSHFWLRQSURFHGXUHVRIFRXQWHUZHLJKWFDEOHVLQXVHRQWKHYDUL
RXVPRGHOVRI*HQHUDO(OHFWULF;±5D\HTXLSPHQWZDVRULJLQDOO\RIIHUHGIRUWKHDVVLVWDQFHRI*HQHUDO
(OHFWULFILHOGSHUVRQQHO,QLWVSUHVHQWIRUPWKLVUHSRUWKDVEHHQUHLVVXHGDQGH[SDQGHGWRLQFOXGHVXSSOH
PHQWDU\LQIRUPDWLRQDVZHOODVSKRWRJUDSKV6RPHRIWKHDGGLWLRQDOLQIRUPDWLRQZLOODOVREHIRXQGKHOSIXO
LQWKHLQVSHFWLRQRILQFRPLQJPDWHULDO

³,WLVFRPPRQNQRZOHGJHWKDWDOORSHUDWLQJZLUHURSHVDUHVXEMHFWWRGHWHULRUDWLRQIURPVXFKFRPPRQ
FDXVHVDVDEXVHZHDUDQGIDWLJXHGXULQJWKHFRXUVHRIQRUPDORSHUDWLRQLQVHUYLFH$OORIWKHVHIDFWRUV
HYHQWXDOO\UHVXOWLQWKHGHYHORSPHQWRIEURNHQZLUHVRIVRPHIRUPRURWKHUDQGLIWKHEURNHQZLUHVDFFX
PXODWHLQODUJHHQRXJKQXPEHUVLQORFDOL]HGDUHDVFRPSOHWHIDLOXUHRIWKHFDEOHZLOOUHVXOW6LQFHWKHSUR
JUHVVLRQRIEURNHQZLUHVLVUHODWHGWRWLPHDQGXVDJHDQGQRUPDOO\WKH\GRQRWGHYHORSLQODUJHQXPEHUV
RYHUDVKRUWSHULRGRIWLPHWKHUHLVDZDUQLQJSHULRGEHWZHHQWKHEHJLQQLQJRIZLUHEUHDN±XSDQGFRP
SOHWHURSHIDLOXUH,WLVGXULQJWKLVSHULRGWKDWZLUHURSHLQVSHFWLRQVVKRXOGUHYHDOWKHFRQGLWLRQRIWKHFDEOH
DQGFRUUHFWLYHDFWLRQVKRXOGEHWDNHQ:HWKHUHIRUHRIIHUWKHIROORZLQJFRQGLWLRQVWREHFRQVLGHUHGLQ
VHWWLQJXSDQLQVSHFWLRQSUDFWLFH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

May 5, 1969 SERVICE NOTES Page 2 of 7

FILE TITLE General, Tables & Tube Stands SN 1625

“Frequency of Inspection
7KLVLVDYDULDEOHIDFWRULQDVPXFKDVIUHTXHQF\RIXVHRIWKHHTXLSPHQWLVLQYROYHG,WZRXOGEHRXUUHFRP
PHQGDWLRQWKDWFRXQWHUZHLJKWFDEOHVEHLQVSHFWHGRQFHHYHU\VL[PRQWKVDQGDWPRUHIUHTXHQWLQWHUYDOV
LILQWKHRSLQLRQRIWKHLQVSHFWRUWKHXVDJHRIWKHHTXLSPHQWGLFWDWHV([SHULHQFHDQGKLVWRU\RIFDEOH
GHWHULRUDWLRQPD\EHXVHGDVDIXUWKHUFULWHULRQIRUWKLVGHWHUPLQDWLRQ ,QWKLVUHJDUGLWVKRXOGEHSRLQWHG
RXWKHUHWKDWWKHQXPEHURIWLPHVWKH;±UD\KHDGLVPRYHGLVWKHLPSRUWDQWIDFWRUUDWKHUWKDQWKHQXPEHU
RIVXEMHFWV;±UD\HG

“Inspection Procedure
9LVXDOLQVSHFWLRQSOXVUXQQLQJRIWKHFDEOHWKURXJKDVRIWFORWKVKRXOGEHWKHPHWKRGVXVHGVLQFHEURNHQ
ZLUHVDQGUHVXOWVRIFDEOHDEXVHLQWKHIRUPRINLQNVGLVWRUWLRQHWFDUHWKHPDMRUW\SHVRIGHWHULRUDWLRQ
WREHGHWHFWHG

&DUHVKRXOGEHWDNHQDQGFORVHLQVSHFWLRQPDGHRIDOOFDEOHWHUPLQDWLRQV,QVSHFWIRUEURNHQZLUHVDQG
DUHDVRIZHDU([FHVVLYHZHDUQRWRQO\ZHDNHQVWKHFDEOHEXWLQIOXHQFHVWKHGHYHORSPHQWDQGUDWHRI
ZLUHIDLOXUH

³6LQFHLQDOOSUREDELOLW\WKHHQWLUHOHQJWKRIFDEOHLVVXEMHFWWRSXOOH\ZHDUDOORIWKHZLUHURSHVKRXOGEH
LQVSHFWHG

“Basis for Cable Replacement:


 %URNHQ:LUHV
&DEOHVWUHQJWKLVQRWQHFHVVDULO\LPSDLUHGE\DQRFFDVLRQDOEURNHQZLUH+RZHYHUFRQVLGHUDWLRQ
VKRXOGEHJLYHQDVWRLWVORFDWLRQOHQJWKRIWLPHWKHDVVHPEO\KDVEHHQLQVHUYLFHDQGWKHJHQHUDO
FRQGLWLRQRIWKHUHPDLQGHURIWKHFDEOH%URNHQZLUHVDWFDEOHWHUPLQDOVVKRXOGUHTXLUHLPPHGLDWH
FDEOHUHSODFHPHQW2QHRUWZREURNHQZLUHVLQWKHERG\RIWKHDVVHPEO\GXULQJLWVHDUO\SHULRGRI
XVHQHHGQRWEHFDXVHIRUUHSODFHPHQWKRZHYHUWKHVDPHQXPEHURIZLUHIDLOXUHVLQDQROGDVVHP
EO\VKRXOGMXVWLI\LPPHGLDWHUHSODFHPHQWEHFDXVHWKHUDWHRIEURNHQZLUHGHYHORSPHQWLVLQGHWHUPL
QDWHAny EURNHQZLUHGHYHORSPHQWREYLRXVO\FDXVHGE\XQXVXDOFDEOHDEXVHVKRXOGUHTXLUHFDEOH
UHSODFHPHQWDQGWKHcauseIRUWKLVFRQGLWLRQGHWHUPLQHGDQGLPPHGLDWHO\FRUUHFWHG
%HFDXVHRIWKHVHULRXVFRQVHTXHQFHRISRVVLEOHFDEOHIDLOXUHWKHLQVSHFWRUPXVWEHSUHSDUHGWRXVH
KLVMXGJPHQWUHJDUGLQJFDEOHFRQGLWLRQDQGQHYHUKHVLWDWHWRPDNHDUHSODFHPHQW6HYHUDOPRQWKV
RUDKDOI\HDU¶VDGGLWLRQDOXVDJHLVVPDOOFRPSHQVDWLRQLIWKHUHLVDQ\GDQJHURIFDEOHIDLOXUH
 /XEULFDWLRQ
$OORSHUDWLQJZLUHURSHFDEOHDVVHPEOLHVDUHOXEULFDWHGDWWKHIDFWRU\ZLWKDFRORUOHVVDLUFUDIWW\SH
OXEULFDQW7KLVOXEULFDQWKDVDGULSSRLQWRI_)ZKLFKLVKLJKHQRXJKWRHOLPLQDWHDQ\WURXEOHRI
WKLVQDWXUHZLWKQRUPDODSSOLFDWLRQTXDQWLWLHV7KLVOXEULFDQWPD\EHDSSOLHGLQWKHILHOGZKHQQHHGHG
DWQRUPDOURRPWHPSHUDWXUHVEXWVKRXOGRQO\EHXVHGZKHQDEVROXWHO\QHFHVVDU\7KHFRPPHUFLDO
QDPHRIWKLVPDWHULDOLV,URQVLGHV$&±+FRPSRXQGDQGLVSURGXFHGE\WKH,URQVLGHV&RPSDQ\&R
OXPEXV2KLR 7KHPDQXIDFWXUHUKDVDSSURYHGWKHXVHRI673IRUILHOGVHUYLFHSXUSRVHV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

May 5, 1969 SERVICE NOTES Page 3 of 7

FILE TITLE General, Tables & Tube Stands SN 1625

 :LUH6SOLFHRU-RLQW

,QWKHSURGXFWLRQRIZLUHURSHLWLVVRPHWLPHVQHFHVVDU\WRMRLQWZRZLUHVLQRUGHUWRREWDLQWKHQHFHV
VDU\ORQJFRQWLQXRXVOHQJWKRIZLUH1RUPDOO\ZLUHMRLQWVDUHPDGHE\EUD]LQJRUZHOGLQJEXWLQYHU\
VPDOOZLUHVL]HV IDQGVPDOOHU DZLUHMRLQWPDGHE\WZLVWLQJWKHHQGVRIWZRZLUHVWRJHWKHULV
FRQVLGHUHGDFFHSWDEOHSUDFWLFH6XFKVSOLFHVKRZHYHUDUHOLPLWHGLQRFFXUUHQFHDQGDUHQRWWREH
FORVHUWKDQIHHWDSDUW

$WZLVWHGZLUHVSOLFHLQWKHRXWHUOD\HURIZLUHVRIDVWUDQGZLOODSSHDULQWKHFDEOHDVLQ,OOXVWUDWLRQ
DQGRQHVXFKVSOLFHLQDQLQQHUOD\HU,QWKHODWHUFDVHWKHZLUHVSOLFHRUMRLQWEHLQJRQWKHLQVLGH
RIWKHVWUDQGZLOOWHQGWRPDNHDVOLJKWEXOJHLQWKHVWUDQGDQGRUWHQGWRVSUHDGDSDUWVHYHUDORI
WKHLQGLYLGXDOZLUHVLQWKHFRYHUOD\HURIZLUHV
 ³6WUDQGLQJ´ &RQGLWLRQ

2FFDVLRQDOO\GXULQJIDEULFDWLRQRIDVWUDQGDZLUH RUZLUHV PD\JHWRXWRISRVLWLRQRUPD\FURVV


RWKHUZLUHVDQGLWVWUXHSRVLWLRQLQWKHVWUDQGPD\WKHUHIRUHQRWEHPDLQWDLQHG7KLVFRQGLWLRQPD\
H[WHQGRYHUDGLVWDQFHRIRQO\DIHZIHHWRUHYHQDORQJTXLWHDOHQJWKRIWKHFDEOH7KLVFRQGLWLRQ
LVFRQVLGHUHGDPDQXIDFWXULQJGHIHFWDQGLVHDVLO\LGHQWLILHGE\WKHURXJKVXUIDFHRIWKHDIIHFWHG
VWUDQGLQLWVVSLUDOSDWWHUQDORQJWKHURSH,OOXVWUDWLRQGHSLFWVDQH[DPSOHRID³VWUDQGLQJFRQGLWLRQ´
EXWLWLVWREHQRWHGWKDWLWVKRZVXSLQWZRSODFHVRQO\VL[VWUDQGVDSDUWEHFDXVHLQRUGHUWRIROORZ
WKHKHOLFDOSDWKRIWKHDIIHFWHGVWUDQGLWZRXOGEHQHFHVVDU\WRURWDWHWKHFDEOH
“Additional Information on Broken Wires

$ZLUHURSHFRQWDLQLQJDEURNHQZLUHZLOOVKRZSURWUXGLQJZLUHHQGVDOWKRXJKLIWKHEUHDNLVORFDWHGLQWKH
YDOOH\EHWZHHQWZRVWUDQGVLWLVSRVVLEOHIRURQO\RQHEURNHQZLUHHQGWRVKRZDVLQ,OOXVWUDWLRQ

³$QHZDVVHPEO\FRQWDLQLQJDEURNHQZLUHVKRXOGEHVXEMHFWWRUHMHFWLRQKRZHYHUPLOLWDU\VSHFLILFDWLRQV
FRYHULQJDLUFUDIWFDEOHSXUFKDVHGLQOHQJWKVFRQVLGHUHGDVDFFHSWDEOHRQHEURNHQZLUHHQGLQHDFK
IW$VLQJOHEURNHQZLUHLQDFDEOHLVVKRZQLQ,OOXVWUDWLRQ

³$JRRGH[DPSOHRIDVHFWLRQRIFDEOHEDGO\DIIHFWHGE\IDWLJXHZLUHEUHDNVLVGHSLFWHGLQ,OOXVWUDWLRQ
$FDEOHWKLVEDGO\DIIHFWHGVKRXOGEHUHPRYHGIURPVHUYLFH,WLVWREHQRWHGWKDWDOORIWKHVHEUHDNVDUH
FURZQ±ZLUHEUHDNVDQGWKHEURNHQHQGVDUHWKHUHIRUHVKRUW

³9DOOH\ZLUHEUHDNVRFFXUGRZQLQWKHYDOOH\EHWZHHQWZRDGMDFHQWVWUDQGVDQGWKHUHIRUHDSURWUXGLQJZLUH
HQGUHVXOWLQJIURPWKLVW\SHRIEUHDNZRXOGEHORQJHUDQGZRXOGVWDQGRXWPXFKIDUWKHUIURPWKHFDEOH
WKDQDFURZQZLUHEUHDN6HH,OOXVWUDWLRQ2QO\RQHHQG±WKHORQJHQG±RIDYDOOH\ZLUHEUHDNFDQXVXDOO\
EHGHWHFWHGVLQFHWKHRWKHUHQGUHPDLQVEXULHGLQWKHYDOOH\EHWZHHQWZRDGMDFHQWVWUDQGV8QIRUWXQDWHO\
DYDOOH\ZLUHEUHDNXVXDOO\GRHVQRWYLVLEO\PDQLIHVWLWVHOIXQWLOTXLWHDQDGYDQFHGVWDJHRIGHWHULRUDWLRQ
KDVWDNHQSODFH,WLVWKHUHIRUHUHFRPPHQGHGWKDWLIRQHRUPRUHYDOOH\EUHDNVDUHGHWHFWHGWKHFDEOH
VKRXOGLPPHGLDWHO\EHUHSODFHGUHJDUGOHVVRILWVDSSHDUDQFHRWKHUZLVH,WLVDOVRWUXHWKDWYHU\RIWHQYDOOH\
ZLUHEUHDNVPD\H[LVWZLWKRXWKDYLQJWKHIUHHHQGVSULQJRXWRISODFH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

May 5, 1969 SERVICE NOTES Page 4 of 7

FILE TITLE General, Tables & Tube Stands SN 1625

³7KHUHLVVWLOORQHRWKHUW\SHRILQWHUQDOZLUHIDLOXUHZKLFKFDQQRWEHGHWHFWHGYLVXDOO\7KLVW\SHRIEUHDN
WDNHVSODFHLQWKHRXWHUZLUHVRIWKHPDLQVWUDQGVEXWXQGHUQHDWKZKHUHWKH\DUHLQFRQWDFWZLWKWKHURSH
FHQWHUPHPEHU8VXDOO\WKHVHEUHDNVFDQRQO\EHGHWHFWHGE\VODFNHQLQJWKHFDEOHDQGEHQGLQJLWRSSR
VLWHWRWKHFXUYDWXUHLWQRUPDOO\DVVXPHVRYHUWKHVKHDYHV7KLVKRZHYHULVPRVWRIWHQLPSUDFWLFDOWRGR
EHFDXVHRILQDFFHVVLELOLW\+HUHDJDLQWKHSURWUXGLQJZLUHHQGVZRXOGEHFRQVLGHUDEO\ORQJHUWKDQWKRVH
RIDFURZQRURXWVLGHW\SHRIZLUHEUHDNDQGZRXOGEHHYHQVOLJKWO\ORQJHUWKDQWKHSURWUXGLQJHQGRID
YDOOH\W\SHZLUHEUHDN³DVVKRZQLQ,OOXVWUDWLRQ6NHWFK6.±VKRZVWKHFURVV±VHFWLRQRID[
FDEOHDQGORFDWHVWKHSRVLWLRQVLQZKLFKWKHYDULRXVW\SHVRIZLUHEUHDNVGHVFULEHGDERYHRFFXU$FRPEL
QDWLRQRI,OOXVWUDWLRQVDQGVKRZVHFWLRQVRIFDEOHLQWKHH[WUHPHO\DGYDQFHGVWDJHVRIGHWHULRUDWLRQ
DQGREYLRXVO\LWZRXOGQRWEHWRRORQJEHIRUHFRPSOHWHIDLOXUHRIWKLVFDEOHFRXOGEHH[SHFWHGWRRFFXU
$WWHQWLRQLVFDOOHGWRWKHFURZQW\SHZLUHEUHDNVWKHORQJHUEURNHQZLUHHQGV YDOOH\RULQVLGHEUHDNV 
DQGDOVRWKHXQEDODQFHGFDEOHVWUXFWXUHUHVXOWLQJQRWRQO\IURPWKHXQHYHQRFFXUUHQFHVRIZLUHIDLOXUHV
EXWDOVRIURPWKHXQEDODQFHGORDGGLVWULEXWLRQZKLFKIROORZV

³:KLOHWKHYDULRXVW\SHVRIZLUHIDLOXUHVKDYHEHHQGHVFULEHGDERYHDQGDVVWDWHGVRPHRIWKHPDUHXQ
DEOHWREHGHWHFWHGE\YLVXDOH[WHUQDOLQVSHFWLRQQHYHUWKHOHVVWKHVXUIDFHGHWHULRUDWLRQDQGFRQGLWLRQRI
WKHFDEOHLQJHQHUDOFDQEHUHOLDEO\XVHGDVDEDVLVIRUFDEOHUHWLUHPHQWLIUHJXODUSHULRGLFLQVSHFWLRQV
DUHPDGHDQGH[SHULHQFHDQGJRRGMXGJPHQWDUHXVHGLQHYDOXDWLQJWKHFDEOHFRQGLWLRQ

5HVSHFWIXOO\ VXEPLWWHG
$0(5,&$1&+$,1 &$%/(&203$1<,1&

:$/2:(1
:LUH5RSH(QJLQHHULQJ'HSDUWPHQW´

352'8&76(59,&(
-96

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

May 5, 1969 SERVICE NOTES Page 5 of 7

FILE TITLE General, Tables & Tube Stands SN 1625

&52:1:,5(%5($.6 127,&($%/(
9$//(<:,5(%5($.6 127,&($%/(
21/<,)%52.(1:,5((1'3236287

&$%/(675$1'

,17(51$/:,5(%5($.6:+,&+
2&&851(;7727+(&$%/(
&25( 127,&($%/(21/<,)
%52.(1:,5((1'3236287 
&$%/(:,5(
,11(5:,5(%5($.6
127127,&($%/(

$675$1',6$%81'/(2):,5(6
7+,6&$%/(+$6675$1'62) &25(25&(17(5:,5(
:,5(6($&+ %5($.6 127127,&($%/(

SK–2469
CROSS–SECTION
7 X 19 CABLE

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

May 5, 1969 SERVICE NOTES Page 6 of 7

FILE TITLE General, Tables & Tube Stands SN 1625

,//8675$7,21 
TWISTED WIRE SPLICE IN 1 OF 12 INNER WIRES

,//8675$7,21 
TWISTED WIRE SPLICE IN 1 OF 6 INNER WIRES

81$&&(37$%/(%5($.

,//8675$7,21 
CROWN WIRE BREAKS

CROWN WIRE BROKEN ENDS

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

May 5, 1969 SERVICE NOTES Page 7 of 7

FILE TITLE General, Tables & Tube Stands SN 1625

,//8675$7,21 
VALLEY WIRE BREAKS
9$//(<:,5(%52.(1(1'6

,//8675$7,21 
INTERNAL WIRE BREAKS

,17(51$/:,5(%52.(1(1'

,//8675$7,21 
SINGLE CROWN WIRE BREAK

$&&(37$%/(21%5$1'1(:&$%/(%871272186('&$%/(

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 5, 1979 SERVICE NOTES Page 1 of 5

FILE TITLE Rotating Anode X–Ray Tubes SN 2659

PRODUCT: X–RAY TUBES

Target Appearance

;±UD\WXEHWDUJHWVOHDGDSUHWW\WRXJKOLIH'XULQJWKHPDQXIDFWXUHDQGVHDVRQLQJRIWKH;±UD\WXEHWKH
WDUJHWLVVXEMHFWHGWRKLJKHUHOHFWURQERPEDUGPHQWYHORFLWLHVDQGKLJKHUWHPSHUDWXUHVWKDWRFFXULQQRU
PDOFOLQLFDOVLWXDWLRQV

,QQRUPDORSHUDWLRQWKHWDUJHWPXVWVXUYLYHQRWRQO\WKHGLDJQRVWLFORDGLQJWHFKQLFVEXWDOVRWKHUDQGRPO\
RFFXUULQJFDEOHWUDQVIRUPHURUWXEH³WLFV´RU³VSLW]´WKDWRFFXULQDOOKLJKYROWDJHGHYLFHV

)RUWXQDWHO\WDUJHWEHDXW\LVQRWDIXQFWLRQDOUHTXLUHPHQWIRUWKH;±UD\V\VWHPVLQFHWKHIODVKKHDWLQJ
RIWKHWDUJHWVXUIDFHFDXVHYDULRXVFRVPHWLFPDUNVWRDSSHDURQWKHWDUJHWIDFH7KHVHPDUNLQJVGRQRW
DIIHFWWKHQRUPDOIXOOOLIHRSHUDWLRQRIWKH;±UD\WXEHDQGWKHLUDSSHDUDQFHVKRXOGEHFRQVLGHUHGWKHUXOH
UDWKHUWKDQWKHH[FHSWLRQ

7KHPRVWFRPPRQIODVKDQGVHDVRQLQJPDUNVDUHGHVFULEHGDVIROORZV

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 5, 1979 SERVICE NOTES Page 2 of 5

FILE TITLE Rotating Anode X–Ray Tubes SN 2659

$ 7UDFN6XUIDFLQJ&RQGLWLRQLQJ

7KLVFRQGLWLRQQRUPDOO\DSSHDUVGXULQJWKHH[WHQVLYHWXEHVHDVRQLQJSURFHVVDQGRFFXUVEHIRUHILQDO
;±UD\WXEHDFFHSWDQFHWHVWLQJ,WLVWKHUHVXOWRIWKHFRQWLQXRXVERPEDUGPHQWRIWKHWDUJHWWUDFNE\
WKHHOHFWURQEHDPZLWKWKHWDUJHWEXONWHPSHUDWXUHKLJKHQRXJKWRFDXVHPLQRUVXUIDFHHURVLRQ7KLV
SURFHGXUHLVUHTXLUHGWRHYROYHJDVHVWKDWPD\EHLQWKHEXONRIWKHWDUJHWWUDFNUHJLRQDQGWKDWLI
HYROYHGGXULQJKLJKYROWDJHRSHUDWLRQPLJKWFDXVHXQVWDEOHRSHUDWLRQ

,//8675$7,21 
TRACK SURFACE CONDITIONING

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 5, 1979 SERVICE NOTES Page 3 of 5

FILE TITLE Rotating Anode X–Ray Tubes SN 2659

% ³%OXVK´0DUNV

%OXVKPDUNVFDQEHIRXQGRQPRVWQHZ;±UD\WXEHWDUJHWVDQGFDQDSSHDUDQ\SODFHRQWKHWDUJHW
VXUIDFHIDFLQJWKHFDWKRGHHQGRIWKHWXEH7KLVFRQGLWLRQLVWKHUHVXOWRIWKHKLJKYROWDJHWXEHVHD
VRQLQJSURFHVVLQPDQXIDFWXUH7KH³EOXVK´PDUNVXVXDOO\DSSHDUDVURXQGLVKDUHDVRIDSSUR[LPDWH
O\LQFKLQGLDPHWHUWKDWUHIOHFWOLJKWGLIIHUHQWO\WKDQWKHUHVWRIWKHWUDFNRUVXUIDFH7KHVHPDUNV
DUHFDXVHGE\PLFURGLVFKDUJHVIURPILHOGHPLWWLQJSRLQWVRQWKHFDWKRGHVWUXFWXUHWKDWDUHQRWIR
FXVVHGE\WKHFDWKRGHFXS7KHPLFURGLVFKDUJHXVXDOO\EXUQVDZD\WKH³ZKLVNHU´FDXVLQJWKHILHOG
HPLVVLRQDQGLVGHVLUDEOHDVDVHDVRQLQJSURFHVV7KHEOXVKPDUNW\SHRIIODVKPHOWGRHVQRWDIIHFW
WXEHOLIHRUSHUIRUPDQFH

,//8675$7,21 
BLUSH MARKS

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 5, 1979 SERVICE NOTES Page 4 of 5

FILE TITLE Rotating Anode X–Ray Tubes SN 2659

& ³7UDFN6ODVK0DUNV´

7KLVVXUIDFHFRQGLWLRQLVVLPLODUWRWKDWGHVFULEHGDVEOXVKPDUNVH[FHSWWKDWLQWKLVFDVHWKHILHOG
HPLVVLRQPLFURGLVFKDUJHLVIRFXVVHGE\WKHFDWKRGHFXS7KLVW\SHRIPDUNXVXDOO\DSSHDUVLQWKH
WUDFNRUUXQVVOLJKWO\RXWVLGHRILW7KHPDUNDSSHDUVDVDUDGLDOO\HORQJDWHGOLQHRUDUHDRULHQWHG
SDUDOOHOWRWKHILODPHQWKDYLQJDZLGWKRIDSSUR[LPDWHO\RQHPLOOLPHWHU7KHPDUNLVWKHUHVXOWRIILHOG
HPLVVLRQPLFURGLVFKDUJHVIURPPLQXWHZKLVNHUVRQWKHILODPHQWZLUH%HFDXVHRIRULJLQDWLRQIURP
WKHILODPHQWVXUIDFHWKHILHOGHPLVVLRQLVIRFXVVHGE\WKHFDWKRGHFXSLQWRDPRUHVKDUSO\GHILQHG
DUHDRQWKHWDUJHWUHVXOWLQJLQWKHVODVKW\SHPDUN7KHDSSHDUDQFHRIWKHPDUNLVXVXDOO\YHU\GLV
WXUELQJWRWKHXQLQLWLDWHGREVHUYHUEXWVLQFHWKHIODVKPDUNKDVQRGHSWKWRLWLWGRHVQRWDIIHFWWKH
OLIHRURWKHUSHUIRUPDQFHFKDUDFWHULVWLFVRIWKHWXEH

,//8675$7,21 
SLASH MARKS

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

April 5, 1979 SERVICE NOTES Page 5 of 5

FILE TITLE Rotating Anode X–Ray Tubes SN 2659

2QH)LQDO1RWH

7KHQRUPDOPDQXIDFWXULQJSURFHVVHVDUHGHVLJQHGWRSUHSDUH;±UD\WXEHVIRURSHUDWLRQDWYROWDJHVZHOO
EH\RQGWKHPD[LPXPVSHFLILHGZRUNLQJYROWDJHV$WWLPHVV\VWHPIDXOWVVXFKDVGLVFKDUJHVLQFDEOHV
WUDQVIRUPHUVRUWXEHVFDQVHWXSRVFLOODWRU\KLJKYROWDJHH[FXUVLRQVWKDWIDUH[FHHGWKHWXEHSURFHVVLQJ
YROWDJHVUHVXOWLQJLQWXEHILHOGHPLVVLRQPLFURGLVFKDUJHV7KHUHVXOWRIWKHVHGLVFKDUJHVKRZHYHUZLOO
XVXDOO\EHWKHEOXVKW\SHRUVODVKW\SHPDUNLQJ,IWKHWXEHSHUIRUPVZLWKVDWLVIDFWRU\KLJKYROWDJHVWDELOLW\
DIWHUWKHIDXOWKDVEHHQFRUUHFWHGWKHQWKHWXEHKDVQRWEHHQGDPDJHGDQGQRUPDOOLIHPD\EHH[SHFWHG

'DWD6RXUFH(75DWH0DQDJHU;±5D\7XEH (QJLQHHULQJ

.ULVWD0XVWR
),(/'6(59,&('(9(/230(17(1*,1((5,1*

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

July 16, 1982 SERVICE NOTES Page 1 of 6

FILE TITLE mA Calibration – X–Ray Generators, 3 Phase SN 2970

7KLV6HUYLFH1RWHZDVRULJLQDOO\LVVXHGDVRQ,WLQFOXGHGFKDUDFWHULVWLFFXUYHVDQG
SDJHVRIJUDSKV$OWKRXJKLWSURYLGHGDYHU\DFFXUDWHPHWKRGRIFDOLEUDWLQJ;±UD\WXEHVZLWKYHU\IHZ
H[SRVXUHVH[SHULHQFHKDVVKRZQWKDWRQO\DIHZSHUVRQVDUHFXUUHQWO\XVLQJWKDWDSSURDFK7KHPDLQ
GUDZEDFNZDVWKDWWKHFXUYHVKDGWREHKDQGOHGFDUHIXOO\DQGFRXOGQRWEH[HUR[HGGXHWRWKHVXEVHTXHQW
GLVWRUWLRQ

$VDUHVXOWRIQXPHURXVILHOGUHTXHVWVWRUHLVVXHWKDW6HUYLFH1RWHZHKDYHFRQYHUWHGWKHFXUYHVWRWDEX
ODWHGGDWD,WWXUQVRXWWKDWWKHWDEXODWHGGDWDLVVKDPHIXOO\HDV\WRXVHFRPSDUHGWRWKHRULJLQDOFXUYHV
7KHGDWDUHSUHVHQWVW\SLFDOLQSXWRXWSXWFKDUDFWHULVWLFVIRUYDULRXV;±UD\WXEHVRQ06,067RU03;JHQ
HUDWRUV7KHSURFHGXUHGHVFULEHGEHORZDOORZVWKHGDWDWREH³QRUPDOL]HG´WRWKHVSHFLILF;±UD\WXEHEHLQJ
FDOLEUDWHG8VXDOO\WKLVWDNHVRQHRUWZRH[SRVXUHVDWDVLQJOHP$VWDWLRQ$IWHUQRUPDOL]DWLRQWKHP$
VWDWLRQVDUHDGMXVWHGWRWKHYDOXHVVSHFLILHGE\WKHWDEOHV)LQDOO\DVHULHVRIH[SRVXUHVDUHPDGHWRYHULI\
SURSHUDGMXVWPHQW8VXDOO\RUH[SRVXUHVSHUVWDWLRQDUHDOOWKDWDUHUHTXLUHG7KHSURFHGXUHLVIDVW
DFFXUDWHDQGDYRLGVWKHSUREOHPVRIHPLVVLRQFKDUDFWHULVWLFVKDIWGXHWRDQRGHKHDWLQJ

8QIRUWXQDWHO\WKHGDWDLVROGDQGGRHVQRWFRYHUPDQ\QHZHUW\SHVRI;±UD\WXEHV7KLVLVZKHUH\RXFDQ
KHOS$V\RXJDWKHUGDWDRQWXEHVQRWOLVWHGKHUH\RXFDQGRWKHHQWLUHILHOGRUJDQL]DWLRQDIDYRUE\VHQGLQJ
WKHGDWDWRKHDGTXDUWHUV2QO\GDWDWKDWLVSUHVHQWHGLQDIRUPDWVLPLODUWRWKHDWWDFKHGGDWDZLOOEHDF
FHSWHG:HZLOODFFXPXODWHDYHUDJHDQGWDEXODWHWKHGDWD7KLVVHUYLFHQRWHZLOOEHUHLVVXHGSHULRGLFDOO\
WRNHHSWKHGDWDFXUUHQWZLWKWKHW\SHVRI;±UD\WXEHVLQWKHILHOG

<RXPD\ILQGWKDWWKHUHLVQRQHHGIRUDGGLWLRQDOGDWDKRZHYHUVLQFHSDVWH[SHULHQFHKDVVKRZQWKDW
VRPHWXEHIDFWRUVVXFKDVWDUJHWDQJOHGRQRWDOWHUWKHVKDSHRIWKHFKDUDFWHULVWLFFXUYHV2IWKHRULJLQDO
FXUYHVSUHVHQWHGLQ61WKHUHZHUHDFWXDOO\RQO\DERXWVL[GLVWLQFWO\GLIIHUHQW VKDSHV

PROCEDURE:

 )LQGWKHWDEOHIRUWKHSDUWLFXODU;±UD\WXEH\RXDUHFDOLEUDWLQJRUXVHRQHVLPLODUWRLW

 6HOHFWDPLGUDQJHP$VWDWDLRQDWDN9SZKHUHVSDFHFKDUJHFRPSHQVDWLRQLV]HUR

 0DNHDQH[SRVXUHDQGFDUHIXOO\PHDVXUHWKH;±UD\WXEHRXWSXWFXUUHQWDQGWKHLQSXWFXUUHQWWRWKH
SULPDU\RIWKHILODPHQWWUDQVIRUPHU $&P$PHWHULQVHULHVZLWK;/RU;6 $WUXH506PHWHULVSUH
IHUUHGEXWQRWHVVHQWLDO

 (QWHUWKHRXWSXWFXUUHQWULJKWRQWKHWDEOHLQWKHDSSURSULDWHVSDFHHJLIWKHRXWSXWZDVP$
UHFRUGWKLVEHWZHHQWKHP$DQGP$ILJXUHV(QWHUWKHLQSXWFXUUHQWGLUHFWO\RSSRVLWHWKH
RXWSXWFXUUHQWHQWU\

NOTE: 6WHSVDQGUHSUHVHQWDFODVVLFDOHQJLQHHULQJDSSURDFK,QWKHWLPHLWWDNHV\RXWRUHDGWKDW
\RXFDQ³WZHDN´WKHFRQWURODQG]HURLQRQWKHFRUUHFWRXWSXW:KHQ\RXJHWWKHUHQRWHWKH
LQSXWDV³FRUUUHFWLQSXWYDOXH´<RXFRXOGWKHQVNLSWR6WHS

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

July 16, 1982 SERVICE NOTES Page 2 of 6

FILE TITLE mA Calibration – X–Ray Generators, 3 Phase SN 2970

 'HWHUPLQHDFRUUHFWRUIDFWRUIRUWKHLQSXWFXUUHQWDVIROORZV1RWHWKHGLIIHUHQFHEHWZHHQWKHWDEXODWHG
YDOXHVGLUHFWO\DERYHDQGEHORZWKHUHFRUGHGHQWU\RQWKHRXWSXWFROXPQ/LNHZLVHQRWHWKHGLIIHUHQFH
EHWZHHQWKHWDEXODWHGYDOXHVGLUHFWO\DERYHDQGEHORZWKHUHFRUGHGHQWU\LQWKHLQSXWFROXPQ'LYLGH
WKHVHFRQGGLIIHUHQFHE\WKHILUVWGLIIHUHQFHWKLVLVWKHLQSXWRXWSXWUHODWLRQLQWKHDUHDRIWKHH[SRVXUH
HJLIWKHWDEOHLQGLFDWHVWKDWWKHRXWSXWZLOOJRIURPP$WRP$ZKHQWKHLQSXWJRHVIURP
WRP$WKHQ\RXZRXOGGLYLGHP$LQSE\P$RXWSXWWRJHW±P$LQSSHUP$RXW8VH
WKLVILJXUHWRFRUUHFWWKHLQSXWYDOXHDVIROORZV1RWHWKHGLIIHUHQFHEHWZHHQWKHREVHUYHGRXWSXWDQG
WKHGHVLUHGRXWSXWJP$±P$ P$ KLJK 0XOWLSO\WKLVYDOXHE\WKHUHODWLRQVKLSFDOFX
ODWHGDERYH
P$LQS
HJP$RXW[  P$LQS
P$RXW
7KHUHVXOWLQJQXPEHULVWKHDPRXQWE\ZKLFKWKHLQSXWVKRXOGEHFKDQJHGWRREWDLQWKHFRUUHFWRXWSXW
7KHKDUGSDUWLVRYHU

 &KDQJHWKHLQSXWDVLQGLFDWHGE\WKHSUHYLRXVFDOFXODWLRQDQGYHULI\WKDWWKHFRUUHFWRXWSXWLVRE
WDLQHG,IQHFHVVDU\PDNHDPLQRUDGGLWLRQDODGMXVWPHQWDQGUHFRUGWKHILQDOYDOXHRIWKHLQSXWUH
TXLUHGIRUFRUUHFWRXWSXW7KLVVKRXOGEHUHFRUGHGLQWKHLQSXWFROXPQGLUHFWO\DFURVVIURPWKHFRUUHFW
RXWSXWYDOXH LQWKHDERYHFDVHGLUHFWO\DFURVVIURPWKHP$SRLQW 

 1RWHWKHGLIIHUHQFHEHWZHHQWKHYDOXHHQWHUHGDV³FRUUHFWLQSXW´DQGWKHYDOXHRULJLQDOO\LQGLFDWHG
E\WKHWDEOH7KLVLV\RXU³RIIVHW´$GGRUVXEWUDFWWKLV³RIIVHW´WRHDFKLQSXWYDOXHLQWKHWDEOHWRJHQHU
DWHDQHZWDEOHRILQSXWYDOXHVO7KHVHLQSXWYDOXHVZLOOJHQHUDOO\SURYLGHRXWSXWVZLWKLQRUSHUFHQW
RIGHVLUHGYDOXHV 6(((;$03/( 

 6HWXSWKHP$VWDWLRQVXVLQJWKHQHZWDEOHRILQSXWV0DNHQRH[SRVXUHXQWLODOOVWDWLRQVDUHDGMXVWHG

 0DNHH[SRVXUHVDWHDFKP$VWDWLRQWRYHULI\SURSHUDGMXVWPHQW0LQRUDGMXVWPHQWVPD\EHUHTXLUHG
YHU\PLQRU 
MSI MX–100 1.0 mm 11_
(;$03/(P$VWDWLRQVHOHFWHG)LUVWH[ mA Output mA Input (fil. pri.)
SRVXUHPHDVXUHVP$&RQWURODGMXVWHG
  
WRSURGXFHP$DQGLQSXWFXUUHQWQRWHGWR
  
EHP$7KLVLVP$OHVVWKDQWKHYDOXH
VSHFLILHGLQWKHWDEOHVRPM$LVVXEWUDFWHG   
IURPHDFKYDOXHWRJHQHUDWHDQHZWDEOH   
  
  
  
  
  
  
  
  

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

July 16, 1982 SERVICE NOTES Page 3 of 6

FILE TITLE mA Calibration – X–Ray Generators, 3 Phase SN 2970

MSI MX–75 0.6 mm 15_ MST/MPX MX–75 0.6 mm 15_


mA Output mA Input (fil. pri.) mA Output mA Input (fil. pri.)
   
   
   
   
   
MSI MX–75 1.0 mm 15_ MST/MPX MX–75 1.0 mm 15_
mA Output mA Input (fil. pri.) mA Output mA Input (fil. pri.)
   
   
   
   
   
   
   
MSI MX–75 1.5 mm 15_ MST/MPX MX–75 1.5 mm 15_
mA Output mA Input (fil. pri.) mA Output mA Input (fil. pri.)
   
   
   
   
   
   
   
   
MSI MX–75 2.0 mm 15_ MST/MPX MX–75 2.0 mm 15_
mA Output mA Input (fil. pri.) mA Output mA Input (fil. pri.)
   
   
   
   
   
   
   
   

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

July 16, 1982 SERVICE NOTES Page 4 of 6

FILE TITLE mA Calibration – X–Ray Generators, 3 Phase SN 2970


MSI MX–75 0.6 mm 11_ MST/MPX MX–75 0.6 mm 11_
mA Output mA Input (fil. pri.) mA Output mA Input (fil. pri.)
   
   
   
   
   
MSI MX–75 1.0 mm 11_ MST/MPX MX–75 1.0 mm 11_
mA Output mA Input (fil. pri.) mA Output mA Input (fil. pri.)
   
   
   
   
   
   
   
MSI MX–100 0.6 mm 11_ MST/MPX MX–100 0.6 mm 11_
mA Output mA Input (fil. pri.) mA Output mA Input (fil. pri.)
   
   
   
   
   
   
   
   
   
   
   
   
   
   
   
   
   
   
   
   

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

July 16, 1982 SERVICE NOTES Page 5 of 6

FILE TITLE mA Calibration – X–Ray Generators, 3 Phase SN 2970

MSI MX–100 1.0 mm 11_ MST/MPX MX–100 1.0 mm 11_


mA Output mA Input (fil. pri.) mA Output mA Input (fil. pri.)
   
   
   
   
   
   
   
   
   
   
   
   
MSI MX–100 1.2 mm 11_ MST/MPX MX–100 1.2 mm 11_
mA Output mA Input (fil. pri.) mA Output mA Input (fil. pri.)
   
   
   
   
   
   
   
   
   
   
   
   
   
   

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

July 16, 1982 SERVICE NOTES Page 6 of 6

FILE TITLE mA Calibration – X–Ray Generators, 3 Phase SN 2970

MSI MX–100 1.5 mm 11_ MST/MPX MX–100 1.5 mm 11_


mA Output mA Input (fil. pri.) mA Output mA Input (fil. pri.)
   
   
   
   
   
   
   
   
   
   
   
   
   
   
 ([WUDSRODWHG

mA Output mA Input (fil. pri.)


MSI MX–125 0.3 mm 11_
mA Output mA Input (fil. pri.)
 
 
 
 
 
 
 
 
 
 ,QWHUSRODWHG

(PDQXHO93ROL]]L
),(/'6(59,&('(9(/230(17(1*,1((5,1*
:±

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

Filament Data for Maxiray 125 .3b–1.2 10_

'DWDIURP3DOR$OWR0HGLFDO&OLQLF¶V/8$06,,9

3ODFHWKLVLQIRUPDWLRQZLWK6HUYLFH1RWH

On Generator Select Boost Boost


kV mA Current (mA) Voltage (V)
 &  
 &  
   
   
   
   
   
   
   
   
   

7KLVGDWDZDVFROOHFWHGDWN9S QRVSDFHFKDUJHFRPS 

6PDOO6SRW6WDQGE\&XUUHQW P$DWYROWV
/DUJH6SRW6WDQGE\&XUUHQW P$DWYROWV

7KH WXEH XQLW WKDW WKH VDPSOH UHSODFHG KDV D /6 ILODPHQW SUREOHP WKDW
VKRZHG LWVHOI RQ DQ RKPPHWHU *HQHUDWRU LQGLFDWHG WKDW ODUJH VSRW P$V
ZHUHDERXWORZ

2OG7XEH 1HZ7XEH
/DUJH6SRW RKPV RKPV
6PDOO6SRW RKPV RKPV

7KHVHDUHYHU\URXJKILHOGPHDVXUHPHQWV

'DWDSURYLGHGE\0DUN%XVZHOO6DQ)UDQFLVFR

MSI & Omega Table Stepper

,IWDEOHLVHQJDJHGEHIRUH$1*,2LVVHOHFWHGDWWKHJHQHUDWRU VHF5DSLG
)LOP WKHUHLVDSRVVLEOHUHOD\UDFHZKLFKPD\DOORZWKHVWHSSHUWRVWHS
WKURXJKDFRPSOHWHFRQVHTXHQFHZLWKRXWSD\LQJDQ\DWWHQWLRQWRWKHJHQHU
DWRU7KHUHLVQRNQRZQVROXWLRQ:ULWHLI\RXKDYHRQH

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

Filament Data for Maxiray 125 .3–.9–1.2 hex


'DWDIURP.XDNLQL+RVSLWDO±03;
3ODFHWKLVLQIRUPDWLRQZLWK6HUYLFH1RWH

80 kVp 50 kVp 130 kVp


mA Selected Phase Boost Phase Boost Phase Boost
on Generator A–B ACV/ACMA A–B ACV/ACMA A–B ACV/ACMA
XS
      
      
      
      
      
      
      
      
      
      
       
        
   1$ 1$ 1$ 1$
XL
      
      
      
      
      
      
       
       
1XPEHUVLQ LQGLFDWHDGLIIHUHQWN9S

'DWDSURYLGHGE\7RP0DUNHUW6RXWKZHVW

Cine Filament Data for Maxiray 125 .3g–.9g–1.2


Boost ACMA Tub Phase VAC
Fil kV Prep/Run mA A–B
/6    
/6    
66    
66    

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

Filament Data for Maxiray 100 HTC .6G–.9G 7_

80 kVp 50 kVp 130 kVp


mA Selected Phase Boost Phase Boost Phase Boost
on Generator A–B ACV/ACMA A–B ACV/ACMA A–B ACV/ACMA
XS
      
      
      
      
      
      
      
      
      
      
      
      
      
      
      
      
XL
      
      
      
      
      
      
      
   ² ²  

±
PROPRIETARY TO
TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
PROPRIETARY X–RAY
REV 16
15
5(9 DIRECTION 46–019510
46–019510
',5(&7,21±
REV 17 DIRECTION

Fluoro Data

Fil. Boost Phase


kVp XRT mA ACV/ACMA A–B R/min
    
    
    

Cine Data

Fil. Boost Phase


kVp XRT mA ACV/ACMA A–B Volts
;6
   
   
;/
   
   

±
PROPRIETARY TO
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
5(9
REV 16
15 ',5(&7,21±
DIRECTION 46–019510
46–019510
REV 17 DIRECTION

January 28, 1992 SERVICE NOTES Page 1 of 15

FILE TITLE RFX/SFX Tables SN 3284

RFX/SFX TABLE
TRANSLATION CHAIN
INSPECTION AND ADJUSTMENT

APPLIES TO: $OO5);DQG6);WDEOHVVKLSSHGWRWKHILHOGSULRUWR-DQXDU\

PROBLEM: ,PSURSHUIURQWDQGUHDUWUDQVODWLRQFKDLQDGMXVWPHQW

SOLUTION: 7UDQVODWLRQFKDLQDGMXVWPHQWVRQ5);DQG6);WDEOHVDUHFULWLFDOWRSURSHUWDEOH
RSHUDWLRQ,IWKHFKDLQDGMXVWPHQWVDUHLQFRUUHFWWKHQWUDQVODWLRQFKDLQVFRXOGVOLS
RQWKHVSURFNHWVFDXVLQJDVXGGHQGURSLQWDEOHKHLJKW

8VH WKH LQVSHFWLRQ SURFHGXUH SURYLGHG DW WKH EHJLQQLQJ RI WKLV 6HUYLFH 1RWH WR
LQVSHFWWDEOHWRSDOLJQPHQWDQGFKDLQWHQVLRQ,IWKHUHDURUIURQWWUDQVODWLRQFKDLQV
DUHDGMXVWHGLQFRUUHFWO\XVHWKHDGMXVWPHQWSURFHGXUHSURYLGHGLQWKHVHFRQGSDUW
RIWKLV6HUYLFH1RWHWRDGMXVWERWKUHDUDQGIURQWWUDQVODWLRQFKDLQV

:KHQWKHLQVSHFWLRQDQGDGMXVWPHQWSURFHGXUHVDUHFRPSOHWHLQFOXGHWKLV6HUYLFH
1RWHZLWKWKH3HULRGLF0DLQWHQDQFH6FKHGXOHLQ\RXU5);RU6);PDQXDO

Translation chain adjustments are interdependent. Adjusting rear


CAUTION translation chains without first removing the front chain will result in
erroneous readings. Remove the front translation chain from both
sprockets before performing any rear chain adjustment.

,QVSHFWWKHUHDUWUDQVODWLRQFKDLQVILUVW,I\RXILQGWKDWUHDUFKDLQWHQVLRQLVLQFRUUHFW
WKHQGLVFRQQHFWWKHIURQWWUDQVODWLRQFKDLQDQGSHUIRUPWKH5);6);7UDQVODWLRQ
&KDLQ$GMXVWPHQW3URFHGXUH$OZD\VDGMXVWWKHUHDUFKDLQVILUVWEHIRUHLQVWDOOLQJ
DQGDGMXVWLQJWKHIURQWFKDLQ

Glyn Livermore John Schneble


X-Ray Service Engineering Field Service Development Engineering
(414)-548-4632
8*320-4690

±
PROPRIETARY TO
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
5(9
REV 16
15 ',5(&7,21±
DIRECTION 46–019510
46–019510
REV 17 DIRECTION

January 28, 1992 SERVICE NOTES Page 2 of 15

FILE TITLE RFX/SFX Tables SN 3284

RFX/SFX TRANSLATION CHAIN INSPECTION PROCEDURE:

Introduction
6WHSWKURXJKWKHSURFHGXUHRQWKHIROORZLQJSDJHVWRLQVSHFWFXUUHQWWUDQVODWLRQ
FKDLQDGMXVWPHQWV5HPHPEHULIDGGLWLRQDOFKDLQDGMXVWPHQWVDUHUHTXLUHGDGMXVW
WKHUHDUWUDQVODWLRQFKDLQVILUVWDQGDGMXVWWKHPRQO\DIWHUGLVFRQQHFWLQJWKHIURQW
WUDQVODWLRQFKDLQ

Section 1. Inspect the Table at Horizontal:


Check Table Top Stability
 $QJXODWH WKH WDEOH WR WKH KRUL]RQWDO SRVLWLRQ DQG FHQWHU WDEOH WRS 6HH
,OOXVWUDWLRQ

 :KHQLQWKHKRUL]RQWDOSRVLWLRQWKHWDEOHWXEVKRXOGUHVLVWDQ\HIIRUWWRFUHDWH
VLGHWRVLGHPRYHPHQW&KHFNWDEOHVWDELOLW\E\H[HUWLQJSUHVVXUHRQWDEOHWXE
VLGHVIURPWKHKHDGRUIRRWHQGSRVLWLRQ

Note: &KHFNWDEOHVWDELOLW\E\H[HUWLQJSUHVVXUHRQWDEOHWXEDQGQRWWKHWDEOH
WRSVLGHV

,IWKHUHLVQRWLFHDEOHVLGHWRVLGHWDEOHWXEPRYHPHQW\RXZLOOKDYHWRDGMXVW
WUDQVODWLRQ FKDLQV 6HH RFX/SFX TRANSLATION CHAIN ADJUSTMENT
PROCEDURE

,//8675$7,21
TABLE CENTERED AT HORIZONTAL

±
PROPRIETARY TO
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
5(9
REV 16
15 ',5(&7,21±
DIRECTION 46–019510
46–019510
REV 17 DIRECTION

January 28, 1992 SERVICE NOTES Page 3 of 15

FILE TITLE RFX/SFX Tables SN 3284

Section 2. Inspect the Rear Translation Chain:


Measure Head End Chain Tension
 $QJXODWHWKHWDEOHWR_5HIHUWR,OOXVWUDWLRQ
 8VLQJDVWHHOWDSHORFDWHDSRLQWRQWKHFKDLQI PP LQIURPWKHRXWVLGH
HGJHRIWKHKHDGHQGVSURFNHWFRYHU6HH,OOXVWUDWLRQ
 &KHFNWKDWORZHUFKDLQLVQRWUXEELQJDJDLQVWWKHORZHUFKDLQJXLGHDQGPHDVXUH
IURPWKHLQVLGHHGJHRIWRSFKDLQJXDUGWRWKHFHQWHUOLQHRIXSSHUFKDLQOLQNSLQV
DWWKHI PP SRLQW6HH,OOXVWUDWLRQ
S ,IWKHORZHUFKDLQLVQRWUXEELQJDQGXSSHUFKDLQFHQWHUOLQHLVEHWZHHQI
DQGI DQGPP IURPWKHLQVLGHHGJHRIWKHJXDUGWKHQWKHKHDG
HQGUHDUFKDLQWHQVLRQDGMXVWPHQWLVDFFHSWDEOH
S ,IWKHORZHUFKDLQLVQRWUXEELQJEXWXSSHUFKDLQFHQWHUOLQHLVEHWZHHQI
DQG±I DQGPP IURPWKHLQVLGHHGJHRIJXDUGFKDLQWHQVLRQ
DGMXVWPHQWLVERUGHUOLQH6FKHGXOHDPDLQWHQDQFHFDOOWRDGMXVWWKHFKDLQV
S ,IORZHUFKDLQLVUXEELQJRULIFKDLQFHQWHUOLQHH[FHHGV±I PP
IURPWKHLQVLGHHGJHRIJXDUGWKHQWKHFXUUHQWFKDLQWHQVLRQDGMXVWPHQWLV
XQDFFHSWDEOH5HWXUQWKHWDEOHWRKRUL]RQWDOLPPHGLDWHO\DQGDGMXVWFKDLQV
6HHRFX/SFX TRANSLATION CHAIN ADJUSTMENT PROCEDURE
,//8675$7,21
TABLE AND REAR TRANSLATION CHAIN AT + 45_

6352&.(7
0($685(72 $1'&29(5
&(17(5/,1(2)
833(5&+$,1

´0($685('
)520(1'2)
6352&.(7
&29(5
0($685()520
,16,'(('*(2)
723&+$,1*8$5'

0($685(72
&(17(5/,1(2)&+$,1
)520,16,'(('*(2)
723&+$,1*8$5'

723('*(2) HEAD
&+$,1*8$5'
END
OF TABLE

±
PROPRIETARY TO
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
5(9
REV 16
15 ',5(&7,21±
DIRECTION 46–019510
46–019510
REV 17 DIRECTION

January 28, 1992 SERVICE NOTES Page 4 of 15

FILE TITLE RFX/SFX Tables SN 3284

 $QJXODWHWKHWDEOHWR±_5HIHUWR,OOXVWUDWLRQ
Note: 2QWDEOHVLQVSHFWIRRWHQGFKDLQVZLWKWDEOHDW±_ 2WKHUZLVH
IRRWHQGLQVSHFWLRQSURFHGXUHLVLGHQWLFDOWRWKDWXVHGRQWDEOHV
 8VLQJDVWHHOWDSHORFDWHDSRLQWRQWKHFKDLQI PP LQIURPWKHRXWVLGH
HGJHRIWKHIRRWHQGVSURFNHWFRYHU6HH,OOXVWUDWLRQ
 &KHFNWKDWORZHUFKDLQLVQRWUXEELQJDJDLQVWWKHORZHUFKDLQJXLGHDQGPHDVXUH
IURPWKHLQVLGHHGJHRIWRSFKDLQJXDUGWRWKHFHQWHUOLQHRIFKDLQOLQNSLQVDWWKH
I PP SRLQW6HH,OOXVWUDWLRQ
S ,IWKHORZHUFKDLQLVQRWUXEELQJDQGXSSHUFKDLQFHQWHUOLQHLVEHWZHHQI
DQGI DQGPP IURPWKHLQVLGHHGJHRIJXDUGWKHQWKHIRRWHQG
UHDUFKDLQWHQVLRQDGMXVWPHQWLVDFFHSWDEOH
S ,IWKHORZHUFKDLQLVQRWUXEELQJEXWXSSHUFKDLQFHQWHUOLQHLVEHWZHHQI DQG
±I DQGPP IURPWKHLQVLGHHGJHRIJXDUGWKHQFKDLQWHQVLRQ
DGMXVWPHQWLVERUGHUOLQH6FKHGXOHDPDLQWHQDQFHFDOOWRDGMXVWWKHFKDLQV
S ,IORZHUFKDLQLVUXEELQJRULIFKDLQFHQWHUOLQHH[FHHGV±I PP
IURPLQVLGHHGJHRIJXDUGWKHQFKDLQWHQVLRQDGMXVWPHQWLVXQDFFHSWDEOH
5HWXUQ WKH WDEOH WR KRUL]RQWDO LPPHGLDWHO\ DQG DGMXVW FKDLQV 6HH WKH
RFX/SFX TRANSLATION CHAIN ADJUSTMENT PROCEDURE
,//8675$7,21
TABLE AND REAR TRANSLATION CHAIN AT – 45_ – 30_ FOR 30/90 TABLES)

0($685()520
6352&.(7 ,16,'(('*(2) 0($685(72
$1'&29(5 723&+$,1*8$5' &(17(5/,1(2)
833(5&+$,1

´0($685('
)520(1'2)
6352&.(7
&29(5

0($685(72
&(17(5/,1(2)&+$,1
)520,16,'(('*(2)
723&+$,1*8$5'

723('*(2)
&+$,1*8$5'
FOOT
END
OF TABLE

±
PROPRIETARY TO
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
5(9
REV 16
15 ',5(&7,21±
DIRECTION 46–019510
46–019510
REV 17 DIRECTION

January 28, 1992 SERVICE NOTES Page 5 of 15

FILE TITLE RFX/SFX Tables SN 3284

Section 3. Inspect the Front Translation Chain:


Angulate Table to Vertical
 $QJXODWHWKHWDEOHWRWKH_SRVLWLRQ5HIHUWR,OOXVWUDWLRQ
 5HDFKEHQHDWKWKHIURQWFRYHUWRFKHFNWKDWIURQWWUDQVODWLRQFKDLQLVLQSODFH
DQGWKDWIWXUQEXFNOHMDPQXWLVWLJKWHQHGVHFXUHO\6HH,OOXVWUDWLRQ
 &KHFNWKDWORZHUIURQWFKDLQLVQRWUXEELQJDJDLQVWWKHORZHUFKDLQJXLGHDQGWKDW
XSSHUIURQWFKDLQGRHVQRWFRQWDFWWKHIURQWVXSSRUW6HH,OOXVWUDWLRQ
Note: ,I UHDU WUDQVODWLRQ FKDLQ DGMXVWPHQWV DUH FRUUHFW RQO\ WKH IURQW
WUDQVODWLRQFKDLQVVKRXOGUHTXLUHDGMXVWPHQW
,IORZHUFKDLQUXEVDJDLQVWWKHWRSHGJHRIORZHUFKDLQJXDUGRULIXSSHUFKDLQ
FRQWDFWV WKH IURQW VXSSRUW WKHQ IURQW WUDQVODWLRQ FKDLQ DGMXVWPHQW LV
XQDFFHSWDEOH5HWXUQWKHWDEOHWRKRUL]RQWDODQGDGMXVWWKHIURQWFKDLQV6HHWKH
RFX/SFX TRANSLATION CHAIN ADJUSTMENT PROCEDURE
 :KHQIURQWWUDQVODWLRQFKDLQDGMXVWPHQWVDUHFRPSOHWHEHVXUHWRUHSHDWERWK
UHDUDQGIURQWWUDQVODWLRQFKDLQLQVSHFWLRQSURFHGXUHV
,//8675$7,21
TABLE AND FRONT TRANSLATION CHAIN IN VERTICAL POSITION
+($'(1'
5($&+%(1($7+
7+()5217
75$16/$7,21
&+$,1&29(56
72&+(&.&+$,1
7(16,21$1'
781%8&./(
-$0187

&+$,1$1'7851%8&./(&21),*85$7,21

7851%8&./(

)5217
6833257

&+$,1

)227(1'

±
PROPRIETARY TO
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
5(9
REV 16
15 ',5(&7,21±
DIRECTION 46–019510
46–019510
REV 17 DIRECTION

January 28, 1992 SERVICE NOTES Page 6 of 15

FILE TITLE RFX/SFX Tables SN 3284

RFX/SFX TRANSLATION CHAIN ADJUSTMENT PROCEDURE:


Introduction
8VHWKHIROORZLQJSURFHGXUHWRDOLJQDQGDGMXVWWKHUHDUDQGIURQWWUDQVODWLRQFKDLQV
5HPHPEHUWKHIURQWWUDQVODWLRQFKDLQPXVWEHUHPRYHGEHIRUHDQ\UHDUWUDQVODWLRQ
FKDLQDGMXVWPHQWVDUHPDGH
Manpower requirement
,WVKRXOGWDNHRQHVHUYLFHHQJLQHHUDERXWKRXUVWRSHUIRUPWKHWUDQVODWLRQFKDLQ
DGMXVWPHQWSURFHGXUH

Section 1. Level and Center Table:


 $QJXODWHWKHWDEOHWRKRUL]RQWDODQGFHQWHUWKHWDEOHWRS6HH,OOXVWUDWLRQ
 3ODFHDOHYHORQWKHUHDUIRRWHQGIOXRURFDUULDJHEHDULQJUDLO
 7XUQRIISRZHUDWWKHURRP¶VPDLQGLVFRQQHFW
 5HPRYHWKHIURQWDQGUHDUFKDLQFRYHUV

Note: 5HIHU WR \RXU 5);6); 6HUYLFH 0DQXDO IRU VSHFLILF LQIRUPDWLRQ
UHTXLUHGWRUHPRYHFKDLQFRYHUVDQGJXDUGVRQWKLVWDEOH

Section 2. Remove Front Translation Chain:


 /RRVHQ DQG UHPRYH WKH WXUQEXFNOH WR UHOD[ IURQW WUDQVODWLRQ FKDLQ WHQVLRQ
5HPRYHWKHFKDLQIURPKHDGDQGIRRWHQGVSURFNHWV5HIHUWR,OOXVWUDWLRQ
,//8675$7,21
TABLE CENTERED AT HORIZONTAL WITH REAR GUARDS REMOVED

±
PROPRIETARY TO
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
5(9
REV 16
15 ',5(&7,21±
DIRECTION 46–019510
46–019510
REV 17 DIRECTION

January 28, 1992 SERVICE NOTES Page 7 of 15

FILE TITLE RFX/SFX Tables SN 3284

Section 3. Check Current Rear Translation Chain Adjustments:


Measure Chain Lengths
 8VLQJDVWHHOWDSHPHDVXUHWKHGLVWDQFHIURPKHDGDQGIRRWHQGVSURFNHWD[OHV
WRWKHPDFKLQHGVXUIDFHRIFKDLQDQFKRUSRLQWV6HH,OOXVWUDWLRQ

)RRWDQGKHDGHQGPHDVXUHPHQWVPXVWEHZLWKLQI PP RIHDFKRWKHU


6HH,OOXVWUDWLRQ

Note: ,IWKHVHPHDVXUHPHQWVDUHQRWHTXDOJRWR6HFWLRQAdjusting Rear


Translation Chain

,//8675$7,21
MEASURE CHAIN LENGTHS

6/,'(7$3(0($685(
%(+,1'*($56(&725

&+$,1
$1&+25

)227(1' +($'(1'

$;/( $;/(

*($56(&725
0$&+,1('
685)$&(

)227(1' +($'(1',1&+ PP

±
PROPRIETARY TO
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
5(9
REV 16
15 ',5(&7,21±
DIRECTION 46–019510
46–019510
REV 17 DIRECTION

January 28, 1992 SERVICE NOTES Page 8 of 15

FILE TITLE RFX/SFX Tables SN 3284

Check Chain Tensions


 3ODFHDSRXQG NJ ZHLJKWRQWKHORZHUFKDLQLQFKHVLQIURPWKH
FHQWHURIWKHVSURFNHWVKDIWDWERWKKHDGDQGIRRWHQGVRIWDEOH0HDVXUHWKH
DPRXQWRIGHIOHFWLRQFUHDWHGE\WKHZHLJKWDWHDFKHQG6HH,OOXVWUDWLRQ

'HIOHFWLRQPXVWUDQJHIURPIWRI WRPP DWERWKKHDGDQGIRRW


HQGV6HH,OOXVWUDWLRQ

Note: ,IWKHVHPHDVXUHPHQWVDUHZLWKLQWKHVSHFLILFDWLRQJRWR6HFWLRQ
Adjusting Rear Translation Chain

,//8675$7,21
CHECK TENSION ADJUSTMENT

,1&+(6
PP

'()/(&7,21
72,1&+
72PP

3281'6
.J

±
PROPRIETARY TO
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
5(9
REV 16
15 ',5(&7,21±
DIRECTION 46–019510
46–019510
REV 17 DIRECTION

January 28, 1992 SERVICE NOTES Page 9 of 15

FILE TITLE RFX/SFX Tables SN 3284

Section 4. Adjusting the Rear Translation Chain:

Translation chain adjustments are interdependent. Adjusting the rear


CAUTION translation chains without first removing front chains will result in
erroneous readings. Ensure that front translation chains have been
removed from both sprockets before initiating rear chain
adjustments.

Check and Adjust Chain Lengths


 %DFNRXWFKDLQDQFKRUVHWVFUHZV6HWVFUHZVPXVWEHRXWVLGHRIFKDLQDQFKRU
ORFNLQJJURRYHVWRWXUQFKDLQDQFKRUV6HH,OOXVWUDWLRQ

 8VLQJDIRSHQHQGFKDLQZUHQFK ±3 WXUQFKDLQDQFKRUVWR


FHQWHUWKHUHDUVLGHRIWDEOH5HIHUWR,OOXVWUDWLRQVDQG

)RUHDFKIRIYDULDQFHEHWZHHQKHDGDQGIRRWHQGPHDVXUHPHQWVWLJKWHQ
WKHFKDLQDQFKRURQWKHORQJVLGHDQGEDFNRXWWKHFKDLQDQFKRURQWKHVKRUW
VLGHRQHIXOOWXUQ

7KH UHDU WUDQVODWLRQ FKDLQ LV SURSHUO\ DGMXVWHG ZKHQ IRRW DQG KHDG HQG
PHDVXUHPHQWVDUHZLWKLQI PP RIHDFKRWKHU

,//8675$7,21
LOOSEN LOCKING SCREW

&+$,1 6(7
$1&+25 6&5(:
±
PROPRIETARY TO
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
5(9
REV 16
15 ',5(&7,21±
DIRECTION 46–019510
46–019510
REV 17 DIRECTION

January 28, 1992 SERVICE NOTES Page 10 of 15

FILE TITLE RFX/SFX Tables SN 3284

Check and Adjust Chain Tension


 8VLQJDIRSHQHQGFKDLQZUHQFK ±3 EDFNRIIRUWLJKWHQERWK
FKDLQDQFKRUVDQHTXDOGLVWDQFH7KHWHQVLRQDGMXVWPHQWLVFRUUHFWZKHQD
SRXQGZHLJKW NJ SODFHGI PP LQIURPKHDGDQGIRRWHQGVSURFNHW
FHQWHUVGHIOHFWVWKHFKDLQIWRI WRPP 5HIHUWR,OOXVWUDWLRQVDQG


 &KHFNWKHUHDUWUDQVODWLRQFKDLQDOLJQPHQWWRHQVXUHWKDWWDEOHLVVWLOOFHQWHUHG
ZLWKLQI PP ,IDGGLWLRQDOFHQWHULQJDGMXVWPHQWVDUHUHTXLUHGEHVXUH
WR FKHFN FKDLQ WHQVLRQ DIWHU WKH UHDU VLGH RI WKH WDEOH LV FHQWHUHG 6HH
,OOXVWUDWLRQVDQG

 $OLJQFKDLQDQFKRUJURRYHVZLWKWKHVHWVFUHZKROHV6HH,OOXVWUDWLRQ,QVWDOO
VHWVFUHZVWRVHFXUHFKDLQDQFKRUV

,//8675$7,21
ADJUST CHAIN ANCHORS

,1&+
:5(1&+

±
PROPRIETARY TO
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
5(9
REV 16
15 ',5(&7,21±
DIRECTION 46–019510
46–019510
REV 17 DIRECTION

January 28, 1992 SERVICE NOTES Page 11 of 15

FILE TITLE RFX/SFX Tables SN 3284

Section 5. Installing the Front Translation Chain:


Procedure
 %DFNRXWFKDLQDQFKRUVHWVFUHZV6HWVFUHZVPXVWEHRXWVLGHRIFKDLQDQFKRU
ORFNLQJJURRYHVWRWXUQFKDLQDQFKRUV6HH,OOXVWUDWLRQ
,//8675$7,21
LOOSEN LOCKING SCREW

SET SCREW

CHAIN ANCHOR

 8VLQJDIRSHQHQGFKDLQZUHQFK ±3 EDFNRXWERWKIURQW


WUDQVODWLRQFKDLQDQFKRUVH[DFWO\WZRIXOOWXUQV IODWV 6HH,OOXVWUDWLRQ
,//8675$7,21
ADJUST FRONT CHAIN ANCHOR

,1&+:5(1&+

&+$,1$1&+25

±
PROPRIETARY TO
PROPRIETARY TO GENERAL
GENERAL ELECTRIC
ELECTRIC COMPANY
COMPANY X–RAY
X–RAY PLANNED
X–RAY PLANNED MAINTENANCE
PLANNED MAINTENANCE
MAINTENANCE
GE MEDICAL SYSTEMS
5(9
REV 16
15 ',5(&7,21±
DIRECTION 46–019510
46–019510
REV 17 DIRECTION

January 28, 1992 SERVICE NOTES Page 12 of 15

FILE TITLE RFX/SFX Tables SN 3284

 :UDSWKHIURQWKHDGDQGIRRWHQGFKDLQVRYHUWKHLUUHVSHFWLYHVSURFNHWVEHLQJ
FDUHIXOWRDOLJQFKDLQDQGVSURFNHWSDLQWPDUNV6HH,OOXVWUDWLRQ
,//8675$7,21
POSITION THE FRONT CHAIN

3$,17
0$5.6

6352&.(7