Sie sind auf Seite 1von 226

The Definitive Guide To

tm tm

Windows Application and Server Backup 2.0


Don Jones

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

by Don Jones, Series Editor

Forseveralyearsnow,Realtimehasproduceddozensanddozensofhighqualitybooks thatjusthappentobedeliveredinelectronicformatatnocosttoyou,thereader.Weve madethisuniquepublishingmodelworkthroughthegeneroussupportandcooperationof oursponsors,whoagreetobeareachbooksproductionexpensesforthebenefitofour readers. Althoughwevealwaysofferedourpublicationstoyouforfree,dontthinkforamoment thatqualityisanythinglessthanourtoppriority.Myjobistomakesurethatourbooksare asgoodasandinmostcasesbetterthananyprintedbookthatwouldcostyou$40or more.Ourelectronicpublishingmodeloffersseveraladvantagesoverprintedbooks:You receivechaptersliterallyasfastasourauthorsproducethem(hencetherealtimeaspect ofourmodel),andwecanupdatechapterstoreflectthelatestchangesintechnology. Iwanttopointoutthatourbooksarebynomeanspaidadvertisementsorwhitepapers. Wereanindependentpublishingcompany,andanimportantaspectofmyjobistomake surethatourauthorsarefreetovoicetheirexpertiseandopinionswithoutreservationor restriction.Wemaintaincompleteeditorialcontrolofourpublications,andImproudthat weveproducedsomanyqualitybooksoverthepastyears. Iwanttoextendaninvitationtovisitusat,especially ifyouvereceivedthispublicationfromafriendorcolleague.Wehaveawidevarietyof additionalbooksonarangeoftopics,andyouresuretofindsomethingthatsofinterestto youanditwontcostyouathing.WehopeyoullcontinuetocometoRealtimeforyour educationalneedsfarintothefuture. Untilthen,enjoy. DonJones

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

IntroductiontoRealtimePublishers.................................................................................................................i Chapter1:Introduction.........................................................................................................................................1 ThePhilosophyofBackup...............................................................................................................................2 WhyBackup1.0IsNoLongerEnough.......................................................................................................3 BackupWindows............................................................................................................................................3 NonContinuous..............................................................................................................................................5 JusttheDataNottheApplication.........................................................................................................5 DisasterRecoveryIsTooInflexible........................................................................................................6 Backup1.0:TheVerdict...............................................................................................................................7 BackupBasics........................................................................................................................................................7 WhyBackUp?...................................................................................................................................................7 WhatDoYouBackUp?.................................................................................................................................8 WhenDoYouBackUp?.............................................................................................................................10 WhatTypeofBackupWillYouUse?...................................................................................................11 . WhereDoYouStoreBackups?...............................................................................................................13 ShouldYouTestBackups?.......................................................................................................................13 AreYouKeepinganEyeonYourBackups?......................................................................................14 ApproachestoBackingUp............................................................................................................................16 FileBasedBackups.....................................................................................................................................16 ImageBackups..............................................................................................................................................17 ApplicationSpecificIdeas........................................................................................................................18 OurBackup2.0WishList..............................................................................................................................21 WhatsAhead......................................................................................................................................................22 Chapter2:12HorrorStoriesWeThoughtWeHadaBackup!......................................................24 . Corruption:NotJustforPolitics.................................................................................................................24 CrackberryWithdrawal.................................................................................................................................25 ExchangeFailure...............................................................................................................................................26 ii

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

MigratingtheClusterOrNot...................................................................................................................28 . VirtuallyExchange...........................................................................................................................................29 ForWantofaCheckBox...............................................................................................................................30 . WeightLossPlan...............................................................................................................................................32 So,640KBIsntReallyEnoughforEveryone?......................................................................................32 SQLServerSyndrome.....................................................................................................................................33 PatchProblem....................................................................................................................................................35 VirtualHotSpares............................................................................................................................................36 IsitaServeroraPhotocopier?...................................................................................................................37 HorrorStoriesandtheLessonsTheyTeachUs..................................................................................39 ComingUpNext.................................................................................................................................................40 Chapter3:WholeServerBackups.................................................................................................................41 TheTechnicalDetails......................................................................................................................................41 TraditionalTechniques.............................................................................................................................42 NativeSolutions................................................................................................................................................43 WindowsBackup/WindowsServerBackup.................................................................................43 . VolumeShadowCopy/PreviousVersions......................................................................................46 TraditionalNonNativeSolutions.............................................................................................................48 . ProblemsandChallenges..............................................................................................................................49 IntheOldDays...................................................................................................................................................50 BackupTechniques.....................................................................................................................................50 RestoreScenarios........................................................................................................................................50 DisasterRecovery........................................................................................................................................51 BackupManagement..................................................................................................................................51 RethinkingServerBackups:AWishList................................................................................................52 NewandBetterTechniques....................................................................................................................52 BetterRestoreScenarios..........................................................................................................................55 iii

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

BetterDisasterRecovery..........................................................................................................................55 EasierManagement....................................................................................................................................56 Greatfor............................................................................................................................................................57 DomainControllers.....................................................................................................................................57 InfrastructureServers...............................................................................................................................58 WebServers...................................................................................................................................................58 PublicKeyInfrastructure.........................................................................................................................59 ComingUpNext.............................................................................................................................................59 Chapter4:ExchangeServerBackups...........................................................................................................60 NativeSolutions................................................................................................................................................60 ProblemsandChallenges..............................................................................................................................63 ABitAboutHowExchangeServerWorks........................................................................................63 WhyExchangeServerBackupsCanbeTricky................................................................................64 IntheOldDays...................................................................................................................................................65 BackupTechniques.....................................................................................................................................65 RestoreScenarios........................................................................................................................................66 DisasterRecovery........................................................................................................................................69 BackupManagement..................................................................................................................................69 RethinkingServerBackups:AWishList................................................................................................70 NewandBetterTechniques....................................................................................................................71 BetterRestoreScenarios..........................................................................................................................72 BetterDisasterRecovery..........................................................................................................................73 EasierManagement....................................................................................................................................73 ExchangeSpecificConcerns........................................................................................................................74 CCR.....................................................................................................................................................................74 IndividualItemRecovery.........................................................................................................................74 DeDuplication..............................................................................................................................................75 iv

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

DataCorruption............................................................................................................................................76 SearchandeDiscovery.............................................................................................................................76 ComingUpNext.............................................................................................................................................77 Chapter5:SQLServerBackups.......................................................................................................................78 NativeSolutions................................................................................................................................................78 HowSQLServerWorks.............................................................................................................................79 HowSQLServerNativeBackupWorks..............................................................................................80 ProblemsandChallenges..............................................................................................................................81 IntheOldDays...................................................................................................................................................81 BackupTechniques.....................................................................................................................................82 RestoreScenarios........................................................................................................................................83 DisasterRecovery........................................................................................................................................85 BackupManagement..................................................................................................................................86 RethinkingServerBackups:AWishList................................................................................................86 NewandBetterTechniques....................................................................................................................86 BetterRestoreScenarios..........................................................................................................................87 BetterDisasterRecovery..........................................................................................................................88 EasierManagement....................................................................................................................................90 SQLServerSpecificConcerns.....................................................................................................................91 Sprawl...............................................................................................................................................................91 LogTruncation..............................................................................................................................................92 SingleObjectRecovery,Corruption,andOffLocationRestores............................................93 ComingUpNext.............................................................................................................................................94 Chapter6:SharePointServerBackups........................................................................................................95 NativeSolutions................................................................................................................................................95 Versioning.......................................................................................................................................................96 RecycleBin.....................................................................................................................................................96 v

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

SharePointDesignerandSTSADMImport/Export.......................................................................96 SQLServerBackup......................................................................................................................................97 CentralAdministration.............................................................................................................................98 ProblemsandChallenges..............................................................................................................................99 IntheOldDays.................................................................................................................................................101 BackupTechniques...................................................................................................................................101 RestoreScenarios......................................................................................................................................102 DisasterRecovery......................................................................................................................................104 BackupManagement................................................................................................................................104 RethinkingSharePointServerBackups:AWishList......................................................................105 NewandBetterTechniques..................................................................................................................105 BetterRestoreScenarios........................................................................................................................107 BetterDisasterRecovery........................................................................................................................111 EasierManagement..................................................................................................................................111 SharePointSpecificConcerns...................................................................................................................111 SingleObjectRecovery...........................................................................................................................111 ProtectingDependencies........................................................................................................................112 ComingUpNext...........................................................................................................................................112 Chapter7:VirtualizationServerBackups.................................................................................................113 NativeSolutions..............................................................................................................................................113 ProblemsandChallenges............................................................................................................................113 IntheOldDays.................................................................................................................................................116 BackupTechniques...................................................................................................................................116 RestoreScenarios......................................................................................................................................119 DisasterRecovery......................................................................................................................................120 BackupManagement................................................................................................................................121 RethinkingServerBackups:AWishList..............................................................................................121 vi

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

NewandBetterTechniques..................................................................................................................122 BetterRestoreScenarios........................................................................................................................124 BetterDisasterRecovery........................................................................................................................127 EasierManagement..................................................................................................................................128 VirtualizationSpecificConcerns..............................................................................................................129 Performance................................................................................................................................................129 . GranularRecovery....................................................................................................................................129 GuestsandHosts........................................................................................................................................129 ComingUpNext...........................................................................................................................................130 Chapter8:OtherConcernsandCapabilities............................................................................................131 DisasterRecoveryandBareMetalRecovery.....................................................................................131 RecoveryTimes..........................................................................................................................................134 RecoveryLocations...................................................................................................................................135 WhyWaitforaDisaster?........................................................................................................................136 HighAvailability,InstantRecovery,andReplication......................................................................136 Hardware......................................................................................................................................................137 Clustering......................................................................................................................................................137 ReplicationforRedundancy..................................................................................................................138 ReplicationforOffsiteRecovery.........................................................................................................139 DataRetentionHereCometheLawyers...........................................................................................141 ComplianceandSecurityHereCometheAuditors......................................................................142 IntegratingBackup2.0withBackup1.0..............................................................................................145 BackupsasaFormofMigration...............................................................................................................146 ComingUpNext...........................................................................................................................................147 Chapter9:KeepingYourBackupsStorageArchitecture................................................................148 WhereBackupsGoStorageinBackup1.0.......................................................................................148 WhatBackedUpDataLooksLike......................................................................................................148 vii

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

TapeDrives...................................................................................................................................................150 DiskStorage.................................................................................................................................................151 RethinkingStorageforBackup2.0.........................................................................................................152 WhatBackedUpDataShouldLookLike.........................................................................................152 PhysicalStorage:Tapes,SANs,NAS,theCloud,andMore.......................................................153 RethinkingHierarchicalBackupStorage.........................................................................................154 SavingSpace.....................................................................................................................................................161 DeDuplicationofData............................................................................................................................161 CompressionofData................................................................................................................................163 WorkingwithBackedUpData.................................................................................................................164 ComingUpNext...........................................................................................................................................164 Chapter10:WhenEverythingFails:WhatsYourDisasterRecoveryPlan?.............................165 . OldSchoolDisasterRecoveryPlanning...............................................................................................165 BareMetalRecoveryandServerRebuilds.....................................................................................167 OffSiteRecovery.......................................................................................................................................171 Backup2.0sDisasterRecoveryApproach..........................................................................................172 BareMetalDisasterRecovery.............................................................................................................172 . VirtualizationasaDisasterRecoveryStrategy............................................................................173 . . RestoringApplicationstoSomeplaceElse.....................................................................................173 ColdRecovery.....................................................................................................................................174 WarmRecovery.................................................................................................................................175 HotRecovery.......................................................................................................................................177 DisasterRecoveryasaMigrationStrategy..........................................................................................179 ComingUpNext...........................................................................................................................................180 Chapter11:RedesigningBackup:IsItReallyWorthIt?....................................................................181 . LetsReview:WhatisBackup2.0?..........................................................................................................181 ABackup2.0ShoppingList........................................................................................................................187 viii

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

WhatsInvolvedinaRedesign?................................................................................................................188 CalculatingtheRealCostofYourGrandfathersBackupStrategy............................................191 TechnicalandBusinessAdvantagesofBackup2.0.........................................................................193 WholeServers.............................................................................................................................................193 Exchange.......................................................................................................................................................194 . SQLServer.....................................................................................................................................................194 SharePoint.....................................................................................................................................................194 Virtualization...............................................................................................................................................194 IsaRedesignThatExpensive?..................................................................................................................194 TacklingtheOfficePolitics.........................................................................................................................195 Conclusion:ThisIsNotYourFathersBackupPlan.........................................................................196 ComingUpNext...........................................................................................................................................197 Chapter12:TalesfromtheTrenches:MyLifewithBackup2.0.....................................................198 Backup1.0FiredOurAdministratorandBackup2.0PromotedMe.....................................198 TheCureforCrackberryWithdrawal....................................................................................................201 ExchangeFailureSuccess...........................................................................................................................202 . VirtuallyOnline...............................................................................................................................................203 Wait,WeGotThat?........................................................................................................................................206 StoptheSpindles!OrWhatever...........................................................................................................207 . EnoughIsNeverEnoughUntilItIs......................................................................................................207 SQLServerSolution.......................................................................................................................................208 Hotfixes,GoneCold........................................................................................................................................210 DeDuplicationDiscovery...........................................................................................................................211 ItsaBackupandanArchive!....................................................................................................................213 VirtualNirvana................................................................................................................................................214 Conclusion.........................................................................................................................................................215


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Copyright Statement
2010 Realtime Publishers. All rights reserved. This site contains materials that have been created, developed, or commissioned by, and published with the permission of, Realtime Publishers (the Materials) and this site and any such Materials are protected by international copyright and trademark laws. THE MATERIALS ARE PROVIDED AS IS WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE, TITLE AND NON-INFRINGEMENT. The Materials are subject to change without notice and do not represent a commitment on the part of Realtime Publishers or its web site sponsors. In no event shall Realtime Publishers or its web site sponsors be held liable for technical or editorial errors or omissions contained in the Materials, including without limitation, for any direct, indirect, incidental, special, exemplary or consequential damages whatsoever resulting from the use of any information contained in the Materials. The Materials (including but not limited to the text, images, audio, and/or video) may not be copied, reproduced, republished, uploaded, posted, transmitted, or distributed in any way, in whole or in part, except that one copy may be downloaded for your personal, noncommercial use on a single computer. In connection with such use, you may not modify or obscure any copyright or other proprietary notice. The Materials may contain trademarks, services marks and logos that are the property of third parties. You are not permitted to use these trademarks, services marks or logos without prior written consent of such third parties. Realtime Publishers and the Realtime Publishers logo are registered in the US Patent & Trademark Office. All other product or service names are the property of their respective owners. If you have any questions about these terms, or if you would like information about licensing materials from Realtime Publishers, please contact us via e-mail at

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Thefirstbackuptechnicallywasaround1951,whenthefirstgenerationofdigital computingappearedintheformofUNIVACI.Thebackups,suchastheywere,werethe punchcardsusedtofeedinstructionstothemassivemachine.Oncecomputersbeganto usemoreflexibleformsofstorage,reeltoreelmagnetictapebegantoreplacepunchcards. In1965,IBMintroducedthefirstcomputerharddrives,althoughthroughthe1970s,these devicesremainedimpracticallyexpensivetouseforbackups.Floppydiskscameintousein 1969an8inchmonsterstoringjust80kilobytesofdata.Recordablecompactdisks becameavailableintheearly1990s,andflashdrivesbecamecommonintheearlypartof the21stcentury.Shockingly,magnetictapethesecondoldestformofbackupstorageis stillinusetoday.Figure1.1showsatimelineofdatabackupstorage(excerptedfrom,andyoucanseethattapeisstillaliveandwellandhasbeen foralmost50years.

Figure1.1:Backupstoragetimeline. Theresaninterestingparalleltobedrawnhere:Despitenumeroustechnicaladvancesin storage,wecontinuetorelyononeoftheoldestmediumstostorebackups.Thesame appliestoourbackuptechniquesandprocedures:Despiteadvancesinhowweperform backups,wetendtostillusethesamedecadesoldtechniques,albeitwrappedupinpretty newtools.

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Throughoutcomputinghistory,backupshavebeenpractical,simpleprocedures:Copya bunchofdatafromoneplacetoanother.Complexitiesarisewithalwaysondatalikethe databasesusedbyExchangeServerandSQLServer,andvarioustechniqueshavebeen developedtoaccessthatformofinusedata;however,backupshaveultimatelyalways beenaboutafairlysimple,straightforwardcopy.Evenmagnetictapemuchmore advancedthaninthe1960s,ofcourseisstillaprimaryformofstorageformany organizationsbackups. IcallitBackup1.0essentiallythesamewayweveallbeenmakingbackupssincethe beginningoftime,withtheonlymajorchangesbeingthestoragemediumweuse.Although manybrightengineershavecomeupwithclevervariationsontheBackup1.0theme,its stillbasicallythesame.AndIsayitsnolongerenough.Weneedtorethinkwhywedo backups,andinventBackup2.0anewwaytobackupourdatathatmeetstodays businessneeds.Surprisingly,manyofthetechniquesandtechnologiesthatsupportBackup 2.0alreadyexistwejustneedtoidentifythem,bringthemtogether,andstartusingthem.

Letsstartwiththequestion,Whydowebackup? Isupposethefirstanswerthatcomestomindissimpleenough:Sothatwedontloseany data.Butthatsnotactuallyanaccurateanswer.Personally,Idontbackthingsupjustso theywillneverbelost;IbackthemupsothatIcancontinueusingthem.Thatsasubtle difference,butanimportantone.Ifyoureonlyconcernedaboutneverlosingdata,Backup 1.0isprobablysufficient:Copyyourdatatoalongtermstoragemediumprobably magnetictapeandstickitinavaultsomewhere.Youcouldcallitarchivingandbemore accurate,really.Butmostorganizationsarentasconcernedaboutarchivingastheyare aboutmakingsurethatdataremainsavailable,whichmeansyounotonlyneedabackup butalsoameansofrestoringthedatatousability.Sotherealanswer,formost organizations,ismorecomplicated:Sothatourdataremainsavailabletousallthetime. ThatswhereBackup1.0thebackuptechniquesandtechnologiesweveallusedforever andarestillnativetooperatingsystems(OSs)likeMicrosoftWindowscanreallyfail. Makingacopyofdataisonething;puttingthatcopybackintoproductionuseisoftentoo slow,toocomplicated,andtoomonolithic.AndthatswhereBackup1.0failsus.Aswestart consideringBackup2.0,andwhatweneedittodo,weneedtobearinmindourreal purposeforbackingup.Ultimately,wedontcareaboutthebackinguppartverymuchat allwecareabouttherestorepartalotmore.

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Ourdecadesoldbackuptechniquesarenotsufficientanymore.Theymaybegreatfor creatingbackupsalthoughinmanycases,theyarentevengoodforthatbuttheydonot excelatbringingtherightdatabackintoproductionasquicklyaspossible.Despite advancesinspecializedagents,compressednetworktransmissions,andsoforth,werestill justmakingacopyofthedata,andthatdoesntalwayslenditselfwelltorestoringthedata. Why?

Oneproblemistheneedforbackupwindows,periodsoftimeinwhichourdataisntbeing usedveryheavily,sothatwecangrabaconsistentcopyofit.Consistencyiscriticalfor backups:Allthedatainanygivencopyneedstobeinternallyconsistent.Wecantbackup halfadatabasenowandtheotherhalflaterbecausethetwohalveswontmatch.Asour datastoresgrowlargerandlarger,however,gettingafullbackupbecomesmoreandmore difficult. MicrosoftsTerraServer,whichstoresandprovidesaccesstosatellitephotographsforthe entireUnitedStates,hasadatastoreinexcessof1terabyte,andevenwithfairlyadvanced backuphardware,itstilltakesalmost8hourstobackitallup.Thatsatotaldata throughputof137GBperhourbutifthatdatawereinconstantuse,itwouldbecomeless practicaltomakeacompletecopyonaregularbasis. Asaworkaround,wecommonlyusedifferentialorincrementalbackups.Theseallowusto grabalotlessdataallatonce,makingiteasiertomakeourbackupcopy.Theproblemis thattheseignoretherealreasonwemadethebackupinthefirstplacetoenableusto restorethatdata.ConsideracommonbackupapproachthatusesSQLServersnative backupcapabilities: Sunday,fullbackup Everyweekdayevening,adifferentialbackup Everyhourduringthedayfrom8amto5pm,alogbackup

Thoseweeknightdifferentialsgrabeverythingthathaschangedsincethelastfullbackup (asopposedtoanincremental,whichgrabseverythingthathaschangedsincethelastfull orthelastincremental).IfsomethinggoeswrongonFridayat4:05pm,theresalotofdata torestore: LastSundaysfullbackupwhichwillbefairlylarge Thursdaysdifferentialwhichwillalsohavegrownquitelarge ThelogbackupsfromFridayat8am,9am,10am,11am,noon,1pm,2pm,3pm,and 4pmthatsninefilesinall,althougheachwillbefairlysmall


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Data Files

Full database backup

Log Files

Differential backup

Transaction log backup

Figure1.2:SQLServerbackuptypes. Thatsatonofworkandatonofwaitingwhiletapesandharddrivesspin,restoringall thatdata.Sure,wewonthavelostmuchjust5minutesworthofworkbutonalarge database(say,aterabyteorso),youcouldeasilybewaitingfor16hoursormore. Andthatsifthebackupsallwork.Tapedrivesandevenharddrivesarenotimmuneto corruption,errors,andfailures,andoneofthemostcommonstoriesintheworldisthe administratorwhorealizedthatthebackuptapeswerenogoodandrealizeditwhile tryingtorestorefromoneofthem.Weallknowthatweshouldtestourbackups,but honestly,doyoudoit?Outofmorethan300consultingclientsIveworkedwithinthepast 10orsoyears,oneofthemhadaregularlyscheduledplantodotestrestores.One.Less thanonepercent.Why? Well,theonecustomerwhodidregularlyscheduledtestrestoreshadadedicated administratorwhodidalmostnothingelse.Afulltestrestoreoftheirenvironment,using Backup1.0styletechniquesandtechnologies,wouldrequiretheentireITteamabouta weektoperform.Thatoneadministratorcouldtestrestorevarioussystems,oneatatime, overthecourseofamonthandthenstartover.Ithinkthatprettymuchanswersthe questionaboutwhysofewpeopletesttheirbackups.Itsasimple:Toomuchdataforfull backupsresultsinworkaroundssuchasdifferentialsandincrementalsthatcontributeto lengthyrestoretimes,whichiswhyweneverbothertotestandwhy,whentherubber hitstheroadandweneedthosebackups,nobodyishappyabouthowlongittakestograb theneededdata.

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Backup1.0hasanothermajorweakpoint:Itsalwaysapointintime.Asnapshot.Non continuous,inotherwords.ConsideroneapproachtobackingupActiveDirectory(AD), whichIseealotofmycustomersusing: FullbackupofeverydomaincontrollersSystemStateontheweekends.Thisisa quick,fairlysmallbackupevenanexceptionallylargedomaincanbebackedupin afewminutes. Ononeortwodomaincontrollers,atwicedailybackupoftheSystemState.Again, thisoperationisquick.

Theproblemisthatyoualwaysstandtoloseahalfdaysworthofworkbecauseyoure onlytakingsnapshotstwiceaday.Whatifyoujustimportedacoupleofhundrednew usersintothedomain,addedthemtogroups,andassignedthemfilepermissionson variousfileservers?Losingthatworknotonlymeansyouhavetostartover,italsomeans youvegotorphanSecurityIdentifiers(SIDs)floatingaroundonallthosefilepermission AccessControlLists(ACLs).Youllnotonlyhavetorepeatyourwork,youllalsohaveto cleanupallthoseACLs. BusinessestendtodesignbackupstrategiesaroundtheconceptofHowmuchdataarewe willingtolose,andhowmuchworkarewewillingtorepeat?Theresoftenalotless considerationaboutHowquicklydowewanttorestorethedata?andmuchtomy irritation,almostnobodythinkstoanswer,Wedontwanttoloseanydataorrepeatany work!Backup1.0hasconditionedustoacceptdatalossandrepeatedworkasinevitable, andsowedesignbackupschemesthattradeoffbetweentheinevitablelossofdataandthe amountofbackupresourceswewanttodevote.Frankly,theattitudethatIhavetoaccept datalossandrepeatedworkisnonsense.Icantbelievethat,adecadeintothe21stcentury, wereallsocomplacentaboutthatattitude.

AnotherproblemwithBackup1.0isthatweoftentendtojustbackupdatadatabases, files,SystemState,orwhateverwerarelybackuptheapplicationsthatusethedata.I,andabout95%ofthe respondentssaidtheydontbackupapplicationsbecausetheykeeptheoriginal installationmediasothattheycanalwaysreinstalltheapplicationifnecessary. Really?Letsthinkaboutthat:MicrosoftExchangeServertakesabout45minutestoan hourtoinstallproperly.Thenyouhavetoapplythelatestservicepackanotherhalfhour orsoandanypatchesreleasedsincetheservicepackcallthatanother20to30minutes. Thenyoucanstartrestoringthedata,whichmaytakeanotherfewhours.Ifyoure rebuildinganentireserver,ofcourse,youllhavetostartwithreinstallingWindowsitself, anditsservicepackandpatches,whichwilladdanother2or3hourstotheprocess.The total?Maybeafullworkday.Andforsomereason,peoplefindthatacceptablebecause Backup1.0isallaboutarchiving,really,notrestoring.

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Onevalidcounterargumentisthatmostrestorationsareforjustthedata,orevenapartof thedata(likeasingledatabasetable,orasingleemailmessage),andarentafullon disasterrecoveryrebuild.Well,okaybutdoesthatmeanitsstillacceptableforafullon disasterrecoveryrebuildtotakeafullday?Typicallynot,andthatswhysome organizationswillimagetheirservers,usingsoftwarethattakesasnapshotoftheentire harddriveandoftencompressesittoasmallersize.Usedforyearsasadeployment technique,itworkswellforbackingupanentireserver.Forbackinguptheserverbutoften notrestoringit.Snapshot,orpointintime,imagestaketimetoproduce,andtheserver mayevenhavetobeshutdowntomakeanimagemeaningyoullneedafrequent maintenancewindow.Atraditionalsnapshotimagewontcontainthelatestdata,soeven afterrestoringtheimage,youstillhavetorelyontraditionalbackupstogetyourmost recentdataback.Itjustamazesmethatweaccepttheselimitations.

Closelyrelatedtothepreviousdiscussionisthefactthatpeopledobackupsfortwo differentreasons.Reasonone,whichIthinkisprobablymorecommonlycitedasareason tobackupistorestoresmallpiecesofdata.Youvedoubtlessdonethis:Restoredasingle filethatsomeonedeletedbyaccident,oranemailmessage,oradatabasetable.Nearly everyonehasdealtwiththis,anditisntdifficulttosellthisreasontomanagementwhen acquiringbackuptechnologies. ThesecondreasonisforwhatIcalledfullondisasterrecoveryintheprevioussection. Thisiswhenanentireserveror,goodnesshelpyou,anentiredatacenterislost,and hastoberestoredonsiteoratadifferentlocation.Unfortunately,thislevelofdisasteris actuallyquiterare,anditsatoughsellformanagementiftheorganizationhasnt encounteredthistypeofdisasterinthepast. TheultimateproblemisthatBackup1.0technologieslendthemselvestooneortheother scenariosbutnotusuallytoboth.Inotherwords,ifyouhaveaproductthatdoesgreat baremetalrecovery,itmaynotdosingleitemrecoveryaswell.Someproducts compromiseanddoanokayjobatbothbackinguptheentireservertoenablebaremetal recovery(andoftenprovidingbootableCDsorothertechniquessothatyoucaninitiatea baremetalrecovery),andthenkeepingaseparateindexofeverybackeduppieceofdata tomakesingleitemrecoveryeasier.Frankly,Ivenotusedmanysolutionsthatdoagreat jobatbothtasksandthefactthattheyreallessentiallysnapshotbasedstillmakesthem prettylimited.Ineverwanttohavetoagreethatlosingacertainamountofworkis acceptable.

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Ifyourejustarchivingdata,Backup1.0isprettyawesome.Itstartstofail,though,when youneedtorestorethatdata,andwanttodosoinanefficientmannerthatenablesboth singleitemandfullondisasterrecoveryrestoration.Thesnapshotorientednatureof Backup1.0meansyourealwaysatriskoflosingsomework,andthatsnapshotoriented naturealsoimposesrigidrequirementsformaintenanceandbackupwindowswindows thatmightnotalwaysbeinthebusinessbestinterests. Soletsrethinkbackup.Iwanttogobacktobasicsandreallydefinewhatbackupsshould do.ConsiderthisdefinitionawishlistforBackup2.0.

IhavenodoubtthatyoureaprettyexperiencedadministratororITmanager,andyou mightnotthinkthatbackupbasicsisaparticularlyenticingsection.Bearwithme.Illtry tokeepeachofthefollowingsectionssuccinct,butIreallywanttostepbackfromthe existingtechnologiesandtechniquestofocusonwhatpeopleandbusinessesnot softwarevendorswanttheirbackupprogramstodo.Wevebeendoingbackupsmoreor lessthesamewayforsolongthatIthinkitsbeneficialtojustforgeteverythingweve learnedanddoneandstartoverwithoutanyassumptionsorpreconceptions.

Wevecoveredthistopicprettywell,butletmestateitclearlysothattheresnoconfusion: Backupsshouldpreventusfromlosinganydataorlosingany work,andensurethatwealwayshaveaccesstoourdatawith aslittledowntimeaspossible. Thatstatementimpliesafewbasicbusinesscapabilities: Whenaproblemoccurs,wewanttoexperienceaslittledatalossaspossible Weneedtobeabletorecoverdataasquicklyaspossible Weplaceequalimportanceonrecoveringasinglebitofdataaswedoindealing withacompletedisaster

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

ThestatementalsomeansafewthingstraditionallyassociatedwithBackup1.0probably arentacceptable: Snapshotsthatgrabonlyacertainpointintimeimagearelessdesirable Anysystemthatisweightedtowarddisasterrecoveryortowardsingleitem recoveryislessdesirableweneedbothcapabilities Anysystemthatrequireslengthy,multisteprestoreprocessesislessdesirable Backupsthatdonotlendthemselvestosomeformofphysicallyprotectedstorage arelessdesirable Backupsthatrequirehoursandhourstocompletewillrequirehoursandhoursto restorebothofwhicharelessdesirable


EventherelativelyprimitivebackupsoftwareincludedwithWindowsServer2003(and priorversionsofWindows)understoodthatyoudontalwaysneedtobackupeverything everytimeyourunabackup.Figure1.3showshowthatutilityallowedyoutoselectthe itemsyouwantedtobackuporrestoreauserinterface(UI)duplicatedinsomeformby mostcommonlyusedbackupsoftware.

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure1.3:SelectingwhattobackuporrestoreinWindowsBackup. Sowhatdoyoubackup?Onanygivenserver,youhavemanychoices: Backuptheentireservereveryfileoneverydisk Backupjustdatasharedfiles,applicationdatabases,andsoforth Backupapplicationsandtheirdataincludingtheapplicationsexecutablefilesand settings BackuptheOSanditssettingsbutnotanyapplicationfilesoranydata

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Thepermutationsarepracticallylimitless.Ifyouresimplyafterarchivingcreating backups,thatisthenanythingthatgrabsthedataisfine.Infact,justgrabbingthedatais probablyallyouneedtodoifallyouwanttodoiscreateapointintimesnapshotfor archivalpurposes.Sure,youcouldbackuptheentireserverandifyourgoalistobeable tohandleafullondisasterorrecoverindividualitems,thenbackinguptheentireserver wouldprovidebothcapabilities.Butbackinguptheentireserverwouldprobablytakealot longer.Itmightnotevenbeentirelypossiblebecausetherewillalwaysbesomeopenfiles, runningexecutables,andotheritemsthatBackup1.0stylebackuptechniquescantgetto. Somaybebackinguptheentireserverisntreallypractical.Afterall,wecanalways reinstalltheOSandanyapplicationsfromtheiroriginalmedia,right? Wait,asecondletsgobacktowhywerebackingup: Backupsshouldpreventusfromlosinganydataorlosingany work,andensurethatwealwayshaveaccesstoourdatawith aslittledowntimeaspossible. Okay,thisstatementclearlyindicatesthatweneedtograbthedata,butthatlastphrase haveaccesstoourdatawithaslittledowntimeaspossibleaddssomethingimportant. Inordertoaccessourdata,weneedtheOSandassociatedapplicationstobeupand running!AdatabackupisuselesswithoutanapplicationandOStorestoreitto.Ivealready explainedwhyrebuildingaserverusingtheinstallationmediaissoslowyouhaveto performlengthyinstalls,theninstallservicepacksandpatches,andthenrestoreyourdata. Thistellsme,then,thatourbackupmustbeoftheentireserver.Afterall,Imnotjusthere toarchivemydataIalsoneedtobeabletorestoreitquickly,andgetaccesstoitquickly, andthatmeansIneedtorestoretheOSandanyapplicationsquickly.Soregardlessof practicalityfornowImgoingtosaythatbackinguptheentireserveristheonlywayto go.Ijustneedtofigureouthowtodoitquickly.

HowoftenwillIbemakingbackups?UnderBackup1.0,thiswasarealquestion.Often,you mighttakeafullbackupduringaneveningorweekendmaintenancewindow,thengrab smallerbackupsmorefrequently.WhenIstartedoutinIT,IwasanAS/400operator. Everyevening,wemadetapebackupsofourmostimportantdatafilesfromtheAS/400;on weekends,weranafullbackupoftheentiresystem.Backingupthedatafilestookafew hours,andwehadtodoitintheeveningafterprettymuchalltheworkforthedaywas finishedbecausethedatawasunavailablewhilethebackupswererunning(infact,we prettymuchkickedeveryoneoffthesystemwhilebackupswerebeingdone).Theweekend fullbackupscouldtakeafullday,andeveryonehadtobeofflinethen. ButmaintenancewindowsareaBackup1.0concept,soletsdisregardthem.Infact,lets reviewourwholereasonforbeinghereonemoretime: Backupsshouldpreventusfromlosinganydataorlosingany work,andensurethatwealwayshaveaccesstoourdatawith aslittledowntimeaspossible.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Rightthereismyanswer:fromlosinganydataorlosinganywork.Thattellsmethe Backup1.0methodofpointintimesnapshotsisuselessbecausenomatterhowoftenIm makingincrementalordifferentialbackups,Imstillgoingtobeatriskforlosingsomework ordata,andthatsnotacceptable. Soifyouask,Whenwillyoumakebackups?IhavetoanswerAlways.Literally continuousbackups.Infact,theindustryalreadyhasatermforit:continuousdata protection.Althoughspecifictechniquesvary,youcanthinkofthisveryroughlyas beingsimilartoRAID1drivemirroring.InaRAID1array,asFigure1.4shows,thedrive controllerwritesblocksofdatatotwo(ormore)harddrivesatonce.Disk2isacomplete, blocklevelbackupofDisk1.RestoringisfastsimplyswapthetwoifDisk1goesbellyup.

Figure1.4:RAID1diskmirroring. Ofcourse,RAID1isgoodforacertaintypeofscenariobutitisntpracticalforallsituations, anditdoesntmeetallourbackuprequirements.Forone,serverdisksarestillpretty expensive.Inaserverusingalargenumberofdisks,mirroringeveryoneofthemisnt practical.SomeorganizationswillsetupaRAID5arrayandthensetupasecondarrayto mirrorthefirstbutthatcanbeincrediblyexpensive.Afurtherproblemisthatthebackup diskscoexistwiththeprimarydisks,sothebackupdisksarestillatriskfordamagedueto fire,flood,andotherphysicalthreats.Further,amirrorisonlyabackupforthecurrent conditionoftheprimarydisk:Youcantrollbacktoapreviouspointintime.Somirroring aloneisagreattoolforcertainsituations,butitisntacompletebackupsolution.Whatitis, though,isagoodideaforhowtomakecontinuousbackups.Wejustneedtoleveragethe techniqueabitdifferently.

Fullbackup?Differential?Incremental?IhavetosaynoneofthesebecausethoseBackup 1.0termsareassociatedwithpointintimesnapshots,andwerenotgoingtousethose. Instead,weregoingtouseaBackup2.0technique,borrowingfromtheRAID1conceptof blocklevelmirroring.Partofcontinuousdataprotection,wellcallthisblocklevelbackups. Figure1.5showshowitmightwork.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure1.5:Agentbasedblockbackups. Here,asoftwareagentofsomekindrunsontheserver.Asblocksarechangedondisk,this agenttransmitsthoseblockstoabackupserver,whichstoresthem.Thatservermight storeblocksformanydifferentservers.Theagentwouldlikelytapintoaverylowlevelof theOStoaccomplishthis.Thebenefits: Wecanhavenearlyrealtimebackupsofallchanges,astheyhappen Wegettheentireserver,notjustthedata Wecanstoremorethanjustthecurrentblocks;infact,wecanstorechangesasfar backaswewant,meaningwecanrestoreanygivenfilewhichconsistsofmultiple diskblockstoanypointintimewewant Wecanrestoretheentireserverbysimplywritingallthelatestbackedupblocksto aservereithertheoriginalserverorareplacement Intheeventofcorruptedblocks,wemightstillbebackingthoseupbutwevealso gotolder,noncorruptversionsofthosesameblocks,sowecanpotentiallyrepair filesthathavebecomecorruptedtotheirmostrecent,noncorruptedpointintime

Thisispowerfulmagic,butitsareality:Todaysmarketincludessolutionsthatfollowthis technique.ItdeliversBackup2.0:continuousbackupsthataredesignedforrestores,notfor archiving.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Doyouneedoffsitestorageofyourbackups?Probablyyes.In1996,ParisbasedCredit Lyonnaishadafireintheirheadquarters.Administratorsranintotheburningbuildingto rescuebackuptapesbecausenothingwasstoredoffsite.Letmewritethatagain:Ranintoa burningbuilding.Folks,fireisaconstantpossibility,asisthepossibilityofdamagefrom floods(badplumbinganyone?)andotherdisasters.Ifthedataisworthbackingup,its worthkeepingcopiessomewhereelse.Attheveryleast,havesomesortofonsitestorage thatsdisasterproofawaterprooffiresafe,forexample.Doesthatmeanyouhavetouse magnetictape?No,butyouprobablywill,simplybecauseitsrelativelyinexpensive,fairly durable,andeasytoworkwith.Youlllikelyendupusingtapeinconjunctionwith somethingelse,infact,withtapesbeingthesortoflastresortplacetorestorefrom.The pointisthis:Dontassumethatamajordisasterwillnotstrikeyou.Pastperformanceis noguaranteeoffutureresults;justbecauseyouveneverbeenhitbyadisasterbefore doesntmeanyouwontbehitbyoneeventually.Thatswhypeoplebuyinsurancepolicies, andbackupsarebasicallyaformofinsurance. IntermsofBackup2.0,wemightcombineourblockbasedbackupswithsometapebased storage.Ourbackupserver,forexample,mightperiodicallydumpallitsbackedupblocks toatapearray,allowingustocarryasnapshotoffsiteforarchivalpurposesandtoprotect againstatotaldisastertoourdatacenter.

Thisisatrickquestion.Theansweris,Ofcourse.AsIvealreadyexplained,though,few folksactuallydo.Why?Well,therearereallyafewreasons,manyofwhicharerelatedto ourBackup1.0mindset. First,asImentionedearlier,isthetimecommitment.Spendinghoursdoingatestrestore isntinmostfolksbudgetsthesedays.Ofcourse,ablockbasedrestorecanactuallybe donemorequickly:Yourestreamingtherestorefromdisksoverahighspeednetwork,not readingthemeversoslowlyfromatapedrive. Second,therestheavailabilityofhardware.Now,ifyouretestingsingleitemrecovery, mostbackupsolutionswillallowyoutorestorefilestoanylocationyouwant,soyoujust needasmallspotonanexistingfileserver.Butyoushouldalsobetestingfullondisaster recovery,whereyourestoreaserverthatwascompletelylost(say,tofire)toadifferent pieceofhardware.TheproblemisthatmanyBackup1.0stylesolutionsrequireyouto restoretoidenticalhardware,meaningyouhavetohavealotofspareserversaround.Not gonnahappen.Agoodsolutionwillletyourestoretodissimilarhardware,whichisactually morepracticalfromadisasterrecoveryperspective;anidealsolutionwillletyourestoreto avirtualizedserver,whichisabsolutelyperfect.Soyes:Testyourbackups.Regularly. Performbothsingleitemrestoresandthetypeofbaremetalrestoreyoudassociatewitha totaldisaster,ideallyutilizingmodernvirtualizationtechnologiestoeliminateorreduce theneedforextratestrestorehardware.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Virtualization:MorethanJustConsolidation AsIlldiscussinlaterchapters,virtualizationisanintegralpartoftheBackup 2.0mentality.InBackup1.0,afullsitedisastermightmeanretreatingtoa specialpurpose,leasedoffsiterecoveryfacilityandstartingalengthyrestore processusingyourmostrecentoffsitebackuptapes. InBackup2.0,thatfacilitymightliveontheInternetandconsistofoneor morevirtualizationhosts,eachrunningadozenorsovirtualservers.You streamyourlatestbackupsoverthewiretothevirtualservers,performinga barevirtualmetalrecoveryratherthanrecoveringtoactual,physical machines.Thisapproachmakesitmorepracticaltorecoverasetofservers, makesthatrecoveryfasterandcheaper(noleasedfacilities),andmakesit morepracticaltoconductoccasionaltestrunsofacompletedisaster scenario.

Doyoumonitoryourbackups?Otherthanjustcheckinganerrorlog,Imean?Youshould. Infact,checkingerrorlogsasidefrombeingincrediblyboringisthekindofoldschool Backup1.0mentalityImtryingtochangeinthisbook.Amodern,Backup2.0stylesolution shouldalertyoutoproblems,andideallymightevenintegratewithanexistingmonitoring solution,suchasMicrosoftsSystemCenterEssentialsorSystemCenterOperations Manager. Whatmightthosealertsactuallyinformyouof?Primarily,problemswiththebackups themselves,suchascorruption.Nothingsworsethansuddenlyfindingyouneedyour backupsandthenrealizingthattheyrenogoodduetocorruption;youshouldbeinformed ofcorruptionassoonasitoccurs.AgoodBackup2.0stylesolutionmightinformyouvia email,mightdropsomethinginaWindowseventlog(whichSystemCenterOperations Managercouldthenpickupandraisetoyourattention),orperformsomesimilarstyleof notification. Figure1.6showshowSystemCenterOperationsManagercanbeusedtoconfigureanalert foragiventypeofeventlogentrysuchasaneventlogentrycreatedbyyourbackup solution,alertingyoutocorruption.NotethatSystemCenterEssentialsworkssimilarlyfor thistypeofalert.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure1.6:CreatinganeventlogentryalertinSCOM. AreallywithitbackupsolutionmightevencomecompletewithaSystemCenter ManagementPack.AManagementPackisbasicallyapreconfiguredsetofrulesfor monitoringandalertingonaspecificapplication;thepacktellsSystemCenterOperations Managerwhattolookfor(suchasspecificeventlogIDs)andwhattodo(suchassending emailalerts).ButifyourbackupsolutiondoesntcomewithaManagementPack,atleast makesurethatithasitsownbuiltinfeaturesforprovidingthesetypesofnotifications.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Havingadvocatedforblocklevelbackups,Iwanttotakeastepbackandbrieflyreviewthe entiregamutofbackuppossibilities.Althoughsomeofthesedontmeetmyrequirements foragoodbackupandrecoverysystem,theynonethelessoffersomebusinessvaluethat youshouldbeawareof.

Filebasedbackupsaretheoldesttypeofbackup,andprobablystillthemostcommon.It involvessimplytakingasnapshotapointintimecopyofoneormorefiles.Thesetypes ofbackupsmayhavedifficultyworkingwithopenfiles,andtheydontcaptureeverychange madetoafiletheyjustgrabacopyofitataspecifictime. Buttheresvaluehere.Forexample,WindowsbuiltinVolumeShadowCopyfeatureis essentiallyanonserverfilebasedbackup,grabbingcopiesoffilesasuserschangethem andstoringtheminalocalcacheontheserver.Userscanaccessthesecachedfieversions ontheirown,usingWindowsExplorersPreviousVersionsfeature,asFigure1.7shows.

Figure1.7:Accessingpreviousversions. 16

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Thekeyphrasehereisontheirown.Unlikemanydatacenterclassbackupsolutions, VolumeShadowCopy/PreviousVersionsisdesignedforuserselfservice.Properlyused (meaningyouruserswillneedabitoftraining),thisfeaturecanhelppreventcallstothe Helpdeskandoverheadforyouwhenusersneedtorollbackafiletoasomewhatolder version.Infact,Iveseenthisfeatureagain,withabitofendusertrainingreduce singlefilerecoveryHelpdeskcallsby90%inseveralofmyclients.Thoseorganizationstell methattheaveragecostforcompletingafilerecoveryrequestisabout$75,andtheones thatkeepreallygoodrecordsaverageaboutfourcallsaweek.Thatsasavingsofmorethan $15,000allforfree,sincethefeatureisbuiltintoWindows(well,youdohavetospenda bitextraforthediskspaceneededtostorethecache). InaBackup2.0world,thereshouldberoomforcomplementarysolutions.Previous Versionsmeetsaspecificneed:userselfserviceforindividualfilerollback.Whateverdata centerbackupsolutionyouselectshouldntinterferewithcomplementarysolutions,andin fact,shouldembracethem.WherefilebasedbackupstendtofallshortasIve discussedisinthewholeserverbackupscenario,whichyoudbeperforminginthedata center.

ImagebackupisanothertermforwhatIvebeencallingblockbasedbackups.Thereare reallytwowaystoachieveanimagestylebackup:byusingsolutionssuchasthetriedand trueimagesnapshotsoftwareandviawhatIllcallstreamingimages. Traditionalimagingsoftware,oftenusedfordeployingoperatingsystemimagestonew computers,commonlymakespointintimesnapshotsofadisk,typicallycompressingthe diskblockssothattheresultingimagefileismuchsmaller.Thissoftwareisntusually positionedasabackupandrecoverysolutionbutratherasadeploymentsolution:You makeatemplatecomputerthemanualway,imageit,andthendeploythatimagerather thaninstallingothercomputersmanually.Itsmostcommonlyusedfordesktop deployment,anditcanserveasakindoflastditchrecoverytoolfordesktops,essentially redeployingtheimagetogetamachinebacktosquareone.Butasapointintime snapshot,itsnotusefulforcapturingdata,changestoapplications,andsoforth. Anotherweakspotisthatsnapshotimagingsoftwareusuallyrequiresthesourcecomputer tobeunavailable.Typically,theimageiscapturedusingaprebootenvironment(likethe oneshowninFigure1.8)asortofstrippeddownOSthatrunsinlieuofWindows.This ensuresthatnoneofthefilesondiskareopenandchangingsothatasingle,consistent snapshotcanbegained.Youcanseewherethiswouldbeabitburdensomeasacontinual backuptechnique.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure1.8:Imagingsoftwaresprebootenvironment. StreamingimagesarethekindofblockbasedbackupIillustratedinFigure1.5,earlierin thischapter.Thistechniqueisthebasisforalmostrealtime,continuousdataprotectionof multipleservers.Youcouldusethetechniquewithdesktopcomputers,too,althoughI suspectdoingsowouldntbepracticalitwouldinvolvealotofbackupdataflyingaround yournetwork,nottomentionalotofstorage.No,Ithinkthistechniqueisreallygeared bestforthedatacenter,whereyourebackingupserversandwhereyoucaneasilysetup highspeedorevendedicatednetworkconnectionsbetweenthoseservers.

Someapplicationsprimarilymissioncritical,alwaysonapplicationssuchasMicrosoft SQLServerandExchangeServerpresenttheirownchallengesforbackupandrecovery. Theseapplicationsexecutablesarealwaysrunning,andtheyalwayshaveseveraldatafiles open,makingitdifficultforfilelevelbackupsoftwaretogetaconsistentsnapshot.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Tohelpaddressthis,theapplicationsdesignerstakevaryingapproaches.SQLServer,for example,hasitsowninternalbackupandrecoverycapability,whichistiedtotheproducts ownuniquearchitecture.Traditionally,thebestwaytogetaSQLServerbackupistoask SQLServertodoit.Youmight,forexample,useSQLServersowntoolstoproduceabackup file,thengrabthatfilewithatraditionalfilebasedbackupsolution.Or,youmightcreatean agentthattapsintoSQLServerandgetsthedatathatwaytheapproachusedbymost enterpriselevel,Backup1.0stylebackupsolutions.Figure1.9showsacommondialogbox forabackupsolutionsconfiguration,showingthataSQLServerspecificagentisloaded andabletostreamdatafromSQLServertothebackupsoftware.ExchangeServer functionalitymightworksimilarlyinfact,youcanseethattabinthefigureaswell.

Figure1.9:Applicationspecificbackupagents. ExchangeServersdeveloperstookaslightlydifferentapproach,choosingtointegratewith WindowsVolumeShadowCopyservice.Essentially,theyprovideacopyoftheExchange datafilesthroughVolumeShadowCopy;abackupsolutionsimplyneedstoaccessthe VolumeShadowCopyApplicationProgrammingInterfaces(APIs)andrequestthelatest copyofthedatabase.Again,itsExchangeServerthatsdoingmostofthework,buta dedicatedagentofsomekindisusuallyneededtogettotherightAPIs.AsFigure1.10 shows,evenWindowsServer2008sbuiltinbackupcanbeextendedtoseetheExchange Serverdatabases. 19

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure1.10:BackingupExchangeServerinWindowsServerBackup. ThedownsideisthattheseapplicationspecificapproachesarestillBackup1.0innature, meaningtheyregrabbingasnapshot.Yourestillatriskforlosingdataandworkthat occursbetweensnapshots;particularlywiththesemissioncriticalapplications,Ithink thatsjustunacceptable. Blocklevelbackupscancertainlysolvetheproblembecausetheyregrabbingchangesat thedisklevelanddontparticularlyneedtounderstandwhatthosediskblocksarefor.A diskblockthatspartofafilelooksthesameasonethatspartofaSQLServerdatabase,so thebackupsolutionjustgrabsemall.Butfromarecoveryviewpoint,yourbackupsolution doesneedsomeadditionalsmarts.Hereswhy:Asimplefilesay,aWorddocument consistsofseveralblocksofdiskspace.Itseasytokeeptrackofwhichblocksmakeupany givenfile,andnodiskblockwilleversharedatafromtwofiles.Ifyouneedtorestore Salaries.xls,youfigureoutwhichblocksthatfileliveson,andrestorejustthose.Easy.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

WithcomplexdatastoressuchasSQLServerandExchangeServerthingsarentsoeasy. Asinglemailmessagemightoccupymultipleblocksofdiskspace,butthosesameblocks mightalsocontaindatarelatedtoothermessages.Thedatabasealsohasinternalpointers andindexesthatneedtoberestoredinorderforagivenmessagetobeaccessible.Soa blockbasedbackupdoesntneedmuchinthewayofextrasmartstomakeabackup,butit willneedsomeclevernessinordertorestoresingleitemsfromthatbackup.Solution vendorstendtoapproachthisbyusingplugins:Itseasytothinkoftheseasbeingsimilar totheBackup1.0styleagents,buttheyrenot.Thesepluginsdontnecessarilyassistwith thebackupprocess(althoughtheymayrecordspecialinformationtoassistwith recoveries),buttheydocontainthesmartsnecessarytopeerinsidecomplexdatastores torecoversingleitems.

ThefollowinglisthighlightsdesirablecapabilitiesinaBackup2.0stylebackupsolution: Continuousdataprotectionthatsalwayson,alwaysworking,andasclosetoreal timeasispractical Theabilitytomovesnapshotsofmybackupstotape(orotherportablemedia)for offsitestorage Theabilitytorestoreanythingfromasinglefiletoanentireserverquickly,andto differenthardware(orvirtualhardware)ifneeded Blocklevelimagingthatprovidestheabilitytorollbacktoanypointintimeand keepsbackupsphysicallyseparatefromthesource Automaticnotificationsofproblemssuchascorruptionwiththebackups DoesntinterferewithcomplementarysolutionssuchasWindowsownVolume ShadowCopyfeature Theabilitytoeasilytestrestores,fromasinglefiletoacompletedisaster,ideally usingdissimilarhardwareorvirtualization TheabilitytorestoresingleitemsfromcomplexstoreslikeSQLServerorExchange Server

Illaddafewthingstothislistasweprogressthroughtheupcomingchapter,butthisisa goodstart.ItrepresentseverythingthattheBackup2.0philosophyisallabout,andit meetsalltheimpliedrequirementsinourbusinesslevelstatement: Backupsshouldpreventusfromlosinganydataorlosingany work,andensurethatwealwayshaveaccesstoourdatawith aslittledowntimeaspossible.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Ivegotafullplatecomingupforyou,startingwiththenextchapterinthisbook,whereI gettosharesomeofthehorrorstoriesIverunacrosswithmyconsultingclients,inthe news,andsoforth.Itskindofinterestingtoseetheproblemsothershavehad,butitcanbe instructional,too:Illexamineeachcaseanddrawconclusionsaboutwhatwentwrongand whatyouwouldneedtodotoavoidthatsituation. Chapter3iswhereIlldiveintotheactualtechnologyofwholeserverbackups.Thisisan areawhereIthinkBackup2.0reallyhassomeimmediatebenefit,butIllstartby examiningmoretraditionalwholeserverbackuptechniquesandidentifyingthingsthat dontalwaysworksowell.Ifyoureresponsibleforbackingupdomaincontrollers, infrastructureservers,Webservers,apublickeyinfrastructure,orsimilarservers,then thisisthechapterforyou. InChapter4,IlltacklethetoughtopicofExchangeServerbackupstoughenoughthatthe backupsoftwarethatshippedwithWindowsServer2008couldntevendoit.Again,Illlay outsomeofthemoretraditionalwaysthatExchangebackupshavebeenmade,andthen rethinktheprocessandcomeupwithawishlistofbackupcapabilitiesthatincludeseveral Exchangespecificconcerns.Chapter5willfollowthesameapproachforSQLServer,and Chapter6willexamineSharePointinthesameway. Chapter7willbeabitofadeparture,asIllfocusonvirtualizationserverbackups.Thisis stillarelativelynewfield,andIlllookatwaysinwhichtraditionalbackuptechniquesare beingusedandexaminehowwelltheyreactuallygettingthejobdone.Illcoversomeof theuniqueaspectsofvirtualizationbackupsandexamineinnovativetechniquesthat Backup2.0canbringtothetable. InChapter8,Illpullbackabitforabroadlookatotherbackupconcernsandcapabilities: Baremetalrecovery,dataretentionconcerns,complianceandsecurityissues,mobile infrastructureproblems,andsoon.Illalsolookatinstanceswhereoldschoolbackups mightstillprovidesomevalue,andIllofferadviceforintegratingBackup2.0withmore traditionaltechniques. Allofthebackupsweremakingaregoingtorequiresomeseriousstorage,soIlluse Chapter9tofocusonstoragearchitecture.Illlookathowbackupdataisstructured,and comparetheadvantagesanddisadvantagesofthingslikestorageareanetworks(SANs), tapedrives,localstorage,andsoforth,andexaminepressingissuesofstorage: compression,encryption,security,deduplication,andsoon.Illalsolookatuniqueways thatBackup2.0allowsyoutointeractwithyourbackedupdatamoreeasilyandefficiently.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Chapter10willfocusondisasterrecoveryandImeanrealdisasters.Illlookatthingslike baremetalrecovery,andIllcoversomeofthemoreinterestingcapabilitiesthattodays technologiesoffer,suchasusingvirtualizationratherthandedicatedoffsitefacilitiesas partofadisasterrecoveryplan. Chapter11isforallthebusinessmindedreadersoutthere;thischapteriswhereIll discussthecostsinvolvedinrearchitectingbackupandrecoverytouseBackup2.0 techniques.Naturally,Illalsohelpyoudeterminewhetherdoingsoisactuallyworthitto yourorganization,andeventacklesomeofthenontechnicalwhatIliketocall politicalissuesthatyoumayhavetosolveinordertomakeyourbackupsituationmore modernandefficient. Finally,Chapter12willbethechanceformetosharestoriesfrommyownexperiences withBackup2.0asortoftalesfromthetrencheschapter,withcasestudiesthat describesuccesses(andchallenges)IveseenwithBackup2.0. Wehavealongjourneyaheadofus,butyouvemadeagoodstart.Ilookforwardtoseeing youagaininthenextchapter.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Chapter2:12HorrorStoriesWeThought WeHadaBackup!
Horrorstories.Talesfromthetrenches.Casestudies.Callthemwhatyouwill,Ilove readingthem.Theyrealookintoourcolleaguesrealworldlivesandtroubles,andan opportunityforustolearnsomethingfrommistakeswithouthavingtomaketheactual mistakesourselves.Inthischapter,Imgoingtosharestoriesaboutbackupstohighlight problemsthatyouyourselfmayhaveencountered.Foreach,Illlookatsomeoftheroot causesforthoseproblems,andsuggestwaysthatamodernizedBackup2.0approach mighthelpsolvetheproblem.Someofthesestoriesareculledfromonlineblogpostings (andIveprovidedtheoriginalURLwhenthatisthecase),whileothersarefrommyown personalcorrespondencewithhundredsofadministratorsovertheyears.Oneortwoare evenfrommyownexperiencesindatacenters.Names,ofcourse,havebeenchangedto protecttheinnocentandthoseguiltyofrelyingonthedecadesoldBackup1.0mentality. Theimportanttakeawayisthateachofthesestoriesoffersavaluablelesson.Canyousee yourselfandyourownexperiencesintheseshorttales?Seeifyoucantakeawaysome valuableadviceforavoidingthesescenariosinthefuture.

Illstartwiththisstory,asitsoneIimagineeveryadministratorhasbeenabletotellat leastonceintheircareers. Thismustbetheoldestbackupstoryintheworld,andyouhaveprobablyheardita milliontimes:Wedutifullytakeourbackupseverynight,eventhoughittakes foreveronthebigmachines.Whenwefinallyneedtouseone,thebackupis corrupted.Eitheritsthetape,whichisactuallyprettyrare,orsomethingwent wrongandthebackedupdataitselfisnogood.Andsothebosswantstoknowwhy weevenhavejobssincewearealluseless.Aaaah! AsIsaid,weveallbeenthere.Twoproblems,bothrelatedtotheoldschoolBackup1.0 mentality: Backupsshouldnttakeforever;theyshouldtakeconstantly.Thatis,apointintime backupisjustasnapshot.Evenifthebackupandrestoreworkperfectly,yourestill losingdata.Withcontinuousbackups,yourenotlosingdataitsreallythatsimple. Whydontbackupprogramstellyouwhentheyseecorrupteddata?Thisshouldbe thesimplestthingintheworldourindustryhashadchecksumsandothermeans ofvalidatingdataprettymuchforever.Itdrivesmecrazythatwehavetodiscover problembackupsbyporingthroughlogfiles.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Thisiswhywehavetorethinkbackups:Theyjustdontdowhatweneedthemtodo.Even whenwedoeverythingperfectly,theresahugeriskthatthebackupsjustwontwork.We needtorethinkwhatweredoing,howweredoingit,andhowweremonitoringittomake sureitworks. Ofcourse,Iwontmentionthattestingthosebackupsmighthaverevealedourauthors problembeforeheactuallyneededthosebackups.AnotherproblemwiththeBackup1.0 mentalityisthatnobody(well,hardlyanybodysomeoftheupcomingstoriesdogiveme hope)seemstotesttheirbackups.

Ifeveronedevicehasmanagedtosomehowmakeemailevenmoremissioncriticalthanit alreadywas,ResearchinMotionsBlackberryfamilymustbeit.Whensomethinggoes wrongwiththeBlackberryinfrastructure,itsaracetoseewhatyouspendmoretimeon: fixingtheproblemoransweringthephonecallsfromuserswhoaresuretheyretheonly oneswhovenoticedtheproblem: Iworkinanenvironmentthatlikeeveryone,IguessusesBlackberriesand cannotlivewithoutthemforonemoment.Theinfrastructureisactuallyvery complex:InadditiontoourExchangeServer,theresalsotheBlackberryEnterprise Server(BES)andasupportingSQLServer.Thelasttimewehadafailure,ittookus5 hourstogetbackonline,whichIthoughtwasprettygoodbuttherewasan inquisitionafterwardstofindoutwhywewereofflineforsolong.Evenwithallthe righttapebackups,doyouhaveanyideahowlongittakestorestoreaSQLServer andtheBES?Apparentlytoolongformyboss. ItstheBackup1.0mentality:Relyonthosebackuptapes,eventhoughjuststreamingthe dataoffoftapecantakehoursassumingitsallingoodshape,notcorrupted,andthatthe dataonthetapeisactuallyagoodbackupinthefirstplace.ThisisexactlywhereBackup 2.0methodologiescanmakeadifference:Withadiskblockbasedbackup,streamedinto thebackupstoreinalmostrealtime,youcanrestoreanentireservertoalmostanypointin therecentpastbypushingabutton.Does5minutessoundbetterthan5hours?By restoringintoastandbyvirtualmachine,5minutesisentirelyrealistic.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

NobodylikesitwhentheExchangeServergoesdown.Honestly,Ithinksomecompanies couldgowithoutafileserverforlongerthantheycouldlivewithoutemailespecially companieswhoseemployeeshaveBlackberries.Soheresastorytomoveyouremotions, drawnfrom day?mkt_tok=3RkMMJWWfF9wsRow5%2FmYJoDpwmWGd5mht7VzDtPj1OY6hBssJJKtUg %3D%3D: WhenmycompanysMicrosoftExchangeServerfailedattheendofthequarter,it couldnothavehappenedataworsetime.ItbeganwiththeVPofSalesyelling Emailisdown,andcustomerscantsendustheirorders!ThenmyBlackberry startedgoingoff,calls,emails,IMsitwasrelentless.WhenIloggedontothe ExchangeServer,Ifoundthatsomeofmymostcriticalmailstoreswerenolonger mounted.WhenItriedtoremountthem,IreceivedtheambiguousyetominousJET 1601JET_errRecordNotFounderrormessage.Iimmediatelyconnectedtothe replicationserverthatrunsatoneofthecompanysremotesites,onlytofindthatI couldntmountthosemailstoreseither. WhenIcalledMicrosoft,techniciansprescribedthestandardprocedureofrunning Eseutil.Theywarnedme,however,thattheerrormessageprobablyindicateda corruptionproblemdeepwithinthedatabaseandthatrunningEseutilmightresult incleaningthestoresofalluserdata.Itooktheleap,onthechancethatitwouldbe quickerthangettingtherestoreprocessunderway.RunningEseutiltookhours,then failedwiththeevenmoreambiguousJET1003JET_errInvalidParameter.Atthat point,IknewIHADtogotothebackup. MycompanyrunsfullbackupseverySaturdaynightandincrementalbackupsthe restoftheweek.Istartedbyrecoveringthemostrecentfullbackup,thenapplying theincrementalsuntilIhadthebackupfromthenightbeforethefailure.Asyoucan imagine,thecalls,emails,etc.keptcomingallthewhileIwascopyingthemailstores frommydisktodiskbackupalthoughtheydidtaperoffabitafter11:00pm,when ourWestCoastofficeclosed. Onceourdatawasbackontheprimaryserver,itwastimetorollthelogsandmount thedatabase.However,whenthelogswereabout80percentapplied,theyfailed withtheJET501JET_errLogFileCorruptmessage.Atthatpoint,Microsoft supportcouldonlysuggestrunningEseutilthroughmyentirelogchain,notingthe corruptedlog,deletinganythingexceptlogfilesfromthelogdirectory,anddeleting thecorruptedlogandallthelogscreatedthereafter.ThenIcouldfinallyrestartthe logrolloperationfromscratch.Thisproceduretookmorethan6hours.Intheend, mycompanylost2daysofemailmessages,andrecoverytookmorethan30hours. ThecauseturnedouttobeaproblemwiththeRAIDcontrollerdriverthathadtaken monthstomanifestitselfafterapreviousserverupgrade.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Executivemanagementfigureditcostthecompanyabout$50K,sotheydefinitely wantedtoknowwhathadhappenedandhowitcouldhavebeenpreventedand howitwouldbepreventedfromhappeningagain.Letsjustsaywantedtoknow meansthatifIdidnthaveagoodanswer,mynamewasgoingonthetopofthenext layofflist.Iwasseriouslycommittedtofindingabetterrecoverysolution. SohereswhatIlearnedonmyworstdayasanetworkadmin:Youcanhave multiplecopiesofyourdataonreplicatedservers,ondisk,andontapebutifyou cantmountthecopies,theyarentanygood. TheBackup1.0mentalitycostthiscompany$50,000.Why?BecausetheBackup1.0 mentalityfocusesonmakingbackups,notrestoringdata.WithBackup1.0,wetendtofocus onbackupwindows,tapedrives,andsoonwedonttendtofocusonwhatwillhappenin theeventofadisaster.Evenwiththeirbackupsand30hoursofeffort,thecompanystill lost2daysofemailsthisisabackupplan? ExchangeServeriscertainlyacomplexanddifficultproductwhenitcomestobackups.The backandforthbetweentheExchangeServerproductteam,theWindowsproductteam, andMicrosoftsownbackupproducts(intheSystemCenterfamily)meansthatExchange andWindowsalonedontofferaneffectivebackupplan.Thirdpartyvendors,however, tendtofocusonExchangespecificagentsthatjustmakecopiesofthedataashandedover byExchange.Asthishorrorstorypointsout,Exchangemightnotalwaysbehandingyou gooddata,meaningyourbackupsareuseless. SohowwouldBackup2.0changethings?WellcoverExchangeServerbackupsindetailin Chapter4ofthisbook,butfornow,letsjustcomparethissituationtomywishlistformthe previouschapter: Thisfellowssituationcouldhavebeenimprovedimmeasurablybyhaving continuousbackupsratherthanpointintimebackupsoflogfilesanddatabases. Blocklevelimaging,whichgrabsthechangesastheyhittheserversharddrives, wouldhaveprovidedanuninterruptedstreamofbackupdataallthewaytothe pointwhereExchangesdatafileswerecorrupted.Theservercouldquicklyhave beenrolledbacktothatpointintime. ExchangeServersnativebackuptechnologiescouldstillhavebeenused,ifdesired. Ourpooradmincouldhavetestedhisrestorecapabilitiesmorefrequently,been morefamiliarwiththeprocess,andlikelyspentfarlessthan30hoursgettinghis serverbackonline.

Remember:Backupsshouldpreventusfromlosinganydataorlosinganywork,andensure thatwealwayshaveaccesstoourdatawithaslittledowntimeaspossible.TheBackup1.0 mentalityoriginallyemployedinthishorrorstorycertainlydidntmeetanyofthose criteria.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Sometimes,disasterdoesntalwaysmeanafailedserver.Sometimesasolidlackof planningcanprovideallthedisasteryouneed! Wereceivedthenewserversforthenewcluster.Thejob:SwapoutanoldWindows forabrandnewone,configureit,andmoveallthefilesanddataovertothenew cluster.Thishastobedonewithinalatenightmaintenancewindow,whichmeans mywifewillnotbehappyagain,butIllbuyflowers.Starttimeisaround11:00pm, anditmustbedoneby7:00am8hours. BothclusterswouldeventuallyberunningthesameversionofWindows,onceIgot everythinginstalled.TheclusterserverscamewithnoOSinstalledatall,though,so installingWindowswouldbemyfirststep.Fortunately,theserverhardwarewas basicallythesameinbothclusters. Afterdriving300kmahorrordrivingonPolishroadsIsetuptheserver hardware.Theoldclusterishummingalongnexttome,andImreadytoget Windowsinstalled.Wherearethedrivers? Andtheproblemarose:Someonehadlosttheservermanufacturersdriversdisc.I knowwhatyourethinkingjustdownloadthem,right?Well,sufficetosaythatthis isaverysecureorganizationperhapsgovernmentalandnobodyinthebuilding atthathourcouldactuallygettotheInternet.SoIhadtopulloutmymobilephone and,despitethehighcostofdatatransfers,downloadthedriversfortheserverover the3Gcellularnetwork.Thenmyphonesbatterydiedandmewithoutmy charger. Iaskedthemaboutserverbackups,figuringwecouldperhapsjustusethoseto restoretothenewmachine,butalltheybackuparethefiles.Theysaidtheyhad neverbeenabletodoabaremetalrestoreusingtheirbackups,sotheyjuststopped backinguptheoperatingsystem(OS). Internetaccesswasavailableagainat8:00am,andsomeonehadtotakemeintothe secureareawhereInternetaccesswasavailable.Iwastired,theentirenightwas wasted,andIhadtodoitallagainthenextnightwhenIfinallyhadthedriversin hand.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Ouch!Weveallhadalatenightlikethatatsomepoint,anditsneverfun.Andthefirst thingIhavetoaskmyselfiswhytheycouldntsimplytakeabackupoftheoldcluster machinesandrestorethemonthenewhardware?BecauseintheBackup1.0world, restoringtodissimilarhardwareisoftenimpossibleoratleastnotrecommended.Asa result,manyorganizationsjustbackuptheirfilesbutabackupisuselesswithout someplacetorestoreit.AmoremodernBackup2.0mentality,however,wouldsaythatthis clustermigrationwasreallynodifferentthanabaremetalrestoreafteracompletecluster failurewhynotrestorethebackuptothenewhardware,andcallitanight?IntheBackup 2.0world,wedbetakingblocklevelbackupsoftheentireserver,sowecouldjustapply thatbackuptothenewhardware(whichweretoldwassubstantiallysimilartotheoriginal hardware)andcallitanight.Lesstimeonthejob,alowercellphonebill,andaless frustratedwife.

Itsbecomingmoreandmorecommontorunserversoftwareinsidevirtualmachines, oftenonavirtualizationhostrunningVMwareorMicrosoftsHyperV.Butyoudbe surprisedhowthisscenariomightimpactyourdisasterrecoverysituation: Afterjust2weeksonmynewjob,ourExchangeServerdecidedtooperatein comatosemodeandstopsendingandreceivingemail.Ifoundthatitwasrunning onavirtualserverandwasbeingbackedupdailybyathirdpartysoftwarepackage. IfiguredIwasfine. Thebackupadministrator,itturnsout,reallyhadnoideaabouthowExchange workedorwhat,ifanything,wasneededtocompletethebackupsproperly.The backupshadneverbeentested,soIwasstartingtothinkfondlyofmyoldjob. Iwasabletogettheserverpartiallyoperationalbutwounduphavingtocallthe softwarevendoronlytogetarefundformysupportcallandatersestatement thattheydidnt(atthetime)supportExchangerunninginavirtualenvironment. Oops. Iwounduphavingtoportmyhalffunctioningsystemtoaphysicalserverandwas eventuallyabletorecovereverythingexceptfor2daysworthofemail,whichdoes notendearyoutoyournewbosses,letmeassureyou. Notsupportedinavirtualenvironmentiskindofacheaptrickforasupportorganization topull,butithappens.Thatswhyitscriticaltoworkwithsoftwareandbackupsolutions thatexplicitlysupportvirtualenvironments.InaBackup2.0world,virtualizationis expected;anyonewhothinksthatvirtualizationisstillnovelorunusualisadinosaur.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Ofcourse,itsalsocriticaltotestthosebackups,andfranklythebackupsolutiononce installedandconfiguredshouldjustwork.Iftheressomethingspecialneededtomake avalidExchangebackup,thesolutionshouldknowaboutitandtakethosesteps automaticallythatswhyitscalledasolution,notanadditionalproblem.Therightvendor willhavealltheknowledgetheyneedontheirownstaff,andshouldmakeabackuptool thatdoesthejobyoupaidfor.Itshouldmaketestingthosebackupseasyespeciallyina virtualizedenvironmentwhereyoudontevenhavetocomeupwithanotherphysical machinetodoatestrestoreon!

Windowsnativebackupcapabilitiesare,andalwayshavebeen,prettyprimitive.Theyre alsofirmlyentrenchedintheBackup1.0mentalityofjustmakeacopyofthenecessary data.Sometimes,thatmentalitycanreallybiteyouwhereithurts: Itwaslate2006,andIwasworkingforabranchoftheUSgovernment.One afternoon,webeganreceivinglargenumbersofcallsattheHelpdeskthatpeople werehavingtroubleloggingintoaparticularActiveDirectory(AD)domain.Now, thisparticulardomainwasusedforcertainspecialprojects,andonlyhadtwo domaincontrollers,buttheydidsupportabout1000usersallofwhomwere prettyupsetthattheycouldntlogonandaccesstheresourcestheyneeded. Bothdomaincontrollers,itturnedout,hadsomehowbeencorrupted.Inever figuredoutwhathappened,butIwasevenhavingproblemsloggingontothe consoledirectlyoneithercomputer.Soalongwithacoupleotheradmins,Idecided tojustdoafullrestoreoftheentiredomain.Afterall,thatswhatbackupsarefor, right? Tomyhorror,Idiscoveredthatwhiletheserverwasindeedbeingbackedupevery singlenight,nobodyhadevercheckedtheSystemStatecheckboxtoensurethat ADwasbackeduptoo.Sothebackupswereessentiallyuseless. Ittookfouradministrators96hours,workingaroundtheclockinshifts,torebuild thatdomainbyhand.Wesleptanhourortwoatatimeatourdesks,thengotback upandstartedworkingagain.WestartedonaTuesdayanddidntleaveuntilearly SaturdaymorningallwearingthesameclotheswedworkinonTuesday. Somebodyatsomepointhadthepresenceofmindtogopickupsometoiletriesfor us,butitwasthelongestTuesdayIcanrememberallbecauseonestupidcheck boxwasntchecked.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

ThisdrivesrightbacktotheBackup1.0mentality:Onlybackupwhatweabsolutelyneed. ThatattitudecomesfromafewfactsoflifeinaBackup1.0world: Backupstakealongtime.Weseektominimizethetimeittakestopullabackup, sowecutoutunnecessaryfiles,folders,andsystems.Inthiscase,the unnecessaryfileswereunfortunatelytheverythingthatwasactuallyneeded. Backupwindowsarelimited.Theveryconceptthatwecanonlybackupourdata duringcertaindeadorslowtimesiscrazy,whenyouthinkofit.Whywouldntwebe backingdataupwhileitschangingsothatwecancaptureeverychange?What aboutuserswhomighthavejustbeencreatedonthedayofthefailuretheywont beinthepreviousnightsbackup,soweloseallthatwork? Thebackupsareonaschedule.Youhope.Toooftenyoufindoutwhenitstoo latethatthebackupwasntworkinglikeyouthought.Theproblemisthatthe scheduleisusuallylateatnightwhennobodysaroundtonoticeaproblemand nobodythinkstocheckeverymorning. Wedontneedtotestourbackups.Thistranslatesas,itstoomuchofapaininthe necktotestourbackups,andwedonthavethetime,sowerenotgoingtodoit. Testing,ofcourse,ishowyoufigureoutthatyourbackupsarentworking,andfind outbeforeyouactuallyneedtorelyonthem.

AsolidBackup2.0mentalitychangesthingsaround: Backupsarecontinuous.Theydonttakealongtimebecausetheyrealways running,grabbingeverylittlechangethatcomesdowntheline. Backupwindowsareunlimited.Theyre247365,infact,becausethebackup windowisalwaysopen,usingasolutionthatgrabseverychangeasithappens.This point,combinedwiththepreviousbulletpoint,meansyoujustgoaheadandbackup everything.Whenyourenotpickingandchoosingdatatobackup,youwindup alwayshavingwhateveryouneedtodoarestore. Thebackupsarentscheduled.Theyrealwaysrunning,andyoucanalwayssee thathappeninginrealtime. Itseasytotestbackups.Whetherrestoringtoavirtualserveroraphysicalone, testingbackupsshouldbeeasyandfastsothatthosetestscanbecomeroutine.If yourenotgoingtotestyourbackups,whybothermakingtheminthefirstplace?


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

ThisoneisjustfunnyIhadtoshareit.Takenfrom Iwasleadtechforabigserverupgradeforacompanythathadtokeeprecordsfor7 years.Wewereimagingtheoldserverdatauponthenetwork,thenreimagingback down[tothenewserver]. Well,onedayIthoughtIwouldmultitaskfourmachinesatthesametimeandgoto lunch.WhenIcamebackfromlunch,Ididawipediskoftheoldharddrivesand noticedthatoneofthetechskeptleaningovertheworkbench;hisbellywassobig thatitwouldhitthespacebar,whichwouldcancelthedatatransfer. Well,tosaytheleast,IfoundthathehaddonethisonthedayIwenttolunch.Well, noonehadanybackups,so7yearsofdatawasgone. Iknowitsnotfunny,butitkindofis.Thelessontolearnhere,though,isthatpointin timeimagesarereallynobetterthananoldstyletapebackup.Anythingthatisjustmaking acopyofthedataataparticularpointintimeisBackup1.0mentality,whereweremore concernedwithgettingacopyofthedataand,asweveseeninthisstory,alotofstrange thingscangowrongtointerruptthatcopyandmakeituseless. SohowwouldBackup2.0solvethisproblem?Byhavingacontinuousbackupoftheold serverinthefirstplace.Theredbenoneedtotakeanimageduringaserverupgrade,and infact,theupgradecouldbedonefasterandmoresmoothlybyjustrelyingonthatblock byblock,Backup2.0stylebackup.Anupgradeisreallynodifferentthanabaremetal disasterrecoveryjustperhapslessurgent.Soagoodbackupsolutionshouldbeableto assistwithaserverupgradeormigrationallthemorereasontohaveagoodbackup solutioninplace.

Theamountofstorageusedbymodernorganizationsistrulystaggering.Infact,getting enoughtimeandnetworkbandwidthtobackupallthatdatacanoftenbeimpossible. Impossible,thatis,whenyourelivinginaBackup1.0worldthatsfocusedonpointintime copiesofdata: IamtheonlyStorageAdministratorforamediumsizedenterprise.Wehavemore than280terabytesofstorageusedonvariousvendorsequipment.WhenIfirst started,wewererunningallofourbackupsthroughasilowithLTO1drivesinit. Wecouldnteverbackupallweneededtointhebackupwindowweweregiven.We finallyupgradedtoLTO4drivesafterseveralfailedattemptstorecovercriticaldata andservers,alongwithcomplaintsaboutnetworkslowdowns,which,ofcourse, camerighttome.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Abitofdiggingrevealedthatthecompanywasactuallypullingweeklyfullbackupsof30to 45terabytes,whicheachrequiredabout14hourstocomplete.14hours!Andobviously someoneishavingtopickandchoosethedatathatgetsbackedupbecausetheyreonly backingupabout16%oftheirdata. Onceagain,itsthemostinsidiouspointsabouttheBackup1.0mentality:Youhavetograb backupsduringsomefixedpointintime,youonlyhaveacertainamountoftimetowork with,andyouhavetograbwhatyoucanduringthatwindow.Backup2.0,bycontinually grabbingchangesastheyoccurcanbackupmuchlargerdatastores,keepthebackups entirelyuptodateatalltimes,consumelessnetworkbandwidthindoingso,andgraball yourchangesnotjustthedatayoucangrabina14hourwindow. ThisstorybringsoutsomeotherweaknessesofBackup1.0.Noticethattheauthorstarted withLT01drivesbuteventuallyhadtoupgradetoLT04drivesfortheimprovedspeedand reliability.Backup1.0byforcingustolivewithinbackupwindowsoftenforcesusto spendalotmoreonourbackupinfrastructurethanisnecessary.Youcouldeasilydrop $15,000onanLT04tapelibraryequippedwithafastFibreChannel4Gbpsnetwork interfaceandeverypennyofthatexpenseissimplytoallowyoutocrammoredatainto yourbackupwindow.Butifyouexpandedthatwindowto724365throughcontinuous backup,youdbeabletocaptureeverythingonsignificantlylessexpensivehardware.

IveworkedwithSQLServerformanyyears(sincev6.5,Ithink),andorganizingbackups hasalwaysbeenachallenge.Mystoryisalotlikethisone: IhavebackupsinthreeversionsofSQLServer,indevelopment,production,and testingenvironments,onmultipleservers.Lotsofbackups,inotherwords probably45to50instancestotal,withasmanyas45databasesperinstance. Wegrabfullbackupseverynight,andtransactionlogbackupsevery15minutes.So ourmaximumdataloss,ifeverythinggoesright,is15minutes.Wetestourbackups byrestoringthefullbackupstoourtestenvironment.Thathelpskeepthetest environmentcloselymatchedtotheproductionenvironment,whichisvaluablefor thesoftwaredevelopers,andhelpsusmakesurethosebackupsareworking.Weroll lastweeksbackupsintoadifferentfolderandgrabthosetotape. WegetfailurenotificationsthroughemailandSystemCenterOperationsManager, andwerelyonmanualinspectionofbackupjobsandfolderstomakesure everythingworks. Rightnowweretryingtoplaywithdifferentbackupschedulesandlookatusing differentialbackups,alltolessenthenetworktrafficandthedrivespaceoccupied bythemanyfullbackups.However,weneedtokeepourrecoverytimesshort,so weretestingtoseehowmuchoverheadthedifferentialsaddtorecoverytimes.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Haveyouevergoneonvacationforacoupleofweeksandforgottentoputaholdonyour mail?Youcomebacktoanenormouspileofmailandspendhoursgoingthroughitall.But dealingwiththatsamemailspreadoutoverthecourseofaweekismucheasier,right? Backupsarethesameway.TheBackup1.0mentalitytellsustowaituntiltheeveningor theweekendtograballofourdata.Thatmeanswehavetohammerthenetworkhardto pullallthatdataovertothebackupserverquickly(afterall,thetimewindowisonlyso big).Wouldntitbeeasierifwecouldjuststreamthechangesoverconstantly,asthey happen?Readingonepostcardadayisntabigdeal;comingbacktoastackofthematthe endofthevacationiswhatspainful.StreamingthechangesiswhatBackup2.0isall about. Remember,too,thegoalofbackups:Backupsshouldpreventusfromlosinganydataor losinganywork,andensurethatwealwayshaveaccesstoourdatawithaslittledowntime aspossible. Losing15minutesworthofwork,justbecausethatswhenyoumadeyourlasttransaction logbackup,isnuts.Whyshouldanydatabeatrisk?Pointintimebackupsalwaysplacedata atrisk;continuousbackupsdont.IwanttorevisitmyBackup2.0wishlist,fromthe previouschapter,onemoretimeandseehowitappliestothiscasestudy: Continuousbackupseliminatebackupwindowsnomoreatriskdata,nomore poundingthenetworkduringabackupwindow. Backedupdatacanbemovedtotapeonadailybasisforsafekeepingwithoutallthe cumbersomerollingoffiles.WhobecameaDBAsothattheycouldspendtime managingfilesondisk? Beingabletorestoreeitherasingledatabaseoranentireserverwouldprovidethe testenvironmentwithalotmoreflexibility,inadditiontobeinganexcellenttestof restorecapabilities. Blocklevelimagingwouldallowanydatabasetoberolledbacktoapointintime withouthavingtofigureoutwhatcombinationofdifferentials,fullbackups,andlog backupsisneeded.Whatsmore,blocklevelimagingpermitsrestorationtoany pointintime,whereasourauthorstransactionlogsonlyproviderollbackin15 minuteincrements. Stillneedthoseoldschoolbackupfilesforotherpurposes?FineatrueBackup2.0 solutionwontinterferewiththem.

ItjustseemsasifBackup2.0,asasetofpracticesandcapabilities,ismuchmorewellsuited toSQLServerthantheoldstyleBackup1.0mentalityourauthorisrelyingon.Welllookat SQLServerinmoredetailinChapter5.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

ThisstoryreallyillustrateswhyIdislikepointintimebackupssointensely.Sure,youcan achievealotofbusinessgoalsusingBackup1.0techniquesandtools,butyouhavetobeso verycarefulinordertogetexactlywhatyouwant.Whoneedsthatextramentaloverhead? Iworkinoneofmycompanyslargerdatacenters,andsupportabout100servers. Mostofthesearefileservers,butthereareacoupleofdomaincontrollers,afew SQLServermachines,andthreeExchangeServerboxes. Weareverygoodaboutpatchingourcomputers.Wetypicallywillnotapplyasetof patchesuntilwehaveafullbackupofthecomputersOSandapplicationfiles,and weusuallymakeabackuprightafterapplyingthepatch,too.Wetendtoapply patchesduringmaintenancewindowswhentheserversarentotherwiseavailable. Onsomeofourlargerservers(theExchangemachinescometomind),itgets difficulttograbonefullbackupandapplypatchesduringour6hourmaintenance windows(youtrytakingemailawayfrompeopleforlonger),sosometimeswetake abackuponenightandapplypatchesthenext,thentakeasecondbackupthe followingnight. Thesystemworksbutnotalwayswell. IcanrecallacoupleinstanceswhereExchangepatcheshavecausedproblemswith someofourthirdpartysoftware,andweneededtorollbacktotheprepatch backup.Unfortunately,awholedayofworkhadpassedsincethatbackupwasmade, sowelostallthatwork.Peoplebecomeincrediblyunhappywhenemailgoes missing. Inatleastonceinstance,wedidntrealizeageneralWindowshotfixwascausing problemsforaboutaweek.Atthatpoint,theprehotfixbackupwasprettyaged. Thiswasonadomaincontroller,sowedecidedtoapplytheoldbackupanyway, knowingthatthedomainwouldbringitselfuptodatethroughreplication. Unfortunately,thebackupalsowefoundouthadsomedeletedobjectsinthe domain,whichwereneartheendoftheirtombstonelife.Thepracticaleffectwas thataboutadozenformerlydeletedobjectssuddenlyreappearedinthedomain. Oursecurityauditorsfreakedout,peoplewereyelledout,anditactuallytookusa whiletoworkoutwhathadhappened,sincethatsnotascenarioyouseeeveryday. Wevesincedecidedtorelylessonbackupsforundoingpatches.Wevestarted spendingmoretimetestingpatches,whichisofcourseagoodideabutitsvery boringandittakesalotoftimewedidntreallyhavetospare.Italsomeansour patchesonlygetrolledoutabouteveryothermonth,ratherthaneveryotherweek, andIworryaboutwhathappenswhenoneofthosepatchesfixessomemajor securityholeandwehavetoleavetheholeopenfor2monthsjustbecauseofour processes.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Again,theBackup1.0mentalityhasdeeperreachingeffectsthanjustdisasterrecovery problems.Inthisinstance,thecompanyhasactuallydecidedtorunoutofdatesoftware forlongersimplybecauseofthewaytheirbackupprocesseswork.Unbelievable.Ifeverthere wasacaseofthetechnologydrivingthebusinessratherthantheotherwayaroundlikeit shouldbethismustbethatcase. Thereareeasytorecognizeproblemshere,whichshouldbefamiliartoyouatthispoint: Backup1.0spointintimesnapshotsdontprovidemuchgranularitywhenitcomes timetorollbacksomething. Backup1.0srelianceonbackupormaintenancewindowstookawaysomeofthe authorsflexibilitywithregardtohisExchangeinfrastructure. Exceptinafewspecialsituations,Backup1.0tendstobeanallornothing proposition:eitheryourollbacktheentireserveroryoulivewithwhatyouvegot. Therearentmanygoodwaystorestoreasingleapplication;Backup2.0,by contrast,canmoreeasilypulloutjustthebitsrelatedtoaspecificapplicationand restoreitwithasingleclick.

VirtualizationisbeingusedinmoreandmorecreativewaysanditssadwhenBackup1.0 cantkeepup.Heresanexcellentstoryaboutusingvirtualizationtoprovidehotsparesfor criticalcomputersIcanseethistechniqueeliminatingtheoldschoolrentalfacilities whereyoudhaveabunchofphysicalserversreadytoactasstandbysintheeventofa disaster.ButseeifyoucanspotwhereBackup1.0methodologieswrecktheeleganceofthe solution: Myorganizationusedtorelyonanoutsourcedhotsitefordisasterrecovery.The theoryisthat,intheeventourdatacenterwashitbyameteororsomething,we wouldrelocatetothisoffsitefacility.Theyhavelotsofservershandy,andwedjust restoreourlatestbackupstothoseservers.Sure,wedlosesomedatabutwe wouldntloseitall.Wecouldthenoperateoutofthatsiteuntilourowndatacenter wasbroughtbackonline. Thecostforthesefacilitiescanbestaggering,soweverecentlyconstructedourown recoverycenterinoneofourlargerremoteoffices.Wecantaffordtobuyallthe serverswedneed,sowearerelyingonvirtualization.Weveidentifiedourtwo dozenorsomostimportantservers,andwehaveenoughserversinthespare facilitytovirtualizeallthecriticalservers.Performancewontbetops,butinthe eventofadisasterthatserious,wereokaywiththetradeoff.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Tokeepthesehotsparesworking,weregularlytakeofflineourcriticalserversfor maintenanceanddoaphysicaltovirtual(P2V)conversion,convertingeach physicalserverintoavirtualmachineinthesparesite.WeactuallydotheP2V conversionlocallyduringthemaintenancewindow,thencopythenewvirtual machineimageslaterbecausethefilesareofcoursehugeandtheWANcant supportgiantcopieslikethatveryquickly. Intheory,thatmeansourcriticalserversarealwaysreadytogoandarenomore thanaweekorsooutofdate.Ourplanwouldbetorestoreourmorerecentbackups toeachvirtualmachinetobringitevenmoreuptodate. Greatplanalmost.HavingtopullserversofflinetodoaP2Vmigrationisnuts.Whytake serversofflineatall?Thebonesofthismethodareagoodidea,butthewholeBackup1.0 snapshotmentalitywhichmostP2Vmigrationsplayintoismessingthingsup. Considerthisinstead:UseaBackup2.0stylesolution,whichmakescontinuous,blocklevel backupsofyoursourceserverswithouttakingthemoffline.Restorethosebackupstoan emptyvirtualmachineonewithoutevenanOSinstalled.Thisisessentiallythesameasa baremetalrestore,justthatthemetalinquestionisvirtual.Yourbackupswillalwaysbe uptodatetothelatestchanges,andyoucandoaweeklyrestoretoyourhotsparevirtual serverssothattheyrereadytogoatamomentsnotice.Or,ifyourbackupsarebeing storedsafelysothatacompletedisasterinyourdatacenterwontalsotakeoutyour backupsyoucouldjustdoyetanotherbaremetalrestorewhendisasterstrikes,andyour hotspareswillbevirtuallyindistinguishablefromtherealservers. Bytheway,wheretokeepyourbackupssothattheyresafeisobviouslyakeypartofthe strategyanditssomethingwellexamineinmoredetailinChapter9.

Thisscenariooutlinesaproblemthatalotofushave,butthatweoftendontthinkabout. Itsnotuncommonforcompaniestoexercisestorageresourcemanagementontheirfile serversprohibitingcertainfiletypes,forexample,orrestrictinguserstoacertain maximumamountofdiskusage.Oneoftquotedreasonforthiskindofstorageresource managementisthatstorageisexpensivetomanageandmaintainespeciallybackups.But itsstrangethatevencompanieswiththestrictestdiskquotasrarelyexerciseanykindof storageresourcemanagementonthebackupsthemselves: Irecentlystartedworkingforanewcompanyandwaspleasedtoseethattheyhada verywellimplementedDistributedFileSystem(DFS)infrastructure.Idontlike mappingnetworkdrives,andtheusersinthiscompanyhadlearnedtoaccessUNC pathslike\\Company\Sales\Files\NovemberratherthanrelyingonthegoodoldS: drive.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

ThecompanywasalsousingDFSreplicastohelpusersinremoteofficeswhich oftenhaveslowerWANlinksgettocriticalfiles.Ifyourenotfamiliarwithit,DFS usesWindowsFileReplicationServicetocopyagivenDFSleaftooneormoreother fileservers.Soaccessing\\Company\General\Policiesmightactuallygetyoutoany oneofadozenserversthatallhostthatsamecontent.Inthisorganizationscase, eachlocalofficefileserverhasacopyofthisandothercommonlyaccessedfile shares,like\\Company\General\Sales\Forms.Thefilesinthesesharesarent updatedreallyfrequently(maybeacouplefilesadaychange),sothereisntreally muchreplicationtraffic,andhavinglocalcopiesletseveryonegettothefiles withoutrelyingontheWAN. Likeanygoodcompany,webackupallourservers.Smallerremoteofficesactually havedirectattachedtapedrivesforthispurpose.Theyvebeenusingthismodelfor years,butonlyrecentlyhavewestartedrealizingthatthebackupswerent completingbecausethetapedrivesdidnthaveenoughcapacity. Istartedlookingintoit,andrealizedthatthecompanyhasbeendoingalotofDFS replicasabout50to60GBworthrightnow,andtheyreaddingmoreallthetime. Thisisthesamedatabeingbackedupoverandoveragainindifferentlocations.All thatduplicateddataiswhatscausingtheproblem.Istartedtryingtofigureout exactlyhowmuchduplicateddatawehavesothatIcouldmakeabusinesscaseto management.Indoingso,Ifoundthatmanyofourfileservershavemultiplecopies ofthesamefiles,allonthesameserver.Alotofthetimeitcomesfromusershome directories:thetwoserversthathostthe\\Company\UsersDFSnodehavetensof thousandsofduplicatedfilesbecauseusersdragcommonlyusedfilesintotheirown homefolders. Wewerebackingupatotalof13.2TBofdata,andcloseto30%ofitwasduplicated data.Onethird!Werecurrentlytryingtofigureouthowtoexcludetheduplicates, butitsactuallyverytrickywecantjustnotbackupusershomefolders! Dataduplicationthebaneofstorageresourcemanagerseverywhere.Infact,datade duplicationisanincrediblyhotnewtechnology;somuchsothatindustrygiantslikeEMC, Dell,andHPbattleitoutoveracquisitionstheybelievewillputthemattheforefrontofthis importantnewtechnology.Soimportant,infact,thatImgoingtoaddabulletpointtomy Backup2.0wishlist: Backupsshouldnotcontainduplicatedata.Backupsomethingonce,notmorethan once. Thisisatallorder,anditmightonlybepossibletoimplementittoadegree.Forexample,a solutionmightdeduplicatedataacrossanentireserverbutallowduplicatesofthatsame datatobebackedupfromotherservers.Othersolutionsmighttakeabroaderviewandde duplicatedataacrosstheentireorganizationthatwouldcertainlybepowerful,butit seemslikeatechnologicallydifficulttask.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Thesetwelvestorieshaveobviouslyhadcommonthemes.BeforeIwrapupthischapter,I thinkitsworthspendingjustafewmomentsreviewingthosethemes,focusingonthe takeaway(whatweshouldlearnfromthem),andreiteratingwhatweshouldbedoing insteadtoprovidebetterbackup,recovery,andothercapabilitiesforourorganizations: Pointintimebackupsarehorrible.Yourealwaysgoingtolosesomedataifyou havetorelyonpointintimebackups,andwhowantstolosedata?Continuous backups,orcontinuousdataprotection,ifyouprefer,offermuchmoreflexibility, lessriskofloss,andgenerallylessmanualeffortandoverhead.Pointintime backupsalsolackgranularityeventhosequarterhourSQLServertransactionlog backupsleavetoomuchdataatriskanddontletyourollbacktheservertoa precisepointinthepast,ifneeded. Backupwindowsarehorrible.Takingserversofflineisnevergoingtoaddmuch valuetotheorganization.Sometimes,fortruemaintenance,youhavenochoice;you dohaveachoicewhenitcomestobackups.Backupwindowsforceyoutochoose whatdatatobackupyoucanonlygrabwhatwillfitwithinthewindowplace unnaturalstrainsonthenetwork,anddriveanumberofotherconstraining decisionsthatsimplyaddnovaluetothebusiness.Continuousbackupsdont requireawindow,soyouarefreetomakebetterdecisionswithoutallthetime constraints. Duplicateddataishorrible.Nobodylikesthatwehavetodobackups,sowhyback upanythingmorethanonce?Duplicateddatabloatsyourbackups,requiresmore time,andmoreimportantlyrequiresmorespaceforbackupstoragespacethat mightbeexpensive(especiallyforoffsitestorage),slow(liketapes),andsoon.Look forsolutionsthatcanautomaticallydeduplicatedatawhenmakingbackups. Anythinglessthantheentireserverishorrible.Sure,yourworstnightmare mightbelosingasingleemailfromtheCEO,butthatsfarfromtheonlynightmare youneedtopreparefor.Dontmakedecisionsaboutwhatsimportantbackitall up.Withtherightsolution,thatoneallinclusivebackupwillenableeverythingfrom singlefilerestorestobaremetalserverrecoveryandeverythinginbetween, includingrestoringanentireapplicationtoanearlierpointintime. Backupsgetcorruptedwhichishorrible.Backupsolutionsshouldtellyou whensomethinggoeswrongnotwaitforyoutofindoutforyourself. Nottestingyourbackupsishorrible.True,oldschoolbackupsolutionsmakeit incrediblydifficulttoactuallytestbackups,butthatsnoexcuse.Orrather,itsan excuseforfindingasolutionthatmakestestingbackupseasier,likeonethat supportsrestoringtoavirtualmachineordissimilarhardware,sothatyoucan practicallytestyourrestores.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Theresplentytolearnfromthesestories,andplentytolookforinaBackup2.0solution. Thekeytothewholethingseemstobethisideaofcontinuousdataprotection,grabbing individualblocksoffdiskassoonastheychangeandstoringthoseblocksinawaythat makesitpossibletorestoreanentireserverorjustasinglefile.Yes,solutionslike SharePoint,SQLServer,andExchangeServeraddsomecomplexitytothepicture,butby continuallystreamingchangeddiskblocksintothebackupsystem,youcangrabanytypeof backupyouneedcontinuously,withoutthepointintimetroublesofBackup1.0.

ItstimetodigintothisBackup2.0philosophyabitdeeper.Inthenextchapter,Illstart lookingatbackupsbeginningwiththemostcommontypeofbackuporwhatshouldbe themostcommontypeofbackup:wholeserverbackups.Whetheryouusethemtoprotect dataortoprepareforacomplete,wholeserverdisaster,thesebackupsshouldbethe stapleofyourdisasterrecoveryplan. Illdiveintothetechnicaldetailsandhurdlesthatwholeserverbackupspresent,andcover someofthenativesolutionsthatWindowsprovides.Illoutlinespecificproblemsand challengesthatbothnativeandthirdpartysolutionshavetodealwith,andlookatsomeof theBackup1.0methodologiesyouredoubtlessfamiliarwith.Thatwillallhelpsetthe contextforadiscussiononrethinkingserverbackups:Illmakeawishlistofcapabilities andfeatures,outlinebettertechniquesthatmorecloselyaligntobusinessrequirements, andpointoutwaysthatBackup2.0canmakebackupmanagementeasier,too.Illfinishby examiningspecificscenarioslikedomaincontrollers,publickeyinfrastructure(PKI),and Webserverswherethesetechniquesofferanadvantage.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Recoveredfromthehorrorstoriesofthepreviouschapter?Readytostartensuringsolid backupsinyourenvironment,theBackup2.0way?Thatswhatthischapterisallabout, andwhatIcallwholeserverbackupsisdefinitelytherightplacetobegin.Thisiswhere Illaddressthemostcommonkindsofservers:fileservers,printservers,directoryservers, andevenWebserverstheworkhorsesoftheenterprise.Illshowyouwhatsomeofthe nativesolutionslooklike,discusssomeoftherelatedBackup1.0styletechniquesand scenarios,anddetailwhytheyjustdontcutitfortodaysbusinesses.ThenIllassemblea sortofBackup2.0wishlist:Allthethingsyouwantinyourenvironmentforbackupand recovery.Illoutlinewhichofthosethingsareavailabletoday,andwrapupbyapplying thosethingstosomerealworldserverrolestoshowhowthosenewtechniquesand technologiesimpactrealworldscenarios.

Whatssotechnicalaboutwholeserverbackup?Windowsstorescriticaldatainanumber ofplaces,andsomeofthemarefilesanddatabasesthatarecontinuallyopenandunder modificationbytheoperatingsystem(OS):theWindowsregistry,ActiveDirectorys(ADs) database,andcertaincriticalOSfilesarejustafewexamplesofthese.Thesefilesare difficulttobackupandrestoresimplybecausetheOSitselfcantlockthefilestoprovide acleanimageofthefile.Inotherwords,becausethefilesareconstantlyopenand constantlychanging,traditionalbackupsolutionscanteasilyseethecompletefiletoback itup. Wholeserverbackupalsoincludesuserfiles,suchasthosestoredonafileserver,along withnumerousconfigurationdatabasesassociatedwithWindowsitself.Althoughallof thesemightnotbeopenatalltimes,theycanstillbetrickytobackupbecausetheymaybe openduringthebriefwindowwhenthebackupsoftwareisrunning. Sothegoalwithwholeserverbackupistogetagood,usablebackupoftheentireserver. Andbyusable,Imeanthatthebackupcanserveourmainbusinessgoalsrelatedto backupandrecovery,whichIstatedinChapter1: Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Aslittledowntimeaspossiblesuggeststhatweneedtodomorethanjustbackuptheentire serverinawaythatfacilitatesrestoringtheentireserver;wemayalsoneedtorecovera singlefile,orasingleconfigurationdatabase,orasingleADobject.Beingabletorecover justthedatawewantfromabackupwillhelpreducedowntime,asrecoveringasinglefile isobviouslyorshouldbemuchfasterthanrecoveringanentireserver. Wealsohavetorecognizethatdowntimedoesntjustapplytotheserverthatwere recovering;italsoappliestothepeoplewhoarewaitingfortherecoverytobecomplete. Wecangetauserbacktoworkfasterbyrecoveringtheonefilethattheuserneedsrather thanhavingtorecovertheentireserver.Thatsaid,wellcertainlywanttheabilityto recovertheentireserver,intheeventthatacompletedisasteroccursandwelosethe entireserver.Whenthathappens,theidealistoloseaslittleworkaspossible,meaning whateverwereusingforbackupsshouldbecontinuous.

Thetechnicaldetailsherepresentonesignificanttechnicalchallenge:openfileaccess.That is,theabilityofabackupsolutiontogetacomplete,consistentbackupofafilethats currentlyopenandinuse.Overtheyears,anumberoftechniqueshavebeendevelopedto addresstheseissues. Onetechniqueiscalledalockedfilebackup(LFB),anditsafairlygenerictechniquethatsin useonmanyOSs.Basically,whenanapplicationrequestsabackupofafile,theLFBlogic whichmaybeembeddedintheOSorprovidedbyanagentofsomekindcheckstosee whethertheOShasthefileopenforanyotherapplications.Ifitdoes,theLFBlogicwaits forapauseinwriteactivitytothefileapauselastingforsomepredeterminedamountof time.Whenapauseoccurs,theLFBmakesacopyofthefileasitexistsatthetime,and offersthatcopytothebackupapplication.Insomeinstances,LFBwilloperateonanentire diskvolumeratherthanonaperfilebasis.Workingacrossanentirevolumehelpsensure thatthefilesareconsistentwithoneanotherbutalsomakesitmoredifficulttofindapause duringwhichalltheopenfilescanbecopiedandcached. WindowsintroducedanewtechniquewithitsVolumeShadowCopy(VSC)service.Ill discussVSCsoperationinmoredetaillaterinthischapter;fornow,sufficetosaythatthe VSCkeepsalocal,onvolumebackupofchangedfiles.Itcanthenofferthosefilestothe backupapplicationwhenafilescurrentversionisopenatthetimeofthebackup.That meansthebackupistypicallygettingthepreviousversionofafileratherthanthecurrent version;youmightsaythatbecausethefileisopen,thecurrentversionhasntyetbeen created. Note MicrosoftreferstothisfeatureasVSS,orVolumeShadowcopyService. Bothofthesetechniquesare,asyoucansee,prettycomplicated,andtheydontworkevery time.FilesthatareconstantlyopenwilldefeattechniquessuchasVSC,forexample.LFBcan bedefeatedbyfilesthatneverhavealongenoughpauseinwriteactivity,orinthecaseof wholevolumeLFBlogicbylarge,busyvolumesthatneverhavealongenoughvolume widepauseinwriteactivity. 42

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

IwanttotakealookatthenativebackupsolutionsthatarebuiltintotheWindowsOS. Therearereallytwo:thebundledbackupapplicationandtheaforementionedVSC.

PriortoWindowsServer2008,WindowsServercamewithafairlyprimitivebackupand restoreapplicationthatwasessentiallyunchangedsinceitsintroductioninWindowsNT 3.1intheearly1990s.Figure3.1showsNtbackup.exe,whichofferedbasicbackupand recoveryoffilesondiskand,asshown,ofthecriticalSystemState.

Figure3.1:WindowsBackup,orNtbackup. TheSystemStateconsistsofWindowsbootfiles,theWindowsregistry,COMclass registration(primarilythenamesandlocationsofDLLfiles),andotherconfigurationdata relatedtotheOSitself.Theapplicationcouldbackuptolocallyattachedtapedrivesortoa file,anditcouldrecovertheentireserverorindividualfiles.Ashortcominginthewhole serverrecoverymethodisthatyoufirsthadtoinstallWindows,thenusetheapplicationto recovertheserver.Inotherwords,theapplicationdidntsupportanykindofbaremetal recovery,wherethebackupcouldbeappliedtoabrandnewserverthathadnoOS installed.TheneedtomanuallyinstallWindowspriortobeginningtherecoveryaddeda fewhours,atbest,totherecoveryprocess,andmadethetoolunsuitableforallbutthevery smallestandrisktolerantenvironments.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Theapplicationalsolackedinternalschedulingofbackups.Instead,itusedtheWindows ScheduledTasksfunctionalitytoschedulethecommandlineversionofthetool.This providedthebasicabilityforschedulingbackups,butfromabusinessperspective,itwas suitableonlytotheverysmallestenvironments. Althoughvaluingthemanythirdpartyapplicationsthatspranguptofillthebackupand recoverygapleftbythenativeapplication,Microsofteventuallyrecognizedtheneedto providesomewhatmoremodernandsophisticatedbackupcapabilitiesintheOSsnative toolset.So,inWindowsServer2008aftermorethanadecadeofNtbackupMicrosoft introducedWindowsServerBackup.AsFigure3.2shows,thisfeaturemustbeexplicitly addedtotheserverbyanadministrator.

Figure3.2:AddingWindowsServerBackuptoaserver. Onceadded,theapplication,seeFigure3.3,offersanumberofimprovementsoverits predecessor,includingtheabilitytonativelyschedulebackupsandtheabilitytoconnectto remoteserversandmanagetheirbackups.Theapplicationcancreatearecoverydisc,which makesiteasierandfastertodobaremetalrecovery.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure3.3:WindowsServerBackupinWindowsServer2008. Asidefromimprovementsinitsuserinterface(UI)andtheadditionofnativescheduling, WindowsServerBackupisntsignificantlydifferentfromitspredecessor.Itstillworksona filebyfilebasis(althoughitbacksupentirevolumes),stillhastheabilitytobackupthe WindowsSystemState,andsoon.SomeoftheUIimprovementsaregreatsuchasthe abilitytorestorefromabackupfilethatislocatedonthenetworkbutinmanyways, WindowsServerBackupprovidesfeaturesthatthirdpartieswereprovidingadecade earlier. Note MicrosoftdoesntoversellWindowsServerBackup;itspecificallypositions thetoolasusefulforsmallerorganizationsorindividualswhoarenotIT professionals. YoucanreadmoreaboutWindowsServerBackupat Bothofthesenativeapplicationshaveamajorshortcominginthattheyaresnapshotbased, meaningtheygrabbackupsonlyduringadesignatedbackupwindow.Anyfilesthat changedafterthebackupwasmade,andbeforethenextonewascompleted,wouldbelost intheeventofadisasterorotherproblem.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

IntroducedinWindowsServer2003,VSCisanative,OSlevelfeaturethatcreatesshadow copiesoffilesonanyvolumeforwhichthefeatureisenabled.Administratorsspecifya maximumamountofstoragetobeusedfortheshadowcache,andtheserviceautomatically makescopiesofsharesfilesthatarechangedaswellasfilesthatareopenwhenabackupis requested. AsFigure3.4shows,VSCisconfiguredonapervolumebasisontheserver.Onceenabled, itwillautomaticallybegincreatingshadowcopiesoffilesthatarecontainedwithinshared foldersonereasontheconfigurationUIdisplaysthenumberofactiveshares.VSCwill maintainseveralshadowcopiesforagivenfile,providingmultipleoldversionsofafile.It willcontinuemakingshadowcopiesuntilitsadministratorallottedspaceisfull,andwill thendiscardoldercopiestomakewayfornewones.

Figure3.4:ConfiguringVSC. Note WindowsServerBackupandlaterversionsofNtbackupincludesupportfor VSC,meaningtheycannativelymakeuseofVSCstorestobackup applicationsthatexposetheirdatathroughVSC.Suchapplicationsinclude MicrosoftSQLServer.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

VSChastwodistinctfunctions: Itwillmakeshadowcopiesofopenfilesautomaticallywhenthosefilesareaccessed forbackup.ThisrequiresabackupapplicationthatisVSCaware,meaningthe backupapplicationhastoaskforashadowcopy.Someapplications,suchas MicrosoftSQLServer,aredesignedtoexposedatathroughVSC,providinga commoninterfacethatbackupapplicationscanusetoaccessapplicationspecific data. Itwillmakeshadowcopiesofsharedfiles,andmakethoseshadowcopiesaccessible toendusersthroughthePreviousVersionsfeatureinWindowsclientOSs,suchas WindowsVista.Thisprovidesenduserswithaselfservicemethodforrecovering individualfilesandfoldersthathavepreviousversionsavailableasshadowcopies. Figure3.5showsanexample.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

VSChasafewshortcomings:First,itisntexactlycontinuous.Thefeaturedoesntmake backupsofafileeachtimethefileissaved,althoughitwillperiodicallymakeanewshadow copyofchangedfiles.VSCdoesntprovidefinegrainedcontrol,either.Inotherwords,an administratorcantdecidewhichfilesaremoreimportantandshouldberetainedlonger; VSCdiscardsshadowcopiesinafirstin,firstoutcycle;administratorscanonlydetermine thetotalamountofspaceavailableforallshadowcopies.VSCisntusefulinfullserver recovery,onlyinsinglefilebackupandrecovery.VSCdoesntcreateshadowcopiesoffiles thatarentshared,anditdoesntprotecttheentireOSitignoresSystemState,for example.Generallyspeaking,mostadministratorsregardVSCasagoodsupplementtoa properbackupapplication;VSCcanhelpreduceHelpdeskcallsforsinglefilerecoveryby makingthatfunctionalitymoreselfservice,butVSCitselfisnotabackupsolution.

SincetheintroductionofWindowsserverOSs,theirfairlyweaknativebackupandrestore capabilitieshavespawnedanenormousecosystemofthirdpartysolutions.Foryears, however,thesesolutionsessentiallyreplicatedthebasicfeaturesofthenativebackup application.Tobesure,theyaddedagreatdealofadministrativeconvenienceand flexibility,buttheydidbasicallythesamejob.Figure3.6showsonesuchapplication.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

WithWindowsBackup,administratorscouldselectthefilestheywantedtobackup;with thirdpartysolutionsasshowntheydidbasicallythesamething.Thethirdparty solutioncouldcompressthebackedupdatafortransmissionacrossthenetworktoa centralbackupserverwithanattachedtapelibrary,ofcourse,whichisamajor improvement.Manythirdpartysolutionsprovidepowerfulschedulingcapabilities, designedtomaximizetheamountofdatathatcouldbecopiedinalimitedbackupwindow. Mostprovidedbackupmediamanagement,andmostprovidedapplicationspecificagents toincludeapplicationssuchasExchangeServer,SQLServer,andsoonintheirbackups. Mostprovidedsingleitemrecoveryaswellaswholeserverrecovery,andmostprovided themeanstoperformbaremetalrecoveryintheeventofacompletedisaster.Ultimately, though,theirrelianceonthesamebasicprinciplesandtechniquesasNtbackupalwaysled tothesamebasicproblemsandchallenges.Itswhatmakesthisentirecategoryofbackups feellikeBackup1.0.

BoththenativeWindowsbackupcapabilitiesandthesimilarlydesignedtraditionalthird partysolutionshavethesamechallengesandproblems: Theyreschedulebased,meaningtheyresnapshotbased.Withoutcontinuousdata protection,yourealwaysatriskforlosingdata.Inmostcases,backupwindowsare intheevening,soyourealwaysatriskforlosinganentiredaysworthofwork. Mediamanagementisasignificantchallenge,andmanyadministratorsusingthese solutionsspendafewhourseachweekjustshufflingbackuptapes. Restorationisatimeconsumingprocess,asfileindexesanddatamustbeloaded fromtape.Evenrestoringasinglefilecantakealongtime:therighttapemustbe locatedandloadedandread,thefilemustbeselectedfromalist,thetapemustbe woundtothecorrectlocation,andfinallythefilecanberead.

Whatisitwewantfromourbackups,again? Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible. TheseBackup1.0techniquesmissoutonpreventingthelossofanydataoranywork; theresalwaysdataatriskbecauseofthesesolutionssnapshotbasis.Theydontensurewe alwayshaveaccesstoourdata,andthedowntimetheyoffercertainlyisntminimal.Even solutionsthateschewtapeinfavorofmoreexpensivediskbasedbackupstillhaveto performanincredibleamountoffileoperationstolocatetherightdataandbringitback intoproduction.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Theresadeeperproblemthattheseoldschooltechniquesalsotendtomiss:datade duplication.Todaysenterpriseshavealotofduplicateddataduplicatedfilesinusers homefolders,forexample.Traditionalbackupsolutionstendtoblindlycopyeverything theysee,meaningyourewastingnotonlyspacestoringthatduplicatedatabutalsotime andcapacitybackingitup.Datadeduplicationisstartingtobecomeawatchwordin storagemanagement,andaBackup2.0stylesolutionwouldcertainlyincludede duplicationcapabilities.

IwanttotakeabriefsectiontosummarizesomeofthekeyBackup1.0principlesand elementssothatwecanpullouttheirspecificproblemsandthinkofwaystosolvethemor improveuponthem.

ThesolutionsIvediscussedsofarrelyonasingleprimarytechniquewithafewsupporting ones.Mainly,thesesolutionsaresnapshotbased,meaningtheyseektobackupafileasit existsatthemoment.Theytypicallybackupgroupsoffilesduringasinglebackupwindow, whichisoftenintheeveningorduringotherperiodsoflowornoutilization.Supporting techniquesprimarilyrevolvearoundbackingupopenfiles,andmayincludeopenfile managementutilities,LFBagentsorfeatures,orspecialfeaturessuchasVSC. Recognizingthatsomeserversmaycontaintoomuchdatatobebackedupinasingle backupwindow,someorganizationsmaychoosetouseapartitioningscheme.For example,halftheserversdatamightbebackedupinfulloneevening,whiletheotherhalf receivesanincrementalordifferentialbackupthatevening.Thesemanagementtechniques helpmakethemostoflimitedbackupwindowsbutalsocomplicaterestoreprocedures. Themainproblemisthatbackupissnapshotbased,meaningthereisalwayssomedataat riskofloss.Asecondaryproblemisthatofduplicateddata,whichwastesbackupstorage space.

Restorationtypicallyinvolvesrestoringasinglefileorotherresource,oftenattherequest ofauserwhoaccidentallychangedordeletedafile.Selfservicesolutionssuchas WindowsPreviousVersionsfeature(inconjunctionwithVSC)workwellwhenthedesired dataisavailableforrestoration;whensuchfeaturesarentavailableortheneededdata isntavailable,administratorsmustturntotheirbackupsolution.Thistypicallyinvolves identifyingthecorrectversionoftheresourcetoberestored,locatingthestoragemedia containingthatbackup,andthenreadingthedatafromthatmediawhich,inthecaseof tape,canrequiresometime,asthetapedoesntsupportrandomaccessandmustbewound tothecorrectreadlocation.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Themainproblemisinidentifyingtheneededdataandlocatingthemediaonwhichitis stored.Withcomplicatedbackupschemes,thismayinvolveidentifyingafullbackup,one ormoreincrementalbackups,and/oradifferentialbackup.Anotherproblemisinthetime ittakestoperformtherestore,particularlywithtapebasedbackups.Afinalproblem relatestothesnapshotbasednatureofthebackup,meaningtherewillbetimeswhenthe desireddatasimplyisntavailableonabackup.

Wholeserverdisasterrecoveryusuallycomesinoneoftwoforms: ThebaseOSmustbeinstalledfirst,possiblyalongwithanyrecentservicepacks, usingstandardinstallationprocedures.Then,oneormoresoftwareapplications mustbeinstalledtosupporttherecovery.Finally,therecoverycanbegininearnest, readingdatafromthebackupmediaandrestoringittotheserver. Abaremetalrecoveryusuallyinvolvesaspecialbootdiscthatincludesastripped downOS,suchasWinPEorWindowsRecoveryEnvironment,thatcontainsenough smartstoaccessbackedupdata,formattheserversdisks,andcopythebackup datatothosedisks.Thisformusuallyinvolvesfewerstepsandismuchfasterthan thepreviousform.

Bothtechniquescanbetimeconsumingandsufferfromtheinherentsnapshotbased natureofthebackup,meaningtherewillalwaysbesomedatamissingeveninaperfectly executedrecovery.

BackupmanagementcanbecomplicatedusingtheseBackup1.0styletechniques.Backup schedulesandtypes(full,incremental,ordifferential)canbecomplex,andrequirecareful managementnotonlyofschedulesbutalsoofstorageresources,networkcapacity,andso forth.Physicallymanagingtapesrotatingthemoffsite,verifyingtheiraccuracy,andso forthcanbetimeconsuminganderrorprone. Thesedays,backupmanagementiscomplicatedbymanycompaniesdataretention requirements.Dothebackupsincluderegulatedinformation?Inthatcase,theymayneed toberetainedforaspecificperiodoftimeordiscardedafteraspecificperiodoftime.They mayneedspecialsecurityprecautions,aswell,toprotectthedatacontainedinthebackup.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

LetsstartthinkingBackup2.0:Whatareouroldwholeserverbackuptechniquesmissing thatwedliketoadd?Theskysthelimit;atthispoint,wedontneedtoworryaboutwhats possibleoravailablejustwhat,inaperfectworld,wedbeabletoimprove.

IthinkthemostimportantimprovementthatBackup2.0canofferisachangefrompoint intimesnapshotbackupstocontinuousdataprotection.Hereshowitmightwork: Everythingstartswhenanapplicationofanykindmakesachangetodisk.Applications dosobypassingdatatotheWindowsOSsfilesystemapplicationprogramminginterfaces (APIs),basicallyaskingWindowstosavethisdatatothisfile.Whenthathappens, Windowsfilesystemtakesthedataandbeginsbreakingitintoblocks. Blocksarethebasicunitofmanagementfordataonadisk.Whenyouformatadisk,you selecttheallocationunitorblocksize.Thatdetermineshowmuchdataiscontained withinagivenblockofdiskspace.Figure3.7showsthatWindowsusuallypicksitsown defaultvalue,whichiswhatmostpeoplegowith.

Figure3.7:Formattingadiskandselectingblocksize. Asingleblockcanholdthecontentsonlyforasinglefile.Ifyourblocksizeis2kilobytes,for example,andyousavea512bytefile,thenthreequartersoftheblockwillbeemptyand wasted.Largerfilesaresplitacrossmultipleblocks,andNTFSkeepstrackofwhichblocks gowhere:fileXYZ.txtconsistsofblock324,thenblock325,thenblock789,andsoforth.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Microsoftrecognizesthatthirdpartyutilitiesmightneedtobenotifiedoffileoperations, andmightinfactneedtomodifyorcancelthoseoperations.Thatshowmostthirdparty diskquotasystemsandfilefilteringsolutionswork:theygetthefilesystemtotellthem whenfilesarechangedondisk,andtheyupdatetheirquotadatabaseorblockfilesfrom beingsaved,orwhatever.ThetechniqueMicrosoftprovidesforaccomplishingthisiscalled afilesystemfilterorshim.Essentially,theshimregistersitselfwiththeOS,isnotifiedoffile operations,andisgiventhechancetoblockoralloweachoperation. InthecaseofaBackup2.0stylesolution,theshimmightjustpayattentiontowhichdisk blockswerebeingmodified.Asblocksaremodifiedondisk,theshimcouldcopytheblocks data,compressit,andtransmititacrossthenetworktoabackupserver.Figure3.8 illustratestheprocessImproposing:

Figure3.8:Capturingchangeddiskblocks. 53

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

InStep1,somethingontheservermodifiesablockofdiskspace.InStep2,thischangeis passedtothebackupsoftwaresfilesystemshim,andthemodifiedblockiscopiedand transmittedtoabackupserver. Thistechniquewouldallowforcontinuousdataprotection.Ofcourse,inadditiontojust copyingblocks,thesoftwarewouldalsomakeanoteofwhichfiletheblockwentwith.On thebackupserver,softwarewouldkeeptrackoffilesandtheirassociatedblocks.Thisisa powerfultechnique:Ratherthanmessingaroundwithcumbersomeandcomplicatedopen filetechniques,asBackup1.0solutionswoulddo,thissystemisgrabbingthelowleveldata changesastheyarephysicallyinscribedontheharddiskbytheOS.Thedataisbeing grabbedbelowthelevelofanentirefile,soevenpartialchangestoafilesuchasa MicrosoftAccessdatabasecanbegrabbedimmediately,almostinrealtime,andthe backupsolutiondoesntcareifthefilehappenstobeopenornotatthetime.When someoneneedstorestoreafile,thebackupserverssoftwaresimplylooksupthemost recentlysavedblocksforthefile,andusesthemtoreconstructthefileinitsmostrecent condition.Bestyet,thecentralbackupservercouldalsosavepastcopiesofafilesblocks meaningitcouldreconstructthefileasitexistedinanyparticularpointintime. Ifthesavedblockswerestoredonahighspeedstoragesystem,suchasaRAIDarray,files couldbereconstructedalmostinstantlyandsavedtoanylocationonthenetwork. Consideringourprimedirectiveforbackups: Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible. ThisBackup2.0techniquewoulddothetrick.Wereallywouldntloseanydataorwork, becauselowlevelchangeswouldbecapturedcontinuously.Wewouldntneedtoworry aboutbackupwindowsbecausetheentiredaywouldbeourbackupwindow.Wedalways beabletoreconstructdataasneeded,withminimaldowntime. Note Infact,solutionsexistthatdojustthis:Althoughtheymayusedifferent underthehoodtechniquesthanthefilesystemshimIvedescribed,the Backup2.0ideaofcopyingblocksnearlyinstantlyisverymucharealthing, notjustawish. Thistechniquealsohastheadvantageofbeingabletocaptureeverythingthatgoestodisk, includingfilepermissions,alternateNTFSstreams,registrychanges,ADchanges,and more,allwithoutnecessarilyneedinganyspecialknowledgeoffiletypesorstructures. Infact,thistechniqueislogically(althoughnotphysically)similartoRAID1diskmirroring, whichalsooperatesatablocklevelalbeitnormallyviaaRAIDcontrollercardandnotvia software,althoughsoftwareRAID1isalsopossible.Ratherthanmirroringblocksinreal timetoaseparatedisk,thisbackuptechniquemirrorstheblocksacrossthenetworktoa backupserver.And,ratherthanonlykeepingthecurrentblockdata,asinadiskmirror,the backupsolutioncankeeppastcopies,too,enablingrecoverytoanyearlierpointintime.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Thetricktoallofthis,ofcourse,ishavinggreatmanagementsoftwareonthatcentral backupserver.Itneedstobeabletotrackwhichchangedblocksgowithwhichfiles,for example,andforconveniencemaywanttokeeptrackofspecialfilesliketheWindows registryorADdatabases. ThebackupserversoftwarecouldeasilyexposeaselfserviceUI,ifdesired,toprovide functionalitysimilartobutmorecontrollablethanWindowsPreviousVersion/VSC feature.ThesoftwarecouldmoreeasilyrecoverdatainapplicationssuchasADbecause thesoftwarecouldreconstructaportionofthedatabasefileoreventheentiredatabase file,downtoaspecificpointintime(inallprobability,youwouldwantthesoftwaretobe abletoattachpointsintimetospecificADoperations,suchasthedeletionofauserorthe creationofagrouporwhateverjustsoyoucouldmoreeasilyidentifythepointintime youwanttorollbackto).

Withacopyofeveryblockofdiskspace,restoringanentireserverwouldbe straightforward:Youdneedsomesortofrecoverydisk,suchasabootableDVD,togetthe serverupandrunningandtotalktothebackupserversoftware.Youdthensimplystream themostrecentversionofeverydiskblockbacktotheserver,writethoseblockstodisk, andthenrestarttheservernormally.Withgoodcompressiontospeedupthetransferof dataacrossthenetwork,baremetalrecoverycouldbedonequicklyandyoudlosevery little,ifany,data. Infact,theopportunityexiststorecovertheservertoavirtualserver,ifneedbean excellentdisasterrecoveryscenarioaswellasapowerfulphysicaltovirtualmigration technique.Youmightwellbeabletorecovertodissimilarhardware,too,sinceinmany casesWindowscanreadjustitselfwhenitfindsitselfsuddenlyrunningondifferent hardware. Tip Asyoubeginlookingatblockbasedrecoverysolutions,askfordetailson howtheydealwithdissimilarbaremetalrecoveryscenarios.Would Windowsrequirereactivationwhenitfindsitselfrunningondifferent hardware?Howdissimilarcanthehardwarebe?Themoreflexibilitythe solutionoffers,thegreaterthenumberofscenarioswhenitwillbeableto savethedaywhenitsneeded. Heresakillerscenario:Imaginegrabbingrealtimediskblocksfromaproductionserver, andthenimmediatelyapplying(restoring)thoseblockstoavirtualmachine.Instant virtualstandby!Ifthemainproductionserverfails,thevirtualservercanstepinandtake overwithlittledowntimeandlittleornodataloss.Dependingonhowyouarchitectthe virtualinfrastructure,asinglevirtualhostmightsupportseveralvirtualstandbys.Those standbysmightoperatewithlessperformancethanthenonvirtualproductionmachines (again,dependingonhowyousetthingsup),butyoudhaveahotspareanytimeyou neededon.Figure3.9illustratesthisidea.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones


Managingblocklevelbackupscanbemucheasierbecausetheylltypicallybestoredfirst ondisk.Youcanthenmaketapebasedbackupsfromthediskbasedbackupsmeaning yourproductionserversdontparticipateinthetapebasedbackup,andyourbackup windowcanbeaslongasyoulike.Tapebackupswouldtrulyrepresenttimespans,and couldbecompleteandinternallyconsistentunliketodaysmixoffull,incremental,and differentialbackups,whichmustbetreatedasasetinordertoretaintheirusefulness. Blockbasedbackupswouldalsobeaneffectivewaytoimplementdatadeduplication,as setsofblockscouldeasilybeindexedandcomparedtocheckforduplication.Thatwould helpcutdownbothondiskstorageandtapestorageaswellasallthemanagement overheadthatcomeswithanykindofstorageresource.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Note Somedatadeduplicationvendorsclaimthatyoucanreducethesizeofyour backupsbyupto70%.Evenifthatsanoptimisticnumber,youcould conservativelyexpecttosaveasignificantamountofspace! Thebackupsoftwarecouldalso,intheory,allowyoutomountbackedupdataasarealdisk volume.ItwouldsimplyneedtoprovidesomekindofdiskdriverforWindowsthatcould talktothebackupsoftwareandreassemble,inrealtime,themostrecentbackedupblocks intoasinglediskvolume.Youcouldthenmountandexplorebackedupdataaseasilyas livedata,allowingyoutocomparefiles,draganddropfilestodifferentlocations,andso forth.Ifthebackupsolutionwasstoringpastversionsofblockdata,youcouldmountadisk thatresembledanygivenpointintime,makingiteasytocomparefilesordatafrom differentpointsintime.

Again,mostofthecapabilitiesIvewishedforareavailabletodayfromavarietyofthird partyvendors.Backup2.0forentireserversisntsomethingyouhavetowishfor;its somethingyoucanchoosetodonow,helpingyouachievethecapabilitiesthatbackups havealwaysallegedtoprovide: Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible. ThefollowingsectionshighlightafewspecificscenarioswheretheseBackup2.0 techniquescouldsavetheday.

Today,companiesspendthousandsonADbackupsolutionsthatcreatepointintime backupsofADandallowforsingleobjectrecoveryaswellasmorecompletewhole directorydisasterrecovery.ABackup2.0stylesolution,however,wouldbeabletonatively backupAD,becauseintheend,ADscomplexdatabaseisjustblocksondisk.Certainly,a backupsolutionwouldneedtoofferADspecificfunctionalityforrestores,ormighteven offeranADmanagementconsoleextensionthatmadeADrecoverycapabilitiesavailable rightfromthatconsole.Butwhenyoustartusingblocklevelbackups,ADsuddenlyisntso difficulttobackup.Youcangetrealtimebackupsofeverychange,automatically,withno extraeffort.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

InfrastructureserversareperfectforBackup2.0:YoullcaptureeveryDNSchange,every DHCPchange,andmoreonserversthatyoumightonlybackuponceaweekinthe Backup1.0world.Whybotherwithrealtimebackupsonaninfrastructureserver? Ifyouhavetodoabaremetalrecovery,thingslikeDHCPleaseswillstillbeintact yournetworkwonthavetogothroughaperiodofrecoveryandreadjustment. BothstaticanddynamicDNSrecordswillbemaintainedagaineliminatingthe periodofconfusionthatnormallyoccurswhenaDNSservercrashesandisbrought backonline. StillusingWINS?Eventhatdatabasecanbebackedupinrealtimeandrecoveredto aspecificpointintimehelpingeliminatetheneedforyournetworktostart massivebroadcastsandreregistrations,aswouldhappenwhenanemptyoroutof dateWINSdatabasewasrecovered. Infrastructureserverscanbeeasilyrestoredtoavirtualmachineintheeventofa completedisasterevenanoffsitevirtualmachine,makingiteasiertorecreate yourexactproductioninfrastructure,virtually,inadisasterrecoverymode.

Webserversarejustfilesandfolders,right?Whynotcaptureeverychange,andmakeit easiertorollbackanentireWebsitetoaknowngoodpointintime,includingWebserver configurationfilesandmetadata?ItdoesntmatterifyoureusingIISorApacheor somethingelseasyourWebserver,itsallblocksondisk,andaBackup2.0solutioncan grabitall. Backup2.0canevenhelpmakeWebfarmmanagementeasier.DesignateoneWebserver asyourmasterperhapsitsevenaprotectedserverthatdoesntacceptlivetraffic.Back thatupinrealtimeusingaBackup2.0stylesolution,capturingnewlyuploadedfilesfrom yourWebdevelopersaswellasconfigurationchangesfromWebmasters.Restorethose changestomultiplehotsparesinyourWebfarmwithnoeffortonyourpart,every memberofyourWebfarmnowhasidenticalWebcontentandserverconfigurationfiles! Yourmastercontentwouldremainprotected,soevenifoneofyourWebserverswas compromised,youcaneasilyandquicklyrestoreittothemostrecent,correctversion, bringingitbackintoproductionquicklyandeffortlessly. WanttorebuildyourWebfarmasvirtualizedservers?Noproblem:JustuseyourBackup 2.0solutiontorestoreyourmasterWebservertooneormorevirtualmachines. Reconfigureafewsettingssuchascomputernames,reconfigureyourloadbalancerto pointtothenewservers,andyourWebfarmismoved.Withtherightmanagementtoolson topofthebasicdiskblockbasedbackupsystem,itsallpossibleanditbringsvalueto yourbackupsolutionthatextendsbeyondmerebackupandrecovery.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

IfyouoperateaPublicKeyInfrastructure(PKI),youknowhowcriticalthoseCertification Authority(CA)serversare.Withdiskblockbasedbackups,youllalwayshaveareliable backupofeveryCAincludingeverycertificate,everypublickey,everyrevocation,and everyoutstandingcertificaterequest.IntheworstcasescenarioofacompleteCAfailure, youcanstillbringthePKIbackupquickly,eitherbyrestoringthemostrecentdiskblocks totheoriginalhardware,todissimilarhardware,oreventoavirtualserver.

Inthenextchapter,Illbetakingthesameapproachasthisonebutfocusingexclusivelyon MicrosoftExchangeServer.TheresnoquestionthatExchangeformsabigpartofmost organizationsmissioncriticallist,andhavingsolid,reliableExchangebackupsisequally critical.ButExchangecertainlymakesbackupandrecoveryabitmorechallenging,asyou needtosupportahighlevelofgranularityfromsinglemessagerecoverytobaremetal serverrestores.YouvegottodoallthatdespitethefactthatExchangesdatabaseis essentiallyabigblackbox,notabunchofmoreeasilymanipulatedlittlefiles.Itsarealtest oftheBackup2.0methodology.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Askanyoneintheorganizationwhattheirmostmissioncriticalpieceofinfrastructureis, andyoullprobablyhearemailasacommonanswer.Oryoumightnot:Manyfolkstake emailforgranted,althoughtheyexpectittobeasavailableandreliableasatelephonedial tone.Userswhohaveneversufferedanemailoutagealmostcantimaginedoingso;once theydoexperienceanoutage,theymakesureeveryoneknowshowmuchtheyresuffering. Asoneofthemostpopularsolutionsforcorporateemail,ExchangeServeroccupiesa specialplaceinyourinfrastructure.Itsexpectedtobealwayson,alwaysavailable,and alwaysreliable.Disasterssimplycantbetolerated.Whatsmore,usersownmistakesand negligencebecomeverymuchyourproblem,meaningyouhavetoofferrecoveryservices thatarequickandeffective,evenwhenyourerecoveringsomethingthatausermistakenly deletedontheirown.

ExchangeServersnativebackupandrestorecapabilitiesaretiedinparttotheunderlying Windowsoperatingsystems(OSs)capabilitieswhichisntalwaysagoodthing.Partof Exchangesrecoverycapabilitiescomefromthefactthatdeletedmessagesarentactually deletedfromthesystem.EmailclientssuchasMicrosoftOutlookautomaticallymove deletedmessagesintoaRecycleBin,wheretheystayforaconfigurableperiodoftimeor untiltheusermanuallyemptiestheRecycleBin.Whenusingotheremailclients,suchasa genericIMAPclient,deletedmessagesareretainedontheExchangeServercomputereven iftheyrenotactuallymovedtotheRecycleBin;deletedmessagesaresimplyleftintheir originalfolderandhiddenfromtheusersviewuntilaconfigurableamountoftimehas passed,oruntiltheuserspecificallypurgesdeletedmessagesaspartofacleanup operation.AsFigure4.1shows,Outlookactuallydisplaysthesedeletedinplacemessages inaspecialfontratherthanhidingthemcompletely,illustratinghowIMAPmessagesare leftinplacewhendeleted.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Allofthisfunctionalityisdesignedtoprovideuserswithaselfservicerecoveryoption:If theyaccidentallydeleteamessage,theycaneitherundeleteitorretrieveitfromthe RecycleBin. OnceamessagehaspassedbeyondtherealmoftheRecycleBinorotherundeleteoptions, recoveringamessagebecomesyourproblem.Unfortunately,ExchangeServerdoesnt includeanybuiltinbackupandrecoverymechanisms;itdoesincludeanapplication programminginterface(API)thatallowsotherapplicationstointeractwithExchange Servertomakebackupsandperformrestores.ExchangeprovidessupportforWindows VolumeShadowService(whichIdiscussedinthepreviouschapter)forbackups,toothe WindowsnativeBackuputility,includedwithWindowsserver2003,canusetheVolume ShadowServiceinterfacetomakebackupsofExchange. Note Inwhatmusthavebeenamiscommunicationbetweenproductteams,the newWindowsServerBackuputilityincludedinWindowsServer2008does notoffersupportforExchangeServerbackups,meaningyouhavenonative optionforproducingbackupsofyourExchangedata.Microsoftdoesofferan additionalcostbackupsolutionthatsupportsExchangebackups,and obviouslynumerousthirdpartiesprovidevaryinglevelsofsupportfor Exchangebackups.AsofExchangeServerServicePack2,Exchangeincludes anewpluginthatdoesenableWindowsServerBackuptonativelybackup andrestoreExchangedatabases. AsofExchangeServer2007,ExchangeincludesafeaturecalledClusteredContinuous Replication.CCRisdesignedtoreplicateExchangedatabasetransactionstheindividual changesthataremadetothedatabasetoaseparateExchangeServercomputer.There arespecifichardware,software,andenvironmentalrequirementstomakeCCRwork,andit doesrequirethatyouhaveadditionalExchangeServercomputersintheenvironment.CCR isMicrosoftspreferredsolutionforwholeserverrecoverybecauseitessentiallykeepsa sparecopyoftheExchangedatabaseonaseparatemachine.ThecostsinvolvedinCCRcan bequitehigh,however,becauseyourebasicallymaintainingacomplete,spareExchange Servermachinehardwareandall,unlessyourspareisvirtualizedjustsittingaround waitingforthefirstservertofail. Figure4.2showswhatCCRlookslike;noticethatathirdwitnessexistshere.Thewitness jobistomakesurethattheprimaryactivenodeisworking;ifitisnt,thewitnessiskeyin makinganautomaticfailovertothepassivenodehappen.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure4.2:CCR. AvariationofCCRisLocalContinuousReplication;LCRdiffersinthatitusestransaction replicationtocreateacopyoftheExchangedatabaseonthelocalserver,onaseparateset ofdisks.Thisgivesyouacopyofthedatabasewithouttheneedforaseparateserver, althoughyourExchangeServerhardwareobviouslyremainsasinglepointoffailureinthat scenario.LCRislessexpensivethanCCRbutdoesrequireextralocallyattachedstorageon theExchangeServercomputer. CCRisprimarilyusefulforwholeserverfailuresafullondisaster,inotherwords(LCRis onlyusefulatprotectingagainstadatabasefailureiftheentireserverfails,youlosethe LCRreplica,too).Neitherofthesereplicationtechniquesisespeciallyusefulforrecovering singlemessages.Infact,neitherWindowsnorExchangeoffersaparticularlyeffective solutionforsinglemessagerecovery.Instead,theyrelyentirelyontheRecycleBin functionalityimplementedinOutlook,themostcommonlyusedExchangeclient application.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Exchangeoffersuniqueproblemsandchallengesinthebackuparena.Illdiscussmanyof theseinmoredetaillaterinthischapter,butforrightnow,Iwanttobrieflyintroducethem fromabusiness,ratherthanatechnology,perspective.

MostofthesederivefromExchangesarchitecture,soitsworthtalkingabitabouthowthat architectureworks.Exchangeisbuiltaroundatransactionaldatabase.Inthisregard, ExchangeissimilartoSQLServer,althoughtheunderlyingstructureofExchangedatabases isverydifferentfromtherelationalonesfoundinSQLServer.Transactionalmeanssome importantthings: Whenchangesaremadetothedatabase,anoteofthosechangesisfirstmadeinthe transactionlog,aspecialfilemanagedbyExchangeServer.Changesmightinclude newmessages,incomingmessages,orevenchangestomessagessuchasmarking amessageashavingbeenreadorrepliedto.Thetransactionlogisbasicallyatodo listmarkmessage#164783asreadorinsertnewmessage#7847829withthe followingcontents. Afternotingthechangeinthetransactionlog,Exchangesearchesitsdatabasefor thebitsofdatathatactuallyneedchanged.Thosebitsareloadedintotheservers memory,andthechangesareappliedtothedatainmemory. Afteracertainamountoftime,thechangeddataiswrittenbacktothedatabaseon disk.Thishappensquickly,butoftennotimmediately;Exchangemaychooseto cachedatainmemorysothatmultiplechangescanbeappliedinsuccession. Oncechangeddataissuccessfullywrittenbacktothedatabaseondisk,Exchange goestothetransactionlogandchecksoffthechangeashavingbeencompleted andcommitted.

IftheExchangeServercomputercrashesorlosespower,noworkislostprovidedthe transactionlogisintact.Eventhoughchangesexistingonlyinmemorymaynothavebeen safelywrittentodisk,Exchangecangobacktothetransactionlogandsimplyredo,or replay,anytransactionsnotcheckedoffascommitted.Thistransactionlogalsoprovides thebasisforLCRandCCR:IndividualtransactionsarereplicatedfromtheExchangeServer logandreplayed,creatinganexactduplicatedatabase.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

SotheExchangedatabasefilesareactuallytheresultofmillionsoftransactionsbeing appliedinmemoryandthensavedtodisk.Thedatabaseisobviouslyindexedsothat individualmessagescanbefoundeasily,andagreatdealofstructureddatasuchaswhich messagesbelongtowhichusersisstoredinthedatabasealongwithactualmessagedata. Normally,whileExchangeServerisrunning,onlyitsprocesseshaveaccesstothedatabase. Allofthisconspirestomakecertainbackupandrecoverytasksabitmorecomplicated: IndividualItemRecovery.Becauseindividualmessagesarestoredinamonolithic databaseratherthanasindividualfilesondisk(asisthecasewithmostUnixbased mailapplications),recoveringanindividualmessagecanbetough.Youmight,for example,havetoretrievetherightwholedatabasebackup,thendiveintoitas Exchangewouldtofindthemessageormessagesyoureafter. DataCorruption.Theslightestdatacorruptiononabackupcanrendertheentire databaseuselessmeaningwhateveryoureusingtomakebackupshastobe100% reliableandcapableofdetectingandrepairingdatacorruption. DataDeDuplication.Exchangeactuallyhasbuiltindatadeduplicationofasort. Individualmessages(and,ifconfigured,attachments)addressedtomultipleusers arestoredonlyonceinthedatabase,providedalltheusersmailboxesareinthe samemessagestore.Thus,backupsoftwaregetstheadvantageofthisde duplication,creatingsmallerbackupsthanifeachmessagewasextracted individually. However,inordertofacilitatesinglemessagerecovery,manybackupsolutionsnot onlybackuptheentiredatabasebutalsoextractindividualmessagesandbackup thoseindependently.Thisletsthemindex,search,andrecoverindividual messagesbutwithsomesolutionslosesthebuiltindeduplicationandincreases thesizeofthebackupdata. SearchandeDiscovery.Exchangedoesnthavegoodbuiltincapabilitiesfor searchingacrosstheentiredatabase,whichisoftenneededwhenyouneedto recoveramessageorperformeDiscoveryforlegalpurposes.Becausemanybackup solutionsgrabtheentireExchangedatabase,theyreoftenincapableofsearching throughthatdatabaseeither.

Obviously,someofthesespecialconcernsareoneswellhavetoaddressinaBackup2.0 solution.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

IwanttolookathowoldstyleBackup1.0solutionsaddressboththebasicandspecial needsofExchangeServerrecovery.Itsimportanttorecognizewhatworksandwhat doesntinthesetraditionalsolutionssothatwecanidentifyareasforimprovementaswell asareasthatshouldberetainedinanewstyle,Backup2.0solution.

ExchangeServerbackupscanbecomplicatedfromaprocessviewpoint.ConsiderFigure 4.3,whichisexcerptedfromablogentryat arewestillbackingupexchange.aspx.TheauthorproposesthatExchangeServernotbe backedup.Instead,hesuggestsenablingcircularloggingmeaningExchangestransaction logwillautomaticallyoverwriteolderentriesasneededtowritenewones.UsingCCR,the Exchangedatabaseisreplicatedinthisproposaltotwopassivenodes,makingtwo completecopiesofthedatabase.Onepassivenodesitsinthedatacenter,readytotake overintheeventofafailureintheproductionExchangecomputer.Theotherpassivenode isinanoffsitelocationanddelaysreplayingincomingtransactionsby7daysmeaningits copyofthedatabaseisalways7daysold.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Therearesomedownsidestothisapproach.Althoughitprovidesgreatalmostinstant recoverycapabilitieswithverylittlelostdata,itwouldbeveryexpensivetoimplement. YourelookingattwoadditionalExchangeServerlicenses,eveniftheyreonvirtual machines.Iftheyrenotvirtualized,thatstwoadditionalExchangeServermachines,too, andagreatdealofnetworkbandwidth.Youdstillhavetohavesomekindofbackup runningtosupportuserswhodeletemessagesandwantthembackintheproposal, Exchangeretainsdeleteditemsforjust30daysandmanyorganizationsmustduetolegal orindustryregulationsretainmessagesforafarlongerperiodoftime. TraditionalExchangebackupstypicallyseektograbtheentiredatabase,usuallyby connectingtoExchangeServersVolumeShadowServiceAPI.Asmentionedearlier,these solutionsmayalsoextractindividualmessagesthroughotherAPIs,givingthemnotonlya completecopyofthedatabaseusedfordisasterrecoverybutalsoaccesstoindividual messages.

ThemostcommonrestorescenariosinExchangearesinglemessagerecoveryorsingle mailbox(includingallofitsmessages)recovery.Anarticleat commonwayofdoingthisinExchangeServer2003:StartbyinstallingthefreeExMerge utility(availablefrom fromtapeorwhateveryoumaywinduprestoringittoadifferentExchangeServerso thatyourenotaffectingyourproductionserver.AsFigure4.4shows,youllbeabletouse ExMergetoexportthedesiredmailboxtoaPSTfile,whichcanbeopenedwithMicrosoft Outlook.Ifyouwanttorecoverasinglemessage,youattachthatPSTtoanOutlookclient andgohuntingforthemessageyouwant.MessagescanbedraggedoutofthePSTfile,via Outlook,anddroppedintoanactiveExchangemailboxtogetthemessagebackontothe server.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure4.4:RecoveringasinglemailboxinExMerge. NewerversionsofExchangeofferaMailboxRecoveryCenterthatperformsessentiallythe sametaskwithouttheneedforExMerge.Youstillhavetoaddastoragegrouptothe RecoveryCenter,restoreanExchangedatabase,mountthedatabaseintotheRecovery Centerstoragegroup,thengobrowsingforthemailboxyouwanttorecover.Figure4.5 showswhattheRecoveryCenterlookslike.Itsstilltimeconsuming,butperhapsprettier thanExMerge.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure4.5:MailboxRecoveryCenter. Frankly,thiswholeprocessisnuts.Itsslow,cumbersome,andincrediblylaborintensive foradministrators.ThisiswhyIveneverbeeninasingleenvironmentthatdoesnthave somekindofthirdpartybackupsolutionoftenjusttoprovidemoreefficientsingle messageandsinglemailboxrecovery. Thirdpartybackupsolutionsworkmorequicklybutinvolvesubstantiallythesame process.Yougogetyourbackupdataoffoftapewhichwilltakesometimebecauseyou mighthavetorestoreafullbackupandmultipleincrementalordifferentialbackupstore createthepointintimeyouwanttorestorefrom.Thebackupsoftwareusuallymaintains itsownindexesofavailablemessagesandmailboxes,soyoubrowseorsearchthroughthat untilyoufindwhatyouwant.Whatthesolutiontypicallyautomatesisthepainof extractingthemailboxormessagefromthedatabaseandputtingitbackintoExchange Serversotheprocessislesslaborintensivefortheadministratorbutstillpretty awkwardandnotnecessarilyveryfast.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

DisasterrecoveryinExchangeisstraightforwardandusuallytimeconsuming.You restorethemostrecentfullbackup.Yourestoreanyincrementalordifferentialbackups madesincethen.Yourestoreanytransactionlogbackupsmadesincethen.Finally,you standbackandletExchangesortitalloutandbepreparedtowaitbecausetheprocess cantakehours.ThedevelopmentofCCRandLCRtechnologieswasdriveninlargepartby thetimeconsumingnatureofmoretraditionalbackups;withCCRorLCR,youvegota sparedatabasesittingrightthere,readytobeusedprovidedwhatyoureafteristhemost recentdatabase.Intruedisasterrecoverysituationsatotalhardwarefailureorevena datacenterdisasteryouusuallydowanttogetthelatestversionofthedatabasebackup andrunningquickly. WhereCCRandLCRfailisifsomethinggoeswrongthatgetsreplicatedinthosecases,the copyofthedatabasewillalsocontainwhateverwentwrong,andyoullbebacktotime consumingtaperestorestorebuildyourdatabases.

Dependingonthebackupsolutionyoureusing,managingtraditionalbackupscanbequite ascience.BecauseExchangedatabasescangrowquitelarge,someorganizationsdonthave thetimetograbafulldatabasebackupasoftenastheydlike.Thatmeansyourestuck managingfullbackups,incrementalbackups,differentialbackups,andinmanycases,log backupsbackupsoftheExchangetransactionlog. Infact,managingtransactionlogbackupsiscrucialtominimizingdatalossintheeventofa failure.ThetransactionlogliterallycontainseverysinglepieceofworkthatExchange needstodo;Exchangesabilitytoreplaythatlogtorecreateworkisaneffectiverecovery technique.Someorganizationswillgrabtransactionlogbackupsthroughouttheday;many thirdpartyExchangebackupsolutionswillbundletransactionsfromtheloginto15 minuterecoverypoints.Ofcourse,losing15minutesofemailtrafficisstillaprettybig disaster. Thedownsidetoallthisissimplymanagementoverheadandstoragespace.Exchange backupscanoccupyalotofdiskandtapespace,andkeepingtrackofallthefilescanbe complex.Infact,mostthirdpartyExchangebackupsolutionsareprimarilysolutionsfor managingbackupfilesafterall,theactualbackupfunctionalitycomesfromExchanges APIs.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

LetsrevisitourBackup2.0missionstatementfromChapter1: Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible. ThisisatrickystatementtoevaluatewhenitcomestoExchange.Certainly,withCCRor LCR,wecanachievebackupsthatofferverylittledowntime;inthecaseofCCR,downtime mightamounttoafewseconds.Wewouldcertainlyloseverylittledata,althoughsomedata lossispossiblebecausebothCCRandLCRutilizeasynchronousreplication,meaningits possibleforafewminutesworthoftransactionstooccuronthesource,yetnotreplicateto themirrorwhenafailureoccurs. ButCCRandLCRhavetwodistinctproblems:First,theyonlymaintainacurrent,working copyofthedatabase;theydontprovidealongtermarchiveandtheydontallowyouto restoretoaparticularpointintime.Ifyouaccidentallydeleteamailbox,thatdeletionis replicated;afterthedeletedmailboxretentionperiodelapses,themailboxisgoneforever nomatterhowmanyCCRorLCRreplicasyouhave.Second,bothCCRandLCRare expensiveintermsofstorageresourcesforboth,andintermsofadditionalhardwareand softwarelicensesforCCR.NeitherLCRnorCCRaredesignedtoprovidesinglemessage recoverybeyondthedeleteditemretentionperiodinExchange. Note Itsbeensuggestedtomebysomeadministratorsthattheycouldsimplyset thedeleteditemretentionperiodveryhighashighas5yearsinonecaseI saw.Idontrecommendit;theExchangedatabasewillgethuge,anditsimply isntintendedtobeapermanentarchive.Performancewillsuffer,anditll becomeharderandhardertogetrealbackupsasthedatabasebloats. Traditionalthirdpartybackupsolutions,whichrelyeitherontheExchangetransactionlog ortheVolumeShadowServiceAPI,haveallthefailingsofanyBackup1.0solutionwhichI explainedatlengthinthepreviouschapter.Backupfilemanagement,backupwindows, timeconsumingrestores,andotherdisadvantageshavebeenfrustratingExchange administratorsformorethanadecade. Letmeclueyouintoalittlesecret:ThereasontraditionalExchangebackupscanbe frustratingorincompleteeveninthecaseofCCRandLCRisthattheyrelyoncatching transactionsastheyoccurorreadinginformationfromExchangesownAPIs.Inother words,everythingdependsonhowExchangeworks.Foranuptodatebackup,likewhat CCRandLCRoffer,youhavetoreplicatetransactions.Forafullpointintimebackup,you havetotalktoExchangeanddealwiththedatathewayExchangegivesittoyou.Whenit comestoExchangeBackups1.0,thatstheultimateproblem.Thesolution?Stopdealing withExchangeforyourbackups.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Inthepreviouschapter,Ipositedanewtypeofbackupsolutionthatfocusedondiskblocks. Figure4.6illustratesmyproposal:ForgetabouttalkingtoAPIsandjustgrabthe informationasitiswrittentodisk.

Figure4.6:AproposalforBackup2.0. Thinkaboutit:SoftwaredevelopersliketheoneswhowroteExchangeServerknow thatservermemoryisntreliable.Alossofpower,asoftwarecrash,whatever,andmemory islost.Disk,however,ismuchmorereliableandispersistent.Exchangestransactionlogis designedtohelpprovideacoverforunreliablememory:Intheeventofamemoryfailure, thetransactionlogallowsworktobereplayed.Forthatreason,thelogitselfsitson persistentdiskstorage. ThatmeansaBackup2.0solutioncansimplygrabblocksofdiskspaceastheyarechanged ondisk.Thatwillgrabanychangestothetransactionlogaswellaschangestothemain Exchangedatabasefiles(thereareafewfilesforeverymailstore).Byimmediately shippingcopiesofthosediskblockstoaseparateserver,youhaveacontinuousbackupthat doesntrelyontalkingtoExchangeAPIs,replicatingtransactions,oranyothercomplexity.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Now,thatsallwellandgoodforsimplefilesondisk:Ifyouwanttorestoresomething,just trackdownthediskblocksthatcomprisethefileandputthoseblocksbackontheserver. Poof,filerestored.ForExchangedisasterrecovery,asIllexplaininamoment,itsafast waytogetanentireserverbackonline.However,howdoesithelpwiththemorecommon restorescenarioslikesinglemailboxrecoveryorsinglemessagerecovery?

ThisiswhereweputBackup2.0tothetest:Doesitmeetthemissionstatementwhenit comestoExchange? Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible. Ithinkitdoes.Wevegotanearlyrealtimebackupofeverythingthatgetswrittento Exchangesdisksincludingdatabasesandtransactionlogs.Thatmeanswedontloseany data,andrestoringdatadoesntneedtoincludetakingExchangeoffline(unlesswere talkingaboutacompletedisasterrecoveryscenariowhichIllcovernext). Withtherighttoolsandinterfaces,Backup2.0enablessingleitemrecoverysomething Illoutlineabitlaterinthischapter.Thatsreallythekeyrestorescenario,althoughyou mightalso,fromtimetotime,needtorecoveranentireExchangedatabaseandmountit elsewherefortestingpurposes. Forexample,IhaveoneclientwhoroutinelyrestoresExchangedatabasestoa disconnectedExchangeServer,wheretheyperformvulnerabilityscanningandantispam testing.Backup2.0excelsatthis,asitcanquicklybringbackanindividualfileevenone aslargeasanExchangedatabaseveryquickly.ButthatskindofaBackup1.0mentality: WithBackup2.0,youcouldmakethattestingoperationevenfasterbysimplyexportingthe entireserversdiskimageintoabootablevirtualmachine.Thatvirtualmachinecanbe easilysegregatedfortestingsothatitwouldntinterferewiththeproductionnetwork(that kindoftestingiswherevirtualizationsawitsfirstwidespreaduses,infact). Note Backup2.0isallbasedondiskblocksraw,diskleveldata.Wherethatdata sitsdoesntmatter,meaningBackup2.0isalsoagreatwaytodophysicalto virtual,physicaltophysical,virtualtovirtual,andvirtualtophysicalmoves andmigrations.IveusedBackup2.0stylesolutionsinmanycasestomove physicalExchangeServercomputersintovirtualmachinesaspartofalarger enterprisevirtualizationproject.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

DisasterrecoveryiswhatBackup2.0isallabout,andExchangeServerisnoexception. Withadiskblockbasedbackupimage,youcanquicklyrestoreyourentireExchange Servertonotjustthemostrecentbackupbutalsotoanygivenpointintime.Youcaneven restoreyourExchangeServertoavirtualmachine,whichisgreatforhugedisaster recoveryscenarioswhereyoumightbehostingthosevirtualmachinesatarecoveryfacility oreveninsomeonlinehostingprovider. SohowdoesBackup2.0complementorinterferewithCCR,Exchangesbuiltinrecovery solution?KeepinmindthatCCRrequiresapassive,standbyserver.Thatmeansthe expenseofadditionalWindowsandExchangelicenses,andpossiblytheexpenseof dedicatedhardware,allasastandbytoafailure.Thatsanexpensesomeorganizationsare happytobear,butitsnotforeveryone.Insomecases,yourCCRpassivenodemightbea lesscapablemachine(thatmightbethecaseifitwasrunninginavirtualmachine,for example)designedtogetyouthroughatoughtimewithlessthannormalperformance.In thoseinstances,Backup2.0canhelpbygettingExchangeupandrunningmorequicklyon youroriginal,fullpoweredhardware.FororganizationsthatcantaffordCCR,Backup2.0 provideswhatisperhapsthenextbestthing:AfastwaytoquicklybringExchangeback onlineinabaremetalrecoverysituation. Backup2.0complementsCCRinthatBackup2.0providestheabilitytorollbacktoa previouspointintime;CCRdoesnot.CCRsgoal,remember,istocreateanexactreplicaof yourExchangedatabaseswithaslittlelatencyaspossible.Thatmeansifyoudosomething wrong,thatsomethingisgoingtoreplicateviaCCRveryquickly,meaningyourbackupis alsomessedup.CCRcantundeleteamailboxoramessage,anditcanthelprecoverfrom accidentalormaliciousactions.Backup2.0,however,candosoanditcanprotectyour passiveCCRnodesatthesametimeitprotectsyouractiveExchangeServercomputers. WhatIlikebestaboutBackup2.0isthatthebackupscanberestoredalmostanywhere. LoseanExchangeServercomputeranddonthaveasparehandy?Noproblem:Restoretoa virtualmachine(Itellclientstoalwayshaveatleastonevirtualizationhosthangingaround thathassomesparecapacityforjusttheseemergencies).NoreinstallingWindows, reinstallingExchange,reconfiguringExchange,andwaitingontapebackupstounspool yourbackedupdatabasesjustdumptheentireserverdiskimageintoavirtualmachine. Itsafastprocessandtheresultisacompletelyconfiguredcomputerthatisthecomputer youlost.Clientsjustreconnectandstartworking.

MyBackup2.0ideadoesneedtohaveafewmoreExchangespecificcapabilities.For example,Exchangeisdesignedsothattransactionsremaininitsloguntilabackupofthe databaseismade;thatway,youreassuredofthelogservingasabackupfortransactions untiltherelateddataissafelyontape.InaBackup2.0world,traditionalbackupsdont occursothebackupagentrunningontheExchangeServercomputerneedstobesmart enoughtotruncatetheExchangetransactionlogaftertransmittingtherelateddiskblocks offtothebackupserver.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Fromthere,youreleftwithoutmuchtomanage.Nologbackups,nofullbackups,no differentialbackupsjusttheabilitytorestore,fromanimage,anybitofExchangeyou needto,atanytime.Asyoullseeinthenextfewsections,though,Backup2.0canenable someprettyimpressivenewmanagementscenarios. WhatAboutPerformance? DoesntallthisBackup2.0magicplacesomeseriousburdenonyour ExchangeServercomputers?Inmyexperience,no.Themajorityofthe overheadkicksinwhenyoustartdeduplicating,compressing,indexing,and savingdatathatisusuallyoffloadedtoacentralizedbackupserver.Allthe ExchangeServerbasedagenthastodoistransmitdiskblockdeltasoverthe networkyoumightseelowsingledigitincreasesinthingslikeprocessor utilization,butthatsit.Backup1.0solutionstendtohitExchangeServer harderbecausetheyrenotgrabbingdatainsmallchunksallday;theyre tryingtocramalltheirbackupactivityintoasmalleveningwindow.

SohowwillBackup2.0workwithExchange?Ivealreadypointedouthowspecialized Exchangeisinthewayitworks;willBackup2.0beabletoworkwithitandstillprovidea betterbackupsolutionthanBackup1.0does?MuchofExchangesfunctionalityand architecturearespecificallydesignedtoaccommodateandworkwithinaBackup1.0 worldwillturningthatworldintoBackup2.0breakeverything?

ABackup2.0solutionneedstobeCCRaware.Afterall,CCRisstillavaluablehigh availabilitytactic,givingyounearinstantaneousfailoverintheeventofacompleteserver failure.CCRevensupportsgeographicallydispersedclustering.Soabackupsolutionneeds tounderstandCCRandworktotruncatetheactiveCCRnodeslogbasedonthepassive CCRnodesreplicationoftransactions.

RecoveringmailboxesorindividualmessagestoaPSTfilemaybeusefulbutyou shouldntbestuckwiththatasyouronlyoption.Honestly,givingauseraPSTfileand tellingthemtodraganddropmessagesinOutlookisinsanelyprimitive.ABackup2.0 solutionshouldeliminatethatoverheadandletyourestoredirectlytoaliveExchange Servercomputer. Further,aBackup2.0solutionshouldbeabletorecoverindividualmessagesfromthesame backupthatwouldbeusedfordisasterrecovery.Inotherwords,youshouldnthaveto extractindividualmessagesoutofExchangeyoushouldbeabletorecoverfromthe backupimageoftheactualExchangedatabase.How?


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Practicallyspeaking,itwouldprobablybeatwostepprocess.Assumeyouhaveanimage levelbackupofanExchangeServercomputer.Thatmeansyouvegoteveryblockofdata fromdisk,soyoucanreconstructtheentireserver.Withtherighttoolset,youwouldbe abletomountthatbackupasafilesystemineffectbrowsingthebackedupfilesystem fromaspecificpointintimeasifitwereanetworkdrive.Butyourejustlookingatthe backedupfilesExchangeisntrunninganditsdatabasefilesarentopenedandbeing used;yourelookingatastatic,pointintimecopyofthosefiles.Fromthere,therighttool wouldletyoumountandbrowsetheExchangedatabasegivingyouaccesstoindividual mailboxes,messages,andotherdata.YouwouldntneedtodotheusualExchange escapadesofrestoringthedatabasefilefrombackup,mountingthedatabasetoaRecovery StorageGroup,andrunningExMergeorotherutilitiesagainstthemounteddatabase. Instead,youdjustdiveintothedatabaseusingautilitythatunderstandsthedatabase structure,andgetwhatyouneed.ItmightlooksomethinglikeFigure4.7.


Exchangessingleinstancestorageallowseachmessagetobestoredonlyonceinthe messagestoreitsaformofdatadeduplication.Butitdoesnthelpwhenamessageis senttouserswhosemailboxesareondifferentservers,orevenuserswhosemailboxesare indifferentstoresonthesameserver.Inthosecases,themessagewillbeduplicatedat leastonceperstore. ButBackup2.0candoabetterjobofdeduplicatingdataatleastdatafromasingle serverbecauseitsexaminingdiskblocks.Thesamemessagestoredondisklooksthe same,eventhoughthatmessagemighthavetobeduplicatedacrossmultiplemail databases.SothemessagewillbeduplicatedinExchange,butonceitsbackedupbythe Backup2.0solution,thatsolutioncandetecttheduplicatediskblocksandstoreonlya singleinstancemeaningthebackupcanbesmallerthantheoriginaldatabase.Addin compression,somethingevenBackup1.0solutionsoffer,andthebackupcanbemany timessmallerthantheoriginaldata.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Becausedataisbeingbackeduponablockbyblockbasis,itseasierforaBackup2.0 solutiontodetectandcorrecterrors.Asingleblockofdiskdatamightbeassmallas4 kilobytesdetectingatransmissionerrorinthatsmallapieceofdataiseasy.

SearchandeDiscoveryarerapidlybecomingkeycomponentsformanyorganizations.The USFederalCourtSystem,forexample,hasimposedstrictrulesthatrequireprettyrapid responsestoeDiscoveryrequestsduringcourtproceedings;failuretomeetthese requirementscanleadtofinesandevensummaryjudgments.KnowingthattheExchange databasedoesntprovidesolidsearchcapabilitiesnatively,manycompaniesrelyon dedicatedmessagearchivalandretrievaltoolsanadditionalexpenseandyetanother massofstorageresourcestomanage.ABackup2.0solution,however,canprovidesolid searchandeDiscoverycapabilitiesbuiltrightin. Considertheabilitytomountapointintimebackupimageasabrowseablefilesystem,as Ivedescribedearlier.AlsoconsidertheabilitytobrowseanofflineExchangedatabase fromthatfilesystem.GiventhosecapabilitieswhichaBackup2.0solutionmightwell offerasameansofperformingsinglemessagerecoveryyoucouldeasilyimplementa powerfulmessagesearchfunctionthatmakesmessagesearchingandeDiscoverypossible. Figure4.8showswhatitmightlooklike.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Importantly,thistoolwouldneedtobeabletoattachtomultipleExchangedatabasesto search;youcannevertellaheadoftimewhichdatabasewillcontainthemessagesyoure after,andyoudontwanttohavetosearcheachoneindividually. InaneDiscoveryscenario,youlltypicallywanttorestoremessagesnottoaliveExchange ServercomputerbutrathertoaPSTwhichwilloftenbedeliveredtolegalcounsel.Figure 4.9showshowaBackup2.0toolsetmightimplementthatexport.

Figure4.9:ExportingsearchresultstoaPSTfile. ItsimportantthatyounotoverbuildyourexpectationsforaBackup2.0solution,though. MessagesearchandrecoveryisonlyoneaspectofeDiscovery;manyorganizationsthat routinelydealwithlegalsummonsprefertotagandcategorizemessagesastheyresent; thismakesiteasiertolocatemessagesondemand(andhelpscategorizemessagesfor securityandmonitoringpurposes,too),butobviouslygoeswellbeyondwhatyoudexpect fromabackupsolution.SotherewillstillbeamarketforspecificeDiscoverysolutions, especiallyforverylargecompanieswhoroutinelyhavetoperformeDiscoverytasks.

IfyouthoughtExchangeServerhadsomespecializeneeds,waituntilIgetintoSQLServer inthenextchapter.Microsoftsrelationaldatabasemanagementsystemisoneofthefew Microsoftproductsthathashadawellunderstoodbackupandrestoresystemformany yearsbutonceagain,IlltryandturnBackup1.0onitsheadandshowyouwhereour longusedroutinesandtechniquesjustdontmeetmodernbusinessneeds.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

MoreandmorecompaniesareusingMicrosoftSQLServerthesedaysandinmanycases, theydontevenrealizeit.WhileplentyoforganizationsdeliberatelyinstallSQLServer, manybusinessesfindthemselvesusingSQLServerasasideeffect,becauseSQLServeris thedatastoreforsomelineofbusinessapplication,technologysolution,andsoon.Infact, SQLsprawlmakesSQLServeroneofthemostchallengingserverproductsfromabackup perspective:NotonlyisSQLServerchallenginginandofitself,butyouwindupwithtons ofinstances! HereswhatIseehappeninginmanyorganizations:Thecompanyhasoneormoreofficial SQLServerinstallations,andtheITteamisawareoftheneedtobackuptheseinstanceson aregularbasis.ButtherearealsonumerousstealthinstallationsofSQLServer,often runningontheExpresseditionofSQLServer,thattheITteamisunawareof.Thedata storedinthesestealthinstallationsisnolessmissioncriticalthanthedataintheofficial installations,butinmanycases,thatdataisntbeingprotectedproperly.Dealingwiththis sprawlisjustoneoftheuniquechallengesthatBackup2.0facesinSQLServer.

SQLServerhasalwaysofferedanativeapplicationprogramminginterface(API)for backingupdatabases.Infact,SQLServerhaslongbeenoneofthefewMicrosoftserver applicationsthatnativelysupportstapebackup,withoutusingWindowsownbackup utility.Thenativebackuptoolsetisactuallyquiterobust,supportingfeatureslike compression(highlightedinFigure5.1),encryption,andsoforth.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure5.1:SQLServersnativebackupinterface. TounderstandSQLServersnativebackuptechnology,youneedtofirstknowabitabout howSQLServerworksunderthehood.

SQLServerstoresthingsondiskin8KBchunkscalledpages.Italsomanipulatesthose same8KBchunksinmemory,meaningthesmallestunitofdataSQLServerworkswithis 8KB. Whendataiswrittentodisk,anentirerowofdatamustfitwithinthat8KBpage.Its possibleformultiplerowstoshareapage,butarowcannotspanmultiplepages.So,ifa CustomerstablehascolumnsforName,Address,City,State,andPhone,thenallthatdata combinedmustbelessthan8KB.Anexceptionismadeforcertaindatatypessuchas binarydatalikephotos,orlargegobsoftextwheretheactualpageonlycontainsa pointertotherealdata.Therealdatacanthenbespreadacrossmultiplepages,oreven storedinafile.SQLServergathersallthese8KBpagesintoasimplefileondisk,which usuallyhaseitheran.MDForan.NDFfilenameextension.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

WhenSQLServeristoldtodosomething,itsbymeansofaquery,writtenintheStructured QueryLanguage(SQL)syntax.Inthecaseofamodificationquery,SQLServermodifies thepagesofdatainmemory.Butitdoesntwritethosemodificationsbackouttodiskyet, astheremightbeadditionalchangescomingalongforthosepagesandthesystemload mightnotofferagooddiskwritingopportunityrightthen.WhatSQLServerdoesdo, however,ismakeacopyofthemodificationqueryinaspeciallogfilecalledthetransaction log.Thisfile,whichhasan.LDFfilenameextension,keepsarecordofeverytransactionSQL Serverhasexecuted. EventuallymaybeafewsecondslaterSQLServerwilldecidetowritethemodified pagesouttodisk.Whenitdoesso,itgoesbacktothetransactionlogandchecksoffthe transactionthatmadethemodificationsessentiallysaying,Okay,Imadethatchangeand itsbeenwrittentodisk.ThatwaySQLServerknowsthatthechangeissafeondisk. IntheeventthatSQLServercrashes,ithasanautomatedrecoverymodethatkicksinwhen itstartsbackup.Itgoesstraighttothetransactionlogandlooksforuncommitted transactionsthosethathavenotyetbeencheckedoff.Itknowsthatthecheckedoff transactionsaresafeondisk;anythingelsehadnotbeenwrittentodiskandwasstill floatingaroundinmemorywhentheservercrashed.SoSQLServerreadsthose transactionsoutofthelog,reexecutesthem,andimmediatelywritestheaffectedpagesto disk.ThisprocessallowsSQLServertocatchupwithanyinprogresswork,andensures thatyouneverloseanydataprovidedyourdiskfilesareokay,ofcourse. Thinkaboutthisimportantfact:EVERYTHINGthathappensinSQLServerhappensonly throughthetransactionlog,andSQLServercanrereadthelogtorepeatwhateverhas happened.ThisprocessmakesnearlyeverythingthatSQLServerdoespossible.

SQLServersnativebackupsystemworksinconjunctionwiththetransactionlog. Essentially,therearetwotypesofbackupSQLServercanmake:databackupsandlog backups.Databackupsare,asyoumightsuspect,ofthedatabaseitself.Thesearedoneina Backup1.0stylemanner,grabbingasnapshotofthedataasitsitsduringthebackup.Log backupsgrabthecontentsofthetransactionlog. SQLServersnativebackupcapabilitiesincludetheabilitytobackupadatabasewhileits inuse,althoughdatabaseperformancecanslowslightlywhileabackupoperationis underway.TheabilitytobackupaninusedatabasemeansthatSQLServerislessimpacted bybackupwindowsthanmanyotherserverproducts,anditmeansthatyoureabitless tiedtotheBackup1.0modelofonlygrabbingbackupswhilethedataisntbeingused. ButthatdoesntmeanSQLServerisentirelyfreeofbackupproblemsandchallenges.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

ThereareafewdistinctchallengespresentedbytraditionalSQLServerbackuptechniques: Sprawl.AsImentionedearlier,mostorganizationshavealotmoreSQLServer installationsthantheyoftenrealize,andbackingupthemallcanbepainful.Insome cases,particularlywiththeExpresseditionsoftenembeddedintolineofbusiness applicationsandITtools,SQLServerisrunningonaclientcomputerthatisntbeing treatedlikeaserverintermsofbackupandrecovery. Snapshots.JustlikeanyBackup1.0scenario,SQLServerbackupsarebuiltaround theideaofpointintimesnapshots.AsIlldescribeinabit,SQLServerdoesoffer someuniqueabilitiesthatletyoutakemoresnapshotsmorefrequently,butyoull alwayshaveacertainamountofdataatrisk. Recoverytimes.AlthoughSQLServercanbeprettyflexibleinhowitmakesyoudo backups,restoringisstillatimeconsumingoperation.Sotimeconsuming,infact, thatsomecompanieshavecreatedtoolsthatcanattachadatabasebackuptoSQL Server,allowingthebackupdatatobequeriedwithoutactuallyhavingtorestore thedatabase.Thistrickisusefulforthingslikechangecontrol,butitdoesnthelp fromabackupandrecoveryperspectivesimplybecausetheattachedbackupis readonly. Transactionlogs.InSQLServer,backupsareintimatelytiedtothetransactionlog, andbackupsarerequiredinordertokeepthetransactionlogfromgrowinglarger andlarger.AnybackupplanthatdoesntusethenativeAPIsneedstodealwiththis fact.

AnyproposedbackupsolutionthatdoesnotuseSQLServersnativeAPIswillbe challenging.Infact,mostthirdpartybackupsolutionsaresimplyagentsthatsitontopof SQLServersnativeAPIs!ThissetupensuresthatSQLServersinternalneedslikethe transactionlogaretakencareof,butitalsohashistoricallylimitedthirdpartysolutions tothesamebasicfeaturesetasSQLServersnativecapabilities.MostthirdpartySQL ServerbackupsolutionsarereallylittlemorethananagentthattakesdatafromSQL ServersnativeAPIs,andtransmitsthatdataacrossthenetwork.

SohowhasSQLServertraditionallybeenincludedinabackupandrecoveryplan?Lets considersomeofthetechniques,scenarios,andtoolsthatarecommonintheBackup1.0 world.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

SQLServernativelyoffersthreetypesofbackup.IknowIsaidtwoearlier,buthearmeout: FullBackup.Thisisacompletebackupoftheentiredatabase.Oncemade, committedtransactionsinthetransactionlogarecleared,aprocesscalledlog truncation;thisiswhatkeepstransactionlogsfromgrowingforever. DifferentialBackup.Thisisalsoabackupofthedatabase,butonlythedatathat changessincethelastfullbackupisincluded.Again,thetransactionlogistruncated. TransactionLogBackup.Thisdoesntgrabanyoftheactualdata;itsimplygrabs thecurrentstateofthetransactionlogandthentruncatesthatlog.

Sotwokindsofdatabackupandalogbackup.AlthoughSQLServercanbackupanactive database,itsnotsomethingyouddoduringpeakdatabaseusageduetoperformance concerns,sofullandevendifferentialbackupsarestillusuallydoneduringoffpeak periodsorduringaneveningorweekendmaintenancewindow.Becauseitcanbedifficult togetanightlyfullbackupoflargedatabasesinthatwindow,administratorstypically resorttoatieredbackupplangrabbingfullbackupsontheweekends,forexample,and differentialseachevening.Tohelpreducetheamountofatriskdata,transactionlog backupscanbemadeperiodicallythroughouttheday.Thesebackupsareveryfastand offerlittleperformanceimpact,soapracticalbackupplanmightlooksomethinglikethe oneinFigure5.2.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Withthisplan,themaximumamountofatriskdataisaboutanhour,asthatstheinterval betweentransactionlogbackups.Ofcourse,inabusydatabase,anhourcanbealotofdata! ReviewingourmanifestoforBackup2.0: Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible. Anhourofatriskdatacertainlydoesntpreventusfromlosinganydataorlosingany work.Inaddition,therestorescenarioassociatedwiththiskindofbackupplanis,asyou shallsee,hardlyconducivetoaslittledowntimeaspossible.

SQLServerrecoverycanbeatimeconsumingthing.Essentially,youhavetostartwith yourmostrecentfulldatabasebackup,thenaddonthemostrecentdifferentialandevery transactionlogbackupmadesincethen. Infact,youhavetobeveryspecificaboutwhatyouredoingwhenyouconductarestore anaspectofSQLServerthatIvefranklyseenalotofadministratorsmessupprettybadly. Ifyouconductanormal,fulldatabaserestore,SQLServerwillbydefaultputtherecovered databaseonlineassoonasitsdonewiththerestoreoperation.Ifyoustillhavea differentialorsomelogbackupstoapply,youreoutofluck;youhavetostarttherestore over.ThetrickistotellSQLServer,asyourerestoringthefullbackup,thatyouhavemore filestorestore.Youcontinuetellingitthatuntilyourestorethelasttransactionlogbackup, atwhichtimeyoutellSQLServerthatitssafetostartrecovery.ThenSQLServerwillstart applyingthedifferential,thenthetransactionlogbackups,andthenyourdatabasewillbe readytouse.Aslittledowntimeaspossibleisntverylittle,inmostcases,andyoullstill bemissinganychangesthatoccurredafterthemostrecenttransactionlogbackup. SQLServerRecovery Foralargedatabase,SQLServersrecoverytimecanbequitelengthy.Lets sayyouusethebackupplanshowninFigure5.2,andsomethinggoeswrong at4pmonFridayafternoon.Youllhaveafullbackupfromtheprior weekend,Thursdaynightsdifferentialwhichmaybequitelarge,sinceit containsallthechangesfromthefullbackupuptoThursdaynightand hourlytransactionlogbackups. Notonlydoyouhavetowaitforallthosefilestostreamofftapeorwherever youstorethem,youhavetowaitforSQLServertoworkthroughthem.Ithas toapplythedifferentialbackuptothefullbackup,thenithastoreplayeach individualtransactionfromeverysingletransactionloginessence,ithasto reperformalltheworkthatwasdonealldayFriday.Foralarge,busy database,itmaybealongtimebeforethedatabaseisreadytouse. SQLServerdoesntnativelysupportsingleobjectrestores.Whatyoucandoisrestorea backuptoadifferentdatabase,thenmanuallycopyanyobjectsyouwantrestoredfromthat backup.Thisletsyourecoversinglestoredprocedures,tables,orevenrowsofdata providedyouknowhowtodosomanually.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

SQLServerdoessupportpointintimerecovery,withtheobviouscaveatthatitcant restoretoapointintimelaterthanyourmostrecentbackup.Pointintimerecoveryonly workswithtransactionlogbackupsbecausetransactionsinthelogaretimestamped.If youdiscardThursdaystransactionlogbackupsaftermakingadifferentialbackupon Thursdaynight,thenthefirstpointintimeyoucanrecovertoisthetimeofthatThursday nightdifferential.Thisactuallymakesbackupmanagementtrickybecausetoenable maximumpointintimerecovery,youhavetokeepalotoffileshangingaround:full backups,everynightsdifferential,everyhourstransactionlog,andsoforth. Considerthisscenario:YoureusingtheexamplebackupplanfromFigure5.2,which entailsaweeklyfull,nightlydifferential,andhourlytransactionlogbackups.Letssayyou keep3weeksworthofbackups,andWeek3isthemostrecentset.ItsFridayafternoon, andyourealizesomeonedeletedacriticalstoredprocedure.Youneedtorecoverthe databasetothepreviousWednesday(Week2)afternoon;Figure5.3illustratesthefilesthat youhaveonhandandwhichonesyoullhavetorestore.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

So,thats: ThebeginningofWeek2fullbackup TheTuesdaynightdifferentialfromWeek2 TheWednesdaytransactionlogbackupsuptothepointWednesdayafternoonyou wanttorecoverto

Thatssixorsofilestorecover,andthenyouwaitforSQLServertosortitallout.Intotal, youllbekeepingsomethinglike140fileslyingaround,assumingyoutakeatransactionlog backupeighttimesaday(onceeveryhourduringthenormalworkingday).

SQLServerdoesntofferanykindofnativedisasterrecoverycapabilities.Essentially,ifyou loseanentireserver,youllhavetorecoverWindows,installSQLServer,andthenstart restoringSQLServerbackupstobringyourdatabasesasuptodateaspossible.Traditional thirdpartyimagingsoftwareisnteffectivebecauseitsdifficulttoimageanactiveSQL Serverinstallation,andbecauseimagingdoesntalwaysworkwellwithSQLServersnative backupcapabilitiesmeaningitcanbetrickytorestoreanimageandthenalsorestore normalSQLServerbackupstobringyourdatabasesmoreuptodate. Inshort,letshopeyoudontloseanentireSQLServer. Infact,wholeserverdisasterrecoveryforSQLServerissounsatisfyingthatMicrosofthas madeaconsiderableinvestmentinSQLServerhighavailabilityfeaturesthattrytoreduce theneedtoeverdoawholeserverrecovery.Someoptionsinclude: TransactionLogShipping.Theideahereistostartoffwithtwoserversthathave anidenticalcopyofadatabase,thenshipthetransactionlogsfromtheactive servertothehotspareserver.Thesparereplaysthetransactionstobringitscopy ofthedatabaseuptodate;thetheoryisthatifthemainserverdies,thehotspare canbebroughtittoreplaceit. DatabaseMirroring.Essentiallythesameideaastransactionlogshipping,onlythe hotspareiskeptmoreuptodateandcantakeoverautomaticallyifthemain serverdies. Clustering.UtilizingWindowsnativeclusteringcapabilities,thisprovidesa completelyredundantserverwithdirectaccesstothesamedatabasefilesasthe mainserver.

AlloftheseoptionsrequireadditionalSQLServerinstallationsandhardware(orvirtual servers),andtheyrealldesignedtohandleacompletefailurescenario;noneofthese actuallyprovidesforpointintimerecoverycapabilities,sotheyretobeusedinadditionto normalbackuptechniques.Itcangetprettyexpensive,especiallyforsmallerandmidsize companieswhomaynotbeabletoaffordthislevelofrecoverabilityatleastinaBackup 1.0world.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Itouchedonthisearlier,buttheshortmessageisthatSQLServerbackupmanagementcan beprettypainful,unlessyoureonlyworriedaboutrestoringthedatabasetoitsmost recentstate.Inthatcase,youkeepthemostrecentfullbackup,mostrecentdifferential,and alltransactionlogssincethedifferential;thatsstillalotoffilestomaintainbutitsalot lessthantryingtokeepafewweeksworthoffiles. Ioncehadajobwhereweneededtobeabletorestorethedatabasetoanypointintimefor 3months.Youcanimaginethenumberoffileswehadtomaintain;Ithinkitwascloseto 600backupfiles,allfloatingaroundondifferenttapes,someofwhichhadtoberotatedoff siteitwasanightmareandjustdescribingitisgivingmeunpleasantflashbacks.Infact,it wasatthatexactpointintimethatIstartedtorealizethattheBackup1.0wayofdoing thingswasnotveryefficientespeciallybecausemanagingthatmanyfilesstillleftusat riskforanhourormoreofdataandwork.

SohowcanBackup1.0beimprovedfromaSQLServerperspective?Therescertainly plentyofroomforimprovementbasedonthetraditionaltechniquesandapproachesIjust discussed.

Thewholeideaofbeingabletomaketransactionlogbackupstohavelessdataatriskis wonderful,butitisultimatelyakludge.Itsaworkaroundtothesnapshotoriented approachofBackup1.0;IvesaiditbeforeandIllsayitagainhere:Backupsshouldbe continuous.Itsnotpracticaltocontinuallymaketransactionlogbackups,andthatsthe bestSQLServercanoffer;thatmeanswehavetomoveoutsideofthenativeAPIs.Thats scary,Iknow,becausesomuchofSQLServerdependsonfolksusingthosenativeAPIs.But stickwithme. IfweacknowledgethatSQLServersnativeAPIsarentgoingtogiveusfrequentenough backups,weneedtolookatotherwaysofgettingtothedata.GoingthroughSQLServeris nottheanswerbecauseSQLServerdoesnthavethebandwidthtofeedusanykindof continuousdatastream.Instead,weneedtograbthatdatadirectlyfromtheoperating system(OS),asthedatahitsthedisk.Keepinmind:AscomplicatedasSQLServeris, ultimatelyitsalljustbitsondisk.TheresnoreasonwecouldnthaveaBackup2.0style agentsittingontheSQLServercomputer,grabbingdiskblocksasSQLServerwrites changestothedisk.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Cleverreaderswillhavespottedaproblemwiththistheory,frommyexplanationonhow SQLServerworks: WhenSQLServeristoldtodosomething,itsbymeansofaquery,writteninthe StructuredQueryLanguage(SQL)syntax.Inthecaseofamodificationquery,SQL Servermodifiesthepagesofdatainmemory.Butitdoesntwritethose modificationsbackouttodiskyet,astheremightbeadditionalchangescoming alongforthosepagesandthesystemloadmightnotofferagooddiskwriting opportunityrightthen. Oops.IfSQLServerdoesntwritethedatatodiskquickly,thenthatdataisatriskbecause allweregrabbingarethechangesthatactuallymakeitontothedisk.Buttheanswerto thispotentialproblemalsoliesintheverywaythatSQLServerworks: WhatSQLServerdoesdo,however,ismakeacopyofthemodificationqueryina speciallogfilecalledthetransactionlog.Thisfile,whichhasan.LDFfilename extension,keepsarecordofeverytransactionSQLServerhasexecuted. Thetransactionlogitselfisjustafileondisk;Microsoftknowsperfectlywellthatanydata livingentirelyinmemoryisalwaysatrisk,andsothetransactionlogsentriesarewritten todiskimmediately.Allouragentwouldneedtodoisalsograbthechangestothe transactionlog.Then,inafailure,wedsimplyrestorethedatabase,restorethetransaction log,andletSQLServersnaturetakeitscourse.

TherestorescenariosinaBackup2.0worldwouldbevastlyimproved.Forone,the conceptofBackup2.0involvescontinuouslystreamingchangeddiskblockstosomecentral repository;thatbeingthecase,youdsimplyselecttheexactpointintimeyouwantedto restoreto,thenstreamthosediskblocksrightbacktowheretheycamefrom.Youmight havetoshutdownSQLServerwhileyoudidthat,butyoumightnot;programmerscanget prettycleveratmanipulatingSQLServer,andSQLServeritselfisprettyopento manipulationinthisregard. Suddenly,nomoreworryingaboutfullbackups,differentials,andtransactionlogs.You dontcareaboutthefilesperse;youonlycareaboutthediskblocksfromtheactive databaseandlogfiles.YourenotmakingbackupsintheSQLServersenseoftheterm; youreactuallyjustputtingthecomputersdiskbacktotheconditionitwasatacertain pointintime.SQLServerneveractuallyentersitsrecoverymode,becauseyouvenot restoredanyfilesintheSQLServerfashion.SQLServersimplyresumesworkingwiththe databaseandlogfilesjustasitnormallyworkswiththem. Thisentireidea,whichisattheheartofBackup2.0,tookmeawhiletoreallysortoutinmy mind.Intheend,everythingweknowaboutbackupsiswrong,whichiswhyIchosetouse thetermBackup2.0.Thisisanentirelydifferentwayoflookingatthings.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Whataboutsingleobjectrecovery?Thatwouldstillbetricky.Backup2.0willcertainlylet usrestoreasingledatabase,ratherthananentireserver,ifdesired.Butkeepingtrackof whichdiskblockswithinadatabasefilegowithaparticularstoredprocedure,for examplethatwouldprobablybeimpossible.Itcertainlysoundsdifficult.ButaBackup2.0 solutionshouldallowustoquicklyrestoreadatabasetoadifferentlocationafterall,a databaseisjustabunchofdiskblocks,andtheyshouldntcarewheretheywindupand wecoulduseSQLServersnativetoolstoscriptoutastoredprocedureandthenrunthat scriptonourproductiondatabase,oruseSQLServertoolstojustcopydatabaseobjects likeusersorwhateverfromonedatabasetoanother. SingleSQLObjects:Tricky,Tricky PartofthereasonitssotrickytorecoverasingleSQLServerdatabaseobject isthatSQLServerstoresobjectslikestoredproceduresastextdefinitions withinasetofsystemtablesinsidethedatabase.Inotherwords,objectsare externallyindistinguishablefromdata;inmostregards,objectsaredata. Ausefultooltohavehandy,then,issomekindofSQLServercomparison tool;useyourfavoritesearchenginetolookforsqlserverdiffandyou shouldfindseveral.Thesetoolscomparetwodatabaseslikearestored databaseandaninproductionversionandshowyouthedifferences.In mostcases,differencescanbeforwardedintotheotherdatabase,makingit easiertospottheexactdifferencesbetweenarestoreddatabaseanditslive counterpart,andtorestorespecificobjectsfromtherestoreddatabaseinto thelivedatabase. SomeBackup2.0toolsetsmightevenincludesuchcomparisonutilities,and mightevenincorporatethemintotherecoveryprocessforamoreseamless experiencewhenyourejustlookingforasingleobjectoutofabackup.

TheresnodoubtthatBackup2.0canofferabetterdisasterrecoveryoptionthanmore traditionaltechniques.JustconsiderFigure5.4,whichcomparesthetwophilosophiesina practicaldisasterrecoverytimeline.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure5.4:Comparingdisasterrecoverytechniques. Backup1.0isontheleft,whereyourespendingatonoftimemanuallyrecoveringsoftware andlettingSQLServerdealwithitsbackupfiles.Backup2.0isontheright,whereyoure simplypushingalltheserversdiskblocksbacktotheserversdiskrecoveringtheOS, SQLServer,datafiles,andeverythingallatonce,andtoaspecificpointintime. Now,IdorealizethatmanythirdpartybackupsolutionsoftheBackup1.0varietydomake backupsoftheentireserver,andthatmanyofthemofferbootableCDsorDVDsthatcan kickstartawholeserverrecovery.Thatsgreatexceptthatitstillleavesyourecovered toanoldsnapshot.Makingabackupofanentireserverisevenmoretimeconsumingthan backingupasinglelargedatabase;yourelesslikelytohaveanuptotheminutebackup, meaningmoredataisatriskandmoretimewillbespentduringarestore.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

AnotheradvantageoftheBackup2.0techniqueasIvepointedoutinpreviouschapters isthatdiskblocksreallydontcarewheretheylive.Diskblockscouldberestoredtoa differentserver,iftheoriginaloneshardwarewasirrecoverable.Diskblockscouldbe writtentoavirtualserver,givingyouafantasticoptionforoffsiterecoveryintheeventof adatacenterdisaster,likeafloodorlossofutilitypower.

Management,forme,iswhereBackup2.0reallyhasachancetoshine.Havingmanagedthe 600ishfilesinvolvedinapreviouscompanysSQLServerbackupplan,Ilovethewaythat Backup2.0doesntfocusonspecificpointintimesnapshots.Thatmeansnomanaging backupfiles.Instead,youmanageasinglebackuprepository,whereallthebackedupdisk blockslive.Ratherthanjugglingfilesandtapes,youuseacentralizedmanagement consoleliketheoneshowninFigure5.5,forexampletomanagetheentirerepository, whichmightwellhandlebackupsformany,manyservers.Youselecttheserveryouneed torestore,selectthediskvolumethatcontainsthefilesyouwanttorestore,andindicate thepointintimeyouwanttorestoreto.Therepositoryfiguresoutwhichdiskblocksare involvedinthatrecoveryoperation,andstreamsthemtotheserveryoudesignate. Anythingfromasinglefiletoanentireservercanberecoveredinthesamefashion.

Figure5.5:ExaminingtheBackup2.0repository. Easiermanagementlettingthesoftwarejugglethebackupdataisoneofthereal advantagesthatcanberealizedwhenwestartrethinkingwhatbackupsareallabout.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

SohowwillBackup2.0helpaddresssomeoftheconcernsthatareuniquetoSQLServer? Obviously,itdependsontheexactBackup2.0stylesolutionyouretalkingabout,butthere arecertainlywaysinwhichsolutionvendorscouldhandleSQLServerissues.

SprawlisntaproblemwithExchangeServerorSharePoint;thoseapplicationsliveinthe datacenter.SQLServer,however,spreadsthroughouttheorganizationindesktoplevel installationswhereusersmightnotevenrealizethattheirdataiscontainedinSQLServer. Evenwithclientlevelbackupagents,thisSQLServerdataoftengoesunprotected;client levelagentsareusuallydesignedforsimplefileandfolderbackup,anddonttypically includeaSQLServerspecificagent.ThehiddenSQLServerinstancesruncontinuously, justlikeanyinstallationofSQLServer,thwartingsimplefileandfolderbackupschemesat theclientlevel. Backup2.0canhelp.BecausethewholeideaofBackup2.0isbasedoncapturingdisk blocks,itcanwedgeitselfintothefilesystemataverylowlevel,usingbuiltinWindows hooksdesignedforexactlythissortofactivity.Figure5.6illustrateswhereaBackup2.0 agentcanworkitswayintothesystemwhileonlyadding1to2%ofoverheadtotheclient system.Thislowlevelofoverheadmakesthistypeofagentperfectlysuitablefor workstationsrunningExpressordesktopinstancesofSQLServer.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

HereshowIenvisionitworking:ABackup2.0agent,writtenasafilesystemshim, registersitselfwiththeOS.WhenSQLServersavesdatatodiskwhethertoadatabasefile ortoatransactionlogtheshimisnotifiedbythefilesystem.Asthefilesystemwritesthe datatophysicalstorage,theshimcanreadthenewlywrittenblocks,compressthem,and sendthemacrossthenetworktoacentralrepository. Itsfarmoreefficient,especiallyforclientcomputers,thansnapshotbackups.Workstations runninganExpresseditionofSQLServertypicallyhavefairlylowSQLServerworkloads, sinceSQLServerisreallyservingonlyasingleapplicationinusebyoneorafewusers. Ratherthanlaboriouslybackinguptheentiresystemoreverydatabasefileeverysooften, Backup2.0juststreamsthefewdiskblocksthathavechanged.Inasprawlenvironment, itstheperfectwaytocreateconsolidatedSQLServerbackupsforallthatimportantdata thatslivinginallyourstealthSQLServerinstallations.

IfBackup2.0isjustcapturingdiskblocks,whendoestheSQLServertransactionlogget truncated?Well,insomeinstancesyoumightthinkyoucouldjuststopusingthe transactionlog.AsFigure5.7shows,aSQLServerdatabasecanbeconfiguredtousea Simplerecoverymodel.UnliketheFullmodel,whichoperatesasIdescribedearlierin thischapter,theSimplemodelbasicallytruncatesthelogassoonasatransactions changeshavebeenwrittentodisk.Inotherwords,thetransactionlogstillexists,butits notarecoveryoptionbecauseitwontevercontainverymanytransactionsitllonly containthosetransactionswhosedatapagesarestillinmemory.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Atfirstglance,itmightseemlikethiswouldbeperfectinaBackup2.0world.Afterall,you stillgettransactionlogrecoveryforanunexpectedserverpoweroutage,butthe transactionlogisselfmaintaininganddoesntneedtobetruncated.YourBackup2.0 solutionisgrabbingdiskblocksalmostinrealtime,andshippingthemofftoabackup repositorysowhatgoodisthetransactionlog? Insomescenarios,IdsaygowithSimplerecovery!Butinothers,Istillliketohavethe pieceofmindthatthetransactionlogoffersandsoIdlookforaBackup2.0solutionthat hadtheabilitytotruncatethelogjustasSQLServerdoeswhenitmakesasuccessful backup.Inotherwords,ifthebackupsolutionisntusingnativeSQLServerAPIswhichdo truncatethelogafterasuccessfulbackupthenthebackupsolutionshouldfullyreplace thoseAPIs,includinglogtruncationcapability.

Singleobjectrecovery,corruption,andofflocationrestoresmightseemlikethreepretty randomtopicstothrowtogether,buttheyreallpotentialissuesthataresolvedbythe samething.AsIvedescribedearlierinthischapter,singleobjectrecoveryinSQLServer prettymuchalwaysinvolvesrestoringthedatabasetoadifferentlocation,thencopying objectsfromtherestoreddatabasetotheproductiondatabase.Thatsjustinherentinthe waySQLServerworks.Theproblemisthatrestoringabackup,aswevediscussed,cantake alotoftime.Spendinghoursrestoringfilesjusttograbasingleaccidentallydeletedstored procedureorviewispainfulandunrewardingintheextreme. Therearemanyotherreasonstorestoreadatabasetoadifferentlocation,whichisalso calledanofflocationrestoreoralternatelocationrestore.Onereasonistocomparea backedupdatabasetothecurrent,livedatabase,usingsomekindofcomparisontool. Anotherreasonmightbetoaccessdatathatwasdeliberatelypurgedfromthelive database.Typically,thedatabaseisrestored,frombackup,toadifferentserver,ortothe sameserverunderadifferentdatabasenamebothofwhichrequirescratchspace,or temporaryspacetoholdtheentirerestoreddatabaseforhoweverlongitisneeded.Then, ofcourse,theresalsothetimetorestoreallthedatabasefilesandletSQLServerprocess them. Mythirdissueisoneofbackupdatacorruption,whichisaninsidiousthingweveallrun into:Thebackuptapeiscorrupted!AlthoughBackup2.0reliesless(ornotatall)on tapes,datacorruptionisstillarealconcern,andanydecentbackupsolutionwillofferways todetectcorruption. Allthreeoftheseissuesofflocationrestores,singleobjectrecovery,anddata corruptioncanbehandledbyasinglefeaturewecanaddtoourBackup2.0spec:I proposecallingitbackupmounting.Thinkofitlikethis:Ourbackuprepositorycontainsa bunchofdiskblocks,eachonetimestampedtoletusknowwhenitwascaptured.Theres reallynoreasonwecouldntselectabunchofdiskblocksfromagivenpointintime,feed themtoaspecializedfilesystemdriver,andmountthemlikeanormaldiskvolume. Figure5.8showswhatImean.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure5.8:Mountingbackedupdiskblocksasadiskvolume. Afilesystemdrivesjobistotakesomeformofstorageandmakeitlooklikeadiskvolume, files,andfolders.MicrosoftbasicallydoesthissamethinginWindows7,wheretheOS allowsyoutomountavirtualmachineimageasadiskvolume.Imsimplyproposingthat Backup2.0includeaspecialfilesystemdriverthatletsWindowsseeselectedportionsof thebackuprepositoryasiftheywereareal,live,readonlydiskdrive. Oncethatsaccomplished,thebackupsolutioncanmakeSQLServerdatabaseandlogfiles availablewithoutperformingarestore.Soinzerotime,yourdatabasefilescouldappear inreadonlyform,ofcourseandbeattachedtoaliveinstanceofSQLServer.Thiswould enablethebackupsolutiontoconductattachabilitytests,todeterminewhetherthe backedupimagecouldbeoperatedasafulldatabase.Ifitcouldnt,thencorruptionwould besuspect.Youcouldalsoattachbackedupdatabasesondemandforcomparison purposesorforsingleobjectrecoverywithouteverhavingtorestoreanything.Youstay moreproductive,youdontneedscratchspace,andyoucanattachaversionofthe databasefromanypointintime.Trulyaremarkablesetofcapabilitiesfromafairly simplisticnotionwhichisreallywhatBackup2.0isallabout:Simple,newnotionsthat radicallychangethewaywework,forthebetter.

ThelastmajorserverproductIhavetocoverisSharePoint,whichoffersitsownunique challenges.Infact,SharePointwhichhasrapidlygrowninpopularityinthepastfew yearsmaybethebiggestchallengethatBackup2.0hastoface.AsIhaveinthisandthe previouschapters,Illlookatnativesolutions,coverproblemsandchallenges,andcompare the1.0wayofdoingthingswithamoreenlightened2.0approach.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

MicrosoftsSharePointServerhasprobablyhadthemostvarietyinitsbackupandrestore solutions.ThefirstversionoftheproductwasessentiallyamodifiedversionofExchange Server,andusedthesamedatabaseenginethatExchangedidatthetime.Today, SharePointServerusesmultipledatabasestostoreitscontent,configuration,search catalogs,andmoreandevenstoressomecriticalfilesassimplediskfiles.Allthatdata storedindifferentplaceshelpsmakeSharePointServeroneofthemostdifficultMicrosoft serverproductstoworkwithintermsofbusinesscontinuityanddisasterrecovery.It becomesevenmorecomplexwhenyoustartdealingwithSharePointServerfarms collectionsofserversdesignedtoserveupthesamecontentforloadbalancingpurposes.Is itevenpossibletomovebeyondtheBackup1.0mindsetandstartusingBackup2.0whenit comestoSharePoint?

MicrosoftdefinesthreelevelsofdatarecoveryforSharePointServer: ContentrecoveryiswhenyourecoveroneormoreitemsusingaRecycleBinor retrieveapreviousversionoftheitemsfromthecontentdatabase.Thisrelieson functionalitywithinSharePointitselfandisaccessibletoendusers. SiterecoveryiswhenyourecoveranentireSharePointServersite,orWebsite. Thisisthetypeofrecoverymostadministratorsareconcernedwith. Disasterrecoverytypicallyinvolvessiterecoverytonewhardware.

ContentrecoverydoesntaffectanythingbuttheSharePointcontentstore;usersutilizethe SharePointuserinterface(UI)toaccesspriorversionsofafileortorecoverdeletedfiles fromtheinproductRecycleBin.Otherformsofrecovery,however,dealwiththesearch catalogs,siteconfiguration,andotherdatastores.Natively,SharePointServersupportsa dizzyingarrayofbackupandrecoveryoptions,allofwhichessentiallyoverlaptoprovide fullcoverageoftheproductsdata.Illcoversomeofthemajornativeoptionsinthenext fewsections.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Versioningisdesignedtoprovidesingleitemrecoveryforpastversionsofanitem.Whena useroverwritesanexistingdocument,SharePointretainstheoldversion.Userscanalways retrievethoseoldversions,goingasfarbackasSharePointhasretained.Versioningmust beenabledbyanadministrator,andtheadministratorcanselecttwooptions: Majorversions.Eachnewversionofthedocumentisgivenasequentialnumber, suchas1,2,and3.Allusershaveaccesstoallversions,andyoucanspecifyhow manypreviousversionsareretained. Majorandminorversions.Thisallowsforminorversions(1.1,1.2,andsoon)of documents,althoughonlymajorversions(thoseendingin0)canactuallybe published;everythingelseisconsideredadraftrevision.Youcanchoosehowmany majorandminorversionsyouwillkeep.

Versioningisaneffectiverecoverytoolforenduserstoapoint.Itsnotpracticaltostore aninfinitenumberofversions,soatsomepoint,youmaystillhavetogotoatapebased backupinordertoretrieveapastversionthatisolderthanwhatsretainedinthe SharePointdatabase.VersioningalsoassumesthatSharePointisupandrunning,meaning itisnteffectivefordisasterrecoveryorotherscenarioswheretheentireserverislost.

SharePointincludesatwostageRecycleBin.Thefirststageexistsattheenduserlevel, providingasimpleundeletefeaturethatletsusersrecoveraccidentallydeletedfilesand otheritemsfromwithinthesite.Thesecondstageisaccessibletoadministrators,who alsohaveaccesstoallthesitesfirststageRecycleBinitems.Whenauseremptiestheir firststageRecycleBin,thedataisretainedinthesecondstageRecycleBinforrecoveryby anadministrator. Itemsarealsoremovedcompletelyafter30days(bydefault)intheRecycleBinsystem. Afterthattimeperiodelapses,itsbacktobackuptapestorecoverolderitems.Itemsare alsoremovedfromthesecondstageRecycleBinwhenitreachesitsstoragequota;the oldestitemsarepermanentlydeletedtomakeroomfornewitems.Aswithversioning,the RecycleBindependsonSharePointbeingupandrunning,soitisntintendedasadisaster recoveryorwholeserverrecoverytool.

OfficeSharePointDesignerhastheabilitytobackupandrestoreindividualSharePoint sitesandsitecollections,downtotheindividualfilelevel.ThetoolutilizestheSTSADMtool toexportorimportthesite;priortoSharePointServer2007ServicePack2(SP2),backups werelimitedto25MBwhichisntmuch.AfterSP2,backupsarelimitedto2GB,whichisa lotofspacebutstillmightnotbeenoughtocompletelybackupaverylarge,busy SharePointsite.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Thebackupscreatedinthisfashionareactuallycontentmigrationpackages;theonlyway toutilizethesebackupsistorestoretheentiresiteoftentoanofflineserverthatisused specificallyforthatpurpose.BackupsdonotincludeRecycleBinfiles,soanythingthatwas deletedwhenthebackupwasmadewillnotbeincludedinthebackup.Thebackupsalsodo notincludeworkflowdefinitions,alerts,orsitecollectionpropertiesmeaningthese backupsdonotcontaineverythingthatdefinesyourSharePointsite. YoucanalsousetheSTSADMtoolbyitselftoexportasite(createabackup)orimporta site(restorefrombackup).Thetoolhasthesamelimitationswhenusedbyitselforfrom theSharePointDesigner. TherearesomeotherweaknessesofSTSADM,includingthefactthat,althoughitcanback uptheSharePointconfigurationdatabase,itcanonlyrestoretheconfigurationtoaserver ofthesamenamemakingituselessfordisasterrecovery.Microsoftsguidancedocument forSharePointbackupandrecovery( us/library/cc262129.aspx)notessomeotherdisadvantages: CannotbackupdirectlytotapebackuplocationmustbeaUNCpath Doesnotprovideautomaticdeletionofoldbackupfiles Aspartofafarmbackup,canbackuptheconfigurationdatabaseandtheCentral Administrationcontentdatabasebutwillnotrestorethem DoesnotbackupanycustomsolutionfilesintheInetpuborOffice12hive(Program Files\CommonFiles\MicrosoftShared\Webserverextensions\12) Doesnotbackupalternateaccessmappings(AAM) DoesnotbackupInternetInformationServices(IIS)settingsincludinghostheaders, dedicatedIPaddresses,andSecureSocketsLayer(SSL)certificates Sitecollectionbackupsaffectperformanceandcancauseaccesserrorsandshould onlybeusedwhenthesitecollectionislocked;sitecollectionbackupscanbeslow whenworkingwithcollectionslargerthan12to15GB,soMicrosoftrecommends thatyouusefarmbackupsifyouareworkingwithcollectionslargerthan15GB

Contentdatabaseslargerthan100GBwhichisntreallythatmuchintodaysworld arentsuitableforSTSADM,andMicrosoftactuallyrecommendsyougobuysomething fromsomeoneelsetohandleyourbackups.

BecauseSharePointServerusesSQLServerasitsmaindatastore,SQLServersownbackup toolscanbeusedtocreatepartialbackupsofaSharePointsite.Isaypartialbecausenotall oftheSharePointsitedataisinsideSQLServer.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

YoucanalsocreateaSQLServerdatabasesnapshotoftheSharePointsite.Thisisaread onlyversionofthedatabaseasitexistsatthetimeofthesnapshot.Thesesnapshots shouldnt,however,beconsideredrealbackups,althoughtheydoprovideameansto retrievedatafromthedatabaseasitexistsatthetimeofthesnapshotsuchasrecovering individualitems.DoingsorequiresaSharePointsitetobecreatedthatusesthedatabase snapshot,andthatsitewillbereadonly;obviously,SharePointServerneedstobe functionalinordertodothat.Thereareotherdisadvantagesagain,fromMicrosofts guidancedocument: DoesnotincludefrontendWebservercustomsolutions CanbackuptheconfigurationdatabaseandCentralAdministrationcontent databasebutrestoringisnotsupported DoesnotbackupIISsettingssetoutsideofOfficeSharePointServer,includinghost headers,dedicatedIPaddressesandSSLcertificates IfusingSearch,youmustrecrawlafterrestoringcontentbecauseindexesarenot backedupinSQLServer ShouldnotbeusedtobackuptheSearchdatabasebecauseitcannotbe synchronizedwiththeSearchindex YoumustmanuallyreattachyourdatabasestotheWebapplicationsafterarecovery

Whydothesenativetoolssupportbackinguptheconfigurationdatabasebutnotrestoring it?Whatwouldbethepoint,exactly?

ThecentralSharePointadministrativeinterfaceprovidesbasicbackupandrecovery capabilities.Itseasytouse,andbraceyourselfcanautomaticallyhandlebackupsthat runmorethan17hours.Iknow,theverythoughtofa17hourbackup,letalonesomething thatrunslonger,issomiredintheBackup1.0mindsetthatIdontevenwanttothink aboutit. CentralAdministrationdoes,however,havealengthylistofdisadvantages(from Microsoftsguidancedocument): Doesnotprovideschedulingfunctionality Doesnotprovideautomaticdeletionofoldbackupfiles Cannotbackupdirectlytotape;backuplocationmustbeaUNCpath Aspartofafarmbackup,canbackuptheconfigurationdatabaseandtheCentral Administrationcontentdatabasebutwillnotrestorethem DoesnotbackupanyconfigurationchangesorcustomsolutionfilesintheInetpub orOffice12hive(ProgramFiles\CommonFiles\MicrosoftShared\Webserver extensions\12) DoesnotbackupanycustomizationsmadetotheWeb.configfile


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

DoesnotbackupAAM DoesnotbackupIISsettings,includinghostheaders,dedicatedIPaddresses,and SSLcertificates Ifabackuporrecoveryjobisnotsuccessful,theunsuccessfuljobmustbemanually deletedfromtheTimerjoblistontheBackupandRestoreStatuspage;inCentral Administration,clickOperations,thenclickBackupandRestoreJobStatusif thefailedjobisnotdeletedmanually,subsequentbackuporrecoveryjobsfail

So,ithastobeusedmanually,doesntbackupeverything,cantbackuptotape,andhasto bemanuallymonitoredandmaintained.Wonderful.ThatsnotevenBackup1.0;itsmore likeBackup0.5!

Thebiggestproblemwiththenativesolutionsisthatwell,frankly,theyrealloverthe place.Noneofthemarereal,triedandtruebackupsolutionsinthetraditionalsenseofthe word.NoneofthenativesolutionsIvediscussedprovidefordisasterrecovery,for example,whichisimportantevenintheBackup1.0mindset. Disasterrecovery,infact,canbeincrediblycomplicatedwithSharePoint.Youhavethe contentdatabase,customizations,SharePointlevelconfigurationsettings,binaryfiles (SharePointServersownfiles),IISlevelconfigurationsettings,andfinallythebinaryfiles oftheWindowsoperatingsystem(OS)itself.Nothinginthenativetoolsetcanbackupall thatinformation. Microsoftsrecommendationfordisasterrecoveryisto: UseWindowsServerBackuptobackupthebinaryfilesalthoughinafulldisaster recoveryscenario,MicrosoftrecommendsreinstallingtheOS,SharePoint,andSQL Server,whichwilltakeseveralhourstocomplete. Documentwritedown,thatis,notactuallybackuptheIISconfigurationsettings. Youresupposedtomanuallyrecreatethecorrectconfigurationinadisaster recoveryscenario. Documentagain,writedown,notactuallybackuptheSharePointconfiguration settings.Althoughitspossibletobackuptheseandrestorethem,doingsois dangerousbecausetheyneedtobeperfectlysynchronizedwiththeotherdata. Failuretomaintainthatsynchronization,whichisdifficulttodomanually,will resultinrandomsiteerrorsandforceyoutorecreatetheSharePointsitefrom scratch. Packageanycustomizationsassolutionssothattheydonthavetobebackedupbut caninsteadbereinstalledifyouneedtorebuildthesite. BackuptheSQLServerdatabasestoprotectthesitecontent.YoucanuseSQL Servertoolsforthis,exceptinthecaseoftheSearchdatabase,whichmaynotbe backedupusingSQLServertools.YouhavetouseSharePointtoolstobackupthat. 99

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Honestly,youvegottobekidding.SharePointappearstobeaproductthatsimplydoesnot liketobebackedup.Sure,itsnicetohavegreatfunctionalitysuchasversioninganda RecycleBinforsingleitemrecoverybyendusers,butwhataboutacompletedisaster? How,exactly,areyousupposedtoprepareforawholeserverfailure?Andforthatmatter, howareyousupposedtogoaboutrecoveringdatathatstoooldtobeinaRecycleBinorin theversioningsystem?Whatifyouneverturnedonversioningandneedtorecoveranold file? Partofthechallenge,ofcourse,isthatSharePointisahugeandcomplexproduct(Figure 6.1illustratesthevariousindependentcomponents)thatreliesonnumeroustechnologies outsidethecontroloftheSharePointdevelopmentteamatMicrosoft.ItreliesonspecificIIS configurationsettings,andIIShasnevermadeitespeciallyeasytobackupthose configurations(although,asofIIS7,itsgotteneasierWebsitesettingsareinasimple web.configfilethatcanbebackeduplikeanyotherfile).SharePointsitesoftenhave customizedfiles,whichresideontheserversfilesystem.SharePointdatalivesinSQL Server,whichhasitsownbackupandrecoverymodel.Worse,muchofSharePoints configurationdataasIvedescribedreliesonbeinginexactsyncwiththedatastores,so youprettymuchhavetobackupeverythingatonce.Fromabackupandrecovery standpoint,SharePointjustisntwellthoughtout,unfortunately.

Figure6.1:ThemanycomponentsofSharePointServer. SohowdoesBackup1.0workinaSharePointenvironment?


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

TheweaknessesofBackup1.0arereallybroughtintosharpreliefbyacomplexproduct likeSharePointServer.Microsoftsrecommendation?Buyabackupsolution,suchasthe oneMicrosoftwillbehappytosellyou.ManybackupsolutionssupportSharePointServer, butalldosofromaveryBackup1.0perspective:pointintimesnapshots,lengthybackup windows,andevenlongerrecoverytimes.

Forstandardbackups,youhavetwochoices:Usethemishmashoftoolsthatarenativeto SharePointoravailableforfree,orbuysomethingthatcanbackuptheentireSharePoint infrastructureinonego.Eitherway,largeSharePointinstallationscanhaveincrediblylong backuptimesthefactthatthenativetoolshavespecificfeaturestoaccommodate backupslongerthan17hoursshouldtellyousomething. IknowalotofSharePointadministratorswhoruntheirSharePointServerinstallations SQLServerandallinavirtualmachinesimplybecausethatallowsthemtograbcopiesof thevirtualmachinesvirtualdiskfile,thusbackinguptheOSandalltheSharePointbitsin onepiece.Figure6.2illustratesthebasicidea.

Figure6.2:EasierbackupswithvirtualizedSharePoint. Theproblemwiththisapproachisthatitstoughtoactuallyusethosebackupsforanything exceptdisasterrecovery.Yourestuckrestoringtheentireserver,andifyouonlyneededto recoveronefilewell,thatsdefinitelyabitofoverkill.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

OtherBackup1.0stylesolutionstrytoduplicatetheapproachofthenativetoolsbut consolidateeverythinginonetoolforyou.Inotherwords,thesesolutionsdiginto SharePointandgrabtheIISconfiguration,thecontent,theSharePointconfiguration,andso onbutratherthangivingyoueighttoolstodoit,theydoitallatonce.Thatcanbe beneficial,butitsstillapointintimesnapshot,andyouvealwaysgotdataatrisk. Performingrecoveryfromthatkindofbackupcansometimesbetricky,too,dependingon howthebackupsolutionisbuilt. Bytheway,IdontwanttoimplythatMicrosofthasntthoughtaboutallthesecomplexities. Theyhave;oneofthecompletebackupandrecoverysolutionsthatyoucanbuyismade byMicrosoft.

Recoveryscenariosusingthenativetoolsetarejustascomplicatedasperformingthe actualbackupusingthenativetoolset.Infact,asIwasresearchingthischapter,I commentedonFacebookthatIcouldntbelievehowcomplexthenativetoolsetwas;oneof myfriendsresponded: Itsmoreliketheyneverexpectthesystemstoeverfail&thusneedarestore!HA!I amsohappytobeoffoftheSharePointteam! Ouch.ButIcouldntagreemore:Natively,SharePointdoesassumethatthesystemwill neverfail,andthatRecycleBinsandversioningwillprovidealltherecoverycapability youlleverneed.Ifyoudoexperienceacompletesystemfailure,theofficial recommendationistoessentiallystartfromscratchandreinstalleverything,thenrestore yourcontentdatabasefromastandardSQLServerbackup. Ofcourse,Microsoftisntthatnavethecompanyabsolutelyrecognizestheneedforfull systemrecovery,andthatswhytheymakeanaddonproductthatwilldoitforyou. However,onceyouvedecidedthatyouhavetospendmoneytoprotectSharePointand, frankly,youdoyoushouldstartlookingbeyondMicrosoftandcomparetheirofferingsto theothersolutionsoutthere. ThoseothersolutionsincludingtheoneMicrosoftwillsellyoucansometimesdoa betterjobathandlingthetworecoveryscenariosyoullruninto:singleitemrecoveryand disasterrecovery.Illgetintodisasterrecoverynext;fromasingleitemrecovery perspective,mostsolutionsworkbypullingthedataoutofSharePointandstoringthe backedupdatainawaythattheycanalsoaccess.Itsanapproachsimilartothewaysome solutionsbackupExchangeServer:Ratherthanattemptingtograbtheentiredatabasein onechunk,theygrabeachindividualcontentitem.Thatway,youdontneedacopyof SharePointtoaccessindividualitemsfromthebackupyoujustusethebackupsoftware itself.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

IndividualItemBackup:GreatforDeduplication Invariably,SharePointsiteswindupwithalotofduplicateddatacopiesof fileskeptinmultipleplaceswithinthesite,forexample.Asolutionthat accessesindividualitemsforbackuppurposescancomparethemwitheach otherandeliminateduplicatesfromthebackup,makingthebackupssmaller andsavingspace.SomuchspacecanbesavedinatypicalSharePoint installationthatdeduplicationhasbecomeamajorsellingpointfor SharePointbackupandrecoverysolutions. Othersolutionstakeaslightlydifferentapproachtohowtheymaketheirbackup,butthe practicalupshotisthis:Youwantasolutionthatwillallowyoutoaccessoneormore individualitemswithouthavingtorestoretheentiredatabasetoaliveSharePointServer. Thereisactuallyawholemarketoftoolsthatcanaddthiscapabilitytootherbackup solutions.Forexample,toolsexistthatcanopenandbrowsethebackupfilesmadeby Microsoftsownextracostbackupsolution,enablingyoutobrowsetheSharePoint repositorieswithoutactuallyperformingadatabaserestore.Figure6.3showsonesuch solution,whichisafreetoolavailableat backups,STSADMexports,andotherbackupsnapshots;letyoubrowsethedatabase;and retrieveindividualitemsfromit.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

AsIvealreadysaid,theofficialdisasterrecoverypolicyforSharePointistoreinstall, reconfigure,andthenrestoreyourcontentdatabaseaprocessthatwill,inmostcases, takeadayortwoatleast(includingtimetoapplypatchesandservicepackstotheOSand applicationsoftware)andthatsassumingyouvedoneeverythingbythebook,packaged anycustomizationsasdeployablesolutions,andsoon.Ifyouhaventdonethose thingswell,sorry.Youreinforalongrecoveryproject. Ivealsomentionedvirtualizationasawaytomakedisasterrecoveryeasier.Bybackingup avirtualdiskfile,youcanrestorethatfileinasingleoperationthusrestoringyourOS, SharePointbinaryfiles,databases,configurations,andeverythingallinasingleoperation. Ofcourse,youmaybelimitedinhowoftenyoucaneffectivelygrababackupofavirtual diskfile:Togetaconsistent,reliablecopyofthefile,youregoingtoneedtoshutdownthe virtualmachine.AlargeSharePointinstallationmayusevirtualdiskfilesthataredozensof gigabytesinsize,whichmaytakesometimetocopyalthoughyoucanmakeadisktodisk copy,thenbackupthecopytodiskwhileyourestartthevirtualmachine. ForExample IhaveonecustomerwhoseSharePointsiteincludesabout110GBoffilesand data;theirvirtualmachinesvirtualdiskfilestotalabout146GB.Evenona faststorageareanetwork(SAN),ittakesafewhourstomakeadisktodisk copyofallthevirtualdiskfiles,andittakesseveralhourstobackthecopyup totapeforoffsitestorage. Ifyoureusinganaddonbackupsolution,oddsarethatitprovidesadisasterrecovery path.Somerequirethat,ataminimum,youreinstallWindows,andmayrequirethatyou reinstallSQLServerandSharePointalso;othersbackuptheentireserverandcanrestore theentireserver.Fromadisasterrecoveryperspective,Iprefersolutionsthatcanrestore thecompleteservertobaremetalbecausethatstheeasiest,mostfoolproofwaytogetthe serverupandrunningagainasquicklyaspossible.

ManagingbackupsinaSharePointServerworldcanbecomplicatedabitmoresothan theusualbackuptapeshufflethatwereallfamiliarwith.Becausethevariousbitsof SharePointconfigurations,content,databases,files,andsoforthareallsotightly interconnected,youhavetomakesurethatallthevariousbackupsmatchup.Inother words,youneedtofiteverythingfromasinglebackupontoasinglesetofbackuptapes. BecauseSharePointbackupscanbesotimeconsuming,administratorstendtorelyon techniquessuchasdifferentialandincrementalbackups,whichallowyoutomakemore frequentbackupswithoutsuchlengthybackupwindows.However,allthoseincrementals anddifferentialsalsocomplicatebackupmanagementandmakerecoveryprocesseslonger andmorecomplex.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

IrememberoneparticularlyunrewardingexperiencewithSharePoint,wherewehada completebackupfromaboutamonthbackandincrementalbackupssincethen.Wewere usingathirdpartybackupsolution,andwemadeanincrementalbackupeverynight.One day,theserverdiedandcorruptedalotofdiskfiles,soweneededtorestoreeverything. ThatswhenwefoundoutthattheincrementalbackupoftheSharePointconfiguration databaseatiny,tinylittlefilefromaboutaweekbackwascorrupted.Thatmeantallthe backupsofthatsamedatabasesincethenwereuselessbecausetheyallreliedonhavinga continuoussequenceofincrementalbackups.Becausetheconfigurationissocloselytiedto thecontentandeverythingelse,webasicallyhadtostoprestoringdataatthatpoint meaningwelostoveraweekofdata,eventhoughwehadmorerecentbackupsforthe actualcontent.Wetriedseveraltimestoextractthedatainvariousways;ultimately,we woundupusingathirdpartysolutiontoconnecttothecontentdatabasebackup,and manuallyextractedtheindividualitemsthathadchanged.Notfun,andittookalmost2 weekstogeteverythingalmostbacktonormal.ThatsBackup1.0foryou.

CanBackup2.0makeSharePointbackupsanylesscomplicated?ItseemslikeBackup2.0 mayhavemetitsmatch:ThisisthefirsttimeIvelookedataserverproductthathasits ownbinaries,reliesonIIS,reliesonSQLServer,andstoresfilesanddatainahalfdozen differentplaces.TheBackup2.0concepthasitsworkcutoutforit.

IvementionedthatsomeadministratorsvirtualizetheirSharePointinstallationssimplyto makebackupslesscomplicatedanditturnsoutthatthoseadministratorsareontheright path.Notwithvirtualizationperse,butratherwiththeideathatbackinguptheindividual componentsofSharePointisoverlycomplex;therightideaistobackuptheentireserver, grabbingSharePointsdataalongwitheverythingelse. TakealookatFigure6.4.IveredrawnFigure6.1tosimplifyitabitandtoillustratethat althoughSharePointhasmanycomponents,allofthemstoretheirdataontheserversfile system.Disksare,afterall,theonlypersistentformofstorageinatypicalserver.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure6.4:EverythinginSharePointendsupondiskeventually. ThetricktomakingSharePointbackupseasieristoforgetaboutSharePoint.Ignorethe databases,ignorethefiles,ignoretheconfigurations,ignoreitall.Instead,simplybackup everyblockofdiskspace.Asdataischanged,thatdataiswrittentodiskintheformof changeddiskblockshaveanagentontheservergrabthosechangesandsendthemoffto abackuprepository. Thosebackedupdiskblockscanalsobetimestamped,meaningtheBackup2.0solution cankeeptrackofwhichchangescamefromwhatpointintime.Thatimmediatelysolves theproblemwithkeepingtheconfigurationssynchronizedwiththecontent;solongas youregrabbingallthediskblocksuptoaspecificpointintime,youllhaveaconsistent SharePointrestore.Thatalsomeansyoucanchoosetorestoreuptoanypointintime, effectivelyrollingbackSharePointtosomeearlierpointintime,ifneeded.Figure6.5 showshowanagentmightcapturethechangeddiskblocksandsendthemtoatime stampedrepository. ThebeautyoftheBackup2.0approachisthatthebackupsolutiondoesntreallyneedto knoworcarewhatsrunningontheserver,orhowcomplicateditis.Everythingthat matterstousashumanbeingswillendupondisk;solongaswecaptureeverysingle changeddiskblock,wevegotacompletebackup.Becauseadiskblockistinynomore than64kilobytes,andassmallas4kilobytesbackingupasinglediskblockisntvery timeconsumingorintensive.Streamingthosechangesoverthenetworkusing compression,ofcourseisentirelypossible,andgetsallthebackedupdatatoasafeplace almostinrealtime.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure6.5:Streamingdiskblockstothebackupserver. Deduplicationofdataisalsopossible,meaningbackupscanbesmaller,takeuplessspace, andevenrequireabitlesstimetorestore.

AsIsaidbefore,youreallygetintotworecoveryscenarioswithSharePoint:needingto recoverasingleitemandneedingtorecoveranentireserver.ThelatteriswhatIcall disasterrecovery,andIllgettoitnext.Fornow,doesBackup2.0improvesingleitem recovery?


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Absolutely.Remember,becausethosebackedupdiskblocksaretimestamped,youcan recovertheentireservertoaspecificpointintimeoryoucanexposethedatastoresas theyexistedatacertainpointintime.ThisisaconceptIvementionedbefore,butits particularlyapplicabletoSharePoint,soletmerunthroughanexample. LetssayyourgoalistoretrieveasingledocumentfromSharePoint,asthatdocument existedatnoononthepreviousMonday.Thedocumentlivesinthecontentdatabase, whichisaSQLServerdatabase.SQLServerdatabasesarefilesthatsitonthefilesystem; typically,acertainamountofdiskspaceisallocatedtothedatabase,whetherthedatabase actuallycontainsthatmuchdataornot.Astheallocatedspaceisfilled,thedatabasefileis expandedtomakeroomformoredata.Soletssaythatthisparticulardatabaseoccupies diskblocks10,000through790,000(forthisexample,weliveinaperfectworldwhere diskfragmentationdoesntexist,sothedatabaseoccupiesacontiguoussequenceofdisk blocks).Figure6.6showsaportionofthisdiskspaceblocks11,100through11,123.

Figure6.6:Diskblocksonthefilesystem. WhenwestartourBackup2.0stylebackup,wetakeasnapshotofeverydiskblockonthe serverasourbase,orstartingpoint.Then,wesimplycapturediskblocksastheychange. Figure6.7showsapartialexample:thebasesnapshotforourrangeofdiskblocksaswell aschangeddiskblockscapturedfromthreetimeperiods.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure6.7:Backingupdiskblocksfromthefilesystem. Whenthetimecomestoperformourrestore,weneedtoreconstructthefilesystemasit wasat,say,12:02.Sothebackupsolutiongoesandstartswiththebasesnapshot,then substitutesanydiskblocksthathavechangedbetweenthetimethatsnapshotwastaken andtherecoverytimewespecified.Intheeventthatadiskblockhaschangedmultiple times11,102isagoodexampleweuseonlythelatestversion,uptotherecoverytime specified.Letssaythatwereonlyconcernedwithdiskblocks11,100through11,107 becausethoseholdthedataforthefilewewanttorecover.Figure6.8showshowthe backupsolutionwouldapplyblockstorecreatetheserversfilesystemasof12:02.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure6.8:Recoveringtoaspecificpointintime. Oncethebackupsolutionhasreconstructedthispointintimefilesystem,wehavetwo choices.Wecouldsimplyrestoretheentireservertothatpointintimeperhaps recoveringtoavirtualmachinesothatwecoulduseSharePointitselftoactuallyretrieve thefile.Or,thebackupsolutionmightbeabletoexposethispointintimeviewofthefile systemasamountableimage,meaningwecouldbrowseitsfilesystem,attachthedatabase toaSQLServerinstance,orevenusearecoverytool(likethefreeoneImentionedearlier) thatcanattachtotheSQLServerdatabasewithoutneedinganactualrunninginstanceof theSQLServersoftware. Thisisamuchbetterrecoveryscenario:Itseasy,prettyintuitive,anddoesntrequirealot ofwork.Abackupsolutionmightbeabletoconstructthispointintimesnapshotalmoston thefly,meaningwecouldgetinandbrowsespecificpointsintimewheneverweneededto.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

DisasterrecoveryiseasierunderBackup2.0,aswell.Rememberourmissionstatementfor Backup2.0: Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible. Becausewerestreamingthosediskblocksinnearrealtime,wewontloseverymuchdata atallafewsecondsworth,perhaps.Wecanaccessourbackedupdataalmostinstantly, asIvedescribed,andwecanrestoreanentirepointintimeimageanytimeweneedto performdisasterrecovery. SharePointisprettypickyaboutitsconfiguration.IfyousetupaSharePointServernamed SPOINT1,thenneedtorestorethatserver,therestoredserverhadbetterbenamed SPOINT1orSharePointmightnotworkproperly.WithaBackup2.0solution,were restoringtheentireOSduringdisasterrecoverysothingsliketheservernamewill remainintact.However,becauseweresimplywritingdiskblocksbacktoadisk,werenot limitedinwritingthembacktotheoriginalphysicalserverwhichmayhavefailed.We canwritediskblockstoavirtualmachine,allowingustobringSharePointbackonlineeven inanoffsiterecoveryscenario.

Managingbackuptapesismucheasierbecauseinsomeinstancesyoumightnotevenhave backuptapes.Personally,IlovetheadditionalfeelingofsecurityIgetfromhavingcopiesof mybackupsoffsite,andtapesareagreatmediumforit.Thus,yourBackup2.0solution shoulddefinitelybeabletomovecopiesofitsdiskblockrepositorytotape.Butshuffling tapesisalotlesscriticalbecausefromatapeperspective,youreonlybackinguponething: thebackuprepository.Abackupofthebackup,ifyouwill;thus,thetapesareliterallyjust PlanBintheeventyourbackupserverdiesorbecomesinaccessibleduetoadatacenter problemorotherfacilitydisaster.

SharePoint,asIvepointedoutpreviously,isnotwithoutitslittlequirks,andanybackup solutionusedwithSharePointhastoembracethosequirksandcatertothem.Backup2.0is nodifferent,soletsexaminesomeofthemajorSharePointspecificconcernsandseehow Backup2.0mightdealwiththem.

AlthoughSharePointsversioningandRecycleBinfeaturescanprovideenduserswiththeir ownsingleitemrecovery,thosefeaturesonlygosofar.Youlldefinitelywanttheabilityto retrievesingleitemsfromyourbackups,andaBackup2.0solutionusingatimestamped diskblockrepository,asIvedescribedshouldbeabletoprovidethatcapability.By mountingaspecificpointintimeasareadablefilesystem,youcanattachallkindsoftools tobrowsetheSharePointrepositoryandretrieveindividualdocuments;inaworstcase scenario,youcouldrestoretheentireservertoaphysicalorvirtualmachineanduse SharePointitselftoaccessthefilesyouneed. 111

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

SomeBackup2.0stylesolutionsmayevencombineallthefunctionalityyoullneed: mountingthepointintimesnapshot,attachingtotheSharePointdatastores,and presentingtheSharePointdatainagraphicaluserinterface(GUI)whereyoucanbrowse therepositoryandselectthefilesyouwanttoretrieve.

SharePointsconfigurationanddataneedstostayproperlysynchronized;youcantrestore aconfigurationdatabasefrom2monthsagoandrestoreyesterdayscontentdatabaseand expecteverythingtowork.ThatswhyMicrosoftsofficialguidancerecommendsagainst actuallybackinguptheconfigurationandinsteadsuggeststhatyoudocumentthe configurationandrecreateitmanuallyintheeventofadisaster.Becausemanuallyis whywehavecomputersinthefirstplace,right? Backup2.0avoidsthatcomplexitybysimplytreatingtheentireserverasasingleunitof management,andbyallowingyoutorestoretheentireservertoaspecificpointintime. Thatmeansyoucanalwaysrestorethecontentdatabaseandtheconfigurationdatabaseas itexistedatthatexactsamepointintime.ItsjustinthenatureofhowBackup2.0works: Yougeteverything,allthetime.

Inthenextchapter,Illtackleasubjectthatsnearanddeartomyheart:virtualization backups.Virtualizationhaschangedthewaywethinkaboutourdatacenters,andhas enabledanumberofnew,flexiblecomputingscenariosthataresavingbusinessesmoney andhelpingthemtobemoreagile.Atthesametime,however,virtualizationhasupset manyofthetriedandtrueIToperationspracticesthathavebeendevelopedoverthe years.Inmanyways,virtualizationisComputing2.0,andBackup1.0justisntagoodfit. IllexplainhowpeoplehavebeentryingtomakeBackup1.0getalongwithvirtualized infrastructures,andsuggestsomewaysinwhichBackup2.0coulddoamuchbetterjob andhelpfullyrealizethepromiseofvirtualization.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Virtualizationisthehotnewcodewordfortodaysbusinesses,anditschangingeverything wethoughtweknewaboutbackupandrecovery.IactuallyconsiderthattobeaReally GoodThing,becauseitmeansatleastwithregardtovirtualizationwedonthavetoun learnasmanyBackup1.0habitsinordertoseehowaBackup2.0techniquemightbemore effective.

Oddly,itsalmostlikevirtualizationvendorsknowthatbackupsarecomplicatedandthat nativesolutionsareusuallydeficientinkeycapabilities,becausemostvirtualization vendorsweretalkingCitrix,VMware,andMicrosoft,heredontreallyprovideany nativebackupcapabilitiesatall.Sure,mostofthemhavebackupsolutionstheyllsellyou, butmostofthosearestillgoodoldBackup1.0style,getitdoneduringtheeveningbackup windowsolutions. Butletstakeastepbackandlookatwhyvirtualizationbackupshavethepotentialtobe morechallengingthanaphysicalserverbackup.

AsillustratedinFigure7.1,avirtualizedserverrunsonavirtualizationhostlikeVMware vSphereorWindowsHyperV.Thehostcontrolsthehardwareofthephysicalmachine, whilethevirtualizedserverhasitsown,virtualizedhardwareenvironment.Thevirtual serversharddisksaregenerallyjustfilessittingonthephysicalhost.Irealizethisis probablynothingnewtoyou;Imjustsettingsomecontext.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure7.1:Virtualserverrunningonavirtualhost. Thiswholearchitecturemeansthat,unlikewithanormalphysicalserver,wevegottwo placeswecouldrunbackups.Thefirstplaceisonthevirtualizationhostitself,wherewed simplybackupthefilesthatrepresentdrivesforthevirtualservers.Inotherwords,ifwe grabtheCDrive,DDrive,andEDrivefiles,werereallybackingupthecomplete contentsofwhatthevirtualserverseesasitsC,D,andEdrives.Thatwouldseemtobea goodideabecausewegeteverythingthevirtualserverhas. Theproblemisthat,usingpurelyBackup1.0technologies,doingthistaskiskindoftricky. Thoseharddiskfilesarealwaysopenandalwaysinusewhilethevirtualserverisrunning. Thesimplestthingwouldbetotemporarilyshutdownthevirtualserver,backupallofits files,thenstartitupagainandthatsexactlywhatmanycompaniesdo.Butthattakesus backtobackupwindows,pointintimebackups,andotherBackup1.0downsides. Thesecondpossiblescenarioistorunbackupsoftwarewithinthevirtualserver.The backupsolutionwouldseeaC,D,andEdrive,andwouldbackthemupexactlyasifthe backupsolutionwererunningonaphysicalserver.Thatmeanswewouldbackup Exchangeexactlyaswealwayshave,backupSQLServernormally,andsoon.Nothing changes,really;thebackupsolutionisunawarethatitsrunninginsideavirtualmachine (VM),soitbehavesasifvirtualizationdoesntreallyexist.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

ThereareprosandconstoboththeinsidetheVMandtheoutsidetheVMscenario. WhenyourebackinguptheentireVMfromoutside,youregettingeverything.Essentially, thosevirtualdiskfilesarediskimages,andbybackingupthosediskfiles,youreenabling prettystraightforwardrestoreanddisasterrecoveryscenarios.However,youloseanykind ofgranularityyourebackinguptheentireserver,andthatsallyoucanrestore,toothe entireserver.Thefactthatitsavirtualservermakesitveryeasytorestoretoadifferent locationjustpickadifferentvirtualizationhost. Theinsideapproachgivesyougranularity,meaningyoucanbackupindividualfilesand soon.However,youpickupsomeofthedownsidestoanyphysicalserverbackup:Inorder torestoretheserverfrombaremetal,youhavetoinstalltheoperatingsystem(OS)and yourbackupsolution,ataminimum. TheresatwisttoVMstoragethatcomplicatesallofthistheStorageAreaNetwork(SAN). Figure7.2illustratesthedifferences.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Virtualserversdonthavetostoredataonvirtualdisks.Theyrealsocapableofconnecting toaSAN,andstoringtheirdatadirectlyonitwithoutcreatingthefictionofavirtualhard disk.Butdoesthatcreatenewpossibilitiesforbackups?Notnecessarily.SANsgenerally assignbigchunksofdiskspacetoaparticularserverforaccess,meaningwhateverSAN diskspaceisbeingusedbythevirtualservercanonlybeusedbythevirtualserver.Many SANsdosupporttheabilityforbackupsolutionstoonlyreadthediskspaceassignedtoa server,meaningthebackupsolutioncouldgrabthevirtualserversfilesandfolderswhile thevirtualserverwasrunningbutthatsaddingalayertoyourbackupandrecovery scheme. Boththeinsideandoutsidetechniqueshaveprosandcons,butwhichoneisbest?Most importantly,whichonecomesclosesttoourBackup2.0manifesto? Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible. Toanswerthosequestions,letslookmorecloselyatbothtechniques.

LetslookatvirtualserverbackupfromapurelyBackup1.0perspective,whichiswhat mostcompaniesareusingtoday.Ivealreadyoutlinedboththeinsideandoutside techniques;nowletsdiveintoabitmoredetail.Tokeepthingssimple,Imgoingtofocus onMicrosoftsHyperVvirtualserverhypervisor;obviously,thetechniquesImdiscussing aresubstantiallysimilaronothervirtualizationplatforms,butthisbookhashadanice Microsoftfocustothispoint,soIllkeepitthereforthespecifics.

Letsconsidertheinsideapproachfirst,whichmeansyouhaveabackupsolutionrunning insideeachandeveryVM,grabbingthefilesandfoldersanddatafrominsidethatVM.This isastraightforwardtechniquethatalotofcompaniesusebecauseitsexactlythesameas thetechniquestheyvealwaysusedforbackingupservers.Abackupsolutioncangrab individualfilesandfolderssubjecttoalltheBackup1.0limitationsthatIvediscussedin theprecedingsixchapters,ofcourse. Adownsideisthatyourereallydevotingabiggerchunkofphysicalprocessingpowerto runningbackups.ImagineyouhaveasmallerHyperVhostrunningamerefiveVMs.You runyourbackupsduringaneveningbackupwindow,andyourbackupsolutionconsumes about10%ofeachVMsprocessingpowerwhichisntmuch.Ataphysicallevel,however, thoseindividual10%bitesmightadduptoaround50%ofthehostmachinescomputing powerjusttoperformbackups.Figure7.3illustrateswhatImtalkingabout.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure7.3:Processingpowerusedforrunningbackups. Imdeliberatelysimplifyingthenumbersherejusttomakeapoint,whichhopefullyisclear enough:RunningbackupsinsidetheVMsis,inaggregate,usinganoticeableamountof physicalprocessingpower.Itskindofawaste,butitsgettingyoueverysingleindividual fileandfolderfromwithintheVMs,meaningyoucandoverygranularrestorestothe singlepointintimewhenthebackupwasmade,ofcourse.Itwouldprobablynotbe efficienttorunbackupsallthetimefromwithintheVMs;theaggregateuseofphysical processingpowerwouldbetoohigh. WhataboutrunningaBackup2.0stylebackupsolutionwithintheVMs?WhatIve suggestedisanagent,runninginsidetheVM,thatgrabschangestoindividualdiskblocks astheyarewrittentodisk.Suchanagentmightadd2to3%overheadtotheserver,which isabsolutelyminimal.Again,however,thatsperVM;that2to3%wouldadduptoa sizablechunkofphysicalprocessingpower,whichstillseemslikeawaste.Idontmind dedicating2to3%ofmycomputingpowertobackups,butdedicating10%ormoreofa HyperVhostscomputingpoweritjustseemsliketheressomethingbetterIcouldbe doingwiththatpower. Okay,soletsmovetotheoutsidetechnique,wherewerunsomekindofbackupsolution rightontheHyperVhost.Imonlygoingtobelosing2to3%overheadtotalnow,which makesmefeelalotlesswasteful.ButusingpurelyBackup1.0technologies,allIcandois grabentireVMharddiskfiles.Thatswonderfulfordisasterrecovery,becausetheentireVM isexactlywhatIwantinthatscenario.Butrecoveringanindividualfileorotherpieceof datagetsreally,reallytedious.YoualsohavetotakeeachVMofflineinordertofullyback upeachvirtualdisk,whichisahugeinterruptionandtiesyoutoamaintenancewindow ifyourVMscant,forbusinessreasons,beofflineeverynight,thenyouwontbegrabbinga backupeverynight.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

HyperVVSSWriter HyperVdoessupportMicrosoftsVolumeShadowCopyService,which slightlyexpandsyouroptionsforoutsidetheVMbackups.Essentially,VSS allowsHyperVtonativelymakesnapshotsofVMdiskimageswhilethe VMsarerunning.Thisdoesexactlywhatyoumightsuspect:Itmakesa completecopyofthevirtualdiskfiles,andyoucantheneasilybackupthat copywhiletheVMcontinuesrunning.Youneedtoplanfortheextradisk spaceontheHyperVservertotakeadvantageofthis,ofcourse.HyperV evenmakesasnapshotofthevirtualserversmemory,sowhatyoure backingupisliterallyasnapshotoftheVM,includingitscurrentoperating state. Afterthefirstsnapshot,subsequentonesarejustdeltas,meaningtheyonly includethebitsthatchangedsincethefirstsnapshot.Thathelpsconserve diskspace,andVSScanexposetheresultingsnapshotbycombiningthebase snapshotwiththemostrecentdifferences. Thistechnologyisntquiteasmagicalasitmaysound.Virtualization productshavehadtheabilitytotakesnapshotslikethisalmostforever; VMwareWorkstationwasprobablythefirst,anditwassuperhelpfulwhen youwereusingyourVMstodoproductdemonstrations.Youdget everythingsetupthewayyouwanted,andtakeasnapshot.Aftereachdemo, youdrollbacktothesnapshot,leavingyourselfcompletelyreadyforthe nextdemo.BybuildingthecapabilityintoHyperV,Microsofthassimply leveragedthisyearsoldtechniqueforbackuppurposes. Butsnapshotsarestillveryspecificpointsintime.Youcantrelyonthe snapshotsbeingkeptentirelyontheHyperVserver;ifthewholeservergoes kaput,youlosethosesnapshots,too.Snapshotsareonlybackupswhen theyrecopiedoffserver,typicallytotape.ManybackupsolutionsareVSS enabled,meaningtheycanseethesesnapshotsandgrabthemduringa backupoperation.Soyourestillatriskforanydatathathasntbeenmoved offtotape;thebigadvantageisthatyoucancontinuouslymoverecent snapshotsofftotapebecauseyourecopyinginactivefiles. Ofcourse,IvenevermetanyonewhobacksuptheirHyperVserversmore thanoncepernight,andmostdoitonceaweek.Sothatsalotofdataatrisk. Soitseemslikethesetwotechniquesbothhavetheirupsides,buttheybothhave downsides,too.Doeseitherofthemoffergreatrestorescenariosthatwouldmakeupfor thedownsides?


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Again,usingpurelyBackup1.0techniques,boththeinsideandoutsidetechniques actuallyofferprettypooroptionsforrestoringdata.Usingtheinsidetechnique,youstill havetohuntdowntherightbackuptape,spintotherightfile,andrestoreit.Intheeventof anExchange,SQLServer,orSharePointbackup,youhavetorestoreanentiredatabaseto analternativelocation,openitusingthenativeserverapplication,findthebityouwanted torestore,exportittoastandalonefile,andsoon.Tediousandtimeconsuming.Although Backup1.0iseasytopulloffinsideaVM,itstilldoesapoorjobofmeetingactualbusiness needs.Youstillcantrestoretopointsintimeotherthanyourbackup,meaningyoustand toloseagreatdealofdata.Whensomethingdoesgowrong,youllbespendingalotoftime onrecoveryprettymuchtheantithesisofouridealsituation: Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible. Usingtheoutsidetechniqueseemslikeitwouldbeabetterdeal.Yourespendingless overallprocessingpowerbecausethebackupsolutionisrunningontheHyperVhost. Yourealsograbbingtheentirediskimageinyourbackup,withouttheneedforspecial Exchangeaware,SQLServeraware,SharePointaware,orwhateverawareagents.Allof yourdataisprotected.Butyourestilldealingwithbackupwindowstypically,evenif youreusingHyperVsVSSintegration,yourestillonlygrabbingonebackupanightorper week,whichmeansyouhavealotofdataatrisk.Also,restoringdatameansrestoringthe entireVM.Althoughitseasytorestorethattoanalternativelocationyoudohaveaspare HyperVserversittingaroundforthatpurpose,right?youhavetowaitfortherestoreto run,startuptherestoredVM,getwhateveritisyouneeded,andsoon.Doingallthatto recover,say,a5kilobyteemailthatsomeoneaccidentallydeletedisahorriblewasteof time,akintorebuildinganentirehoteljusttofigureoutwhichbitofcarpetingcaughton fireandburnedtheplacedown. MountableImages TheresalittlerayofsunshinewhenitcomestoHyperVthatIllletyouin on.HyperVVMsstoretheirdiskimagesas.VHDfiles.Microsofthasopened the.VHDfileformatspecification,andtheyvecreatedanumberofutilities thatletyoumountandbrowseoffline.VHDfiles. Soheresthescenario:Youregrabbingpointintimebackupsofthe.VHD filesbyrunningabackupsolutionontheHyperVhost.Perhapsyoureusing VSStobackuplivesnapshotsgreat.Whenrestoretimecomes,youdont necessarilyhavetorestoretheentireVM,startit,andgointoittorecover whateveryouwanted.Instead,youcanjustgetthelatest.VHDfileoffoftape, thenmountthat.VHDasareadonlydiskdriveonanotherWindows computerWindows7canactuallydothisnatively.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Thisstillisntaperfectsituation:Yourerestoringfromapointintime,andif yourbackupsarefarapart,youstillhavealotofdatapotentiallyatrisk.You stillhavetospinthe.VHDfileofftapeandfindaplaceforittolive.Butyou canmountitwithouthavingtoactuallyruntheoriginalVM,whichcansavea lotoftime.Forexample,iftheoriginalVMhadthree.VHDfiles,youonlyneed torestoretheoneyouwantsomethingoffofratherthanrestoringallthree sothatyoucanstarttheVMnormally. SovirtualizationbackuptechniquesintheBackup1.0worldarentanybetterthanthenon virtualizationbackupsinthatsameworld.MaybeBackup1.0canofferabetterdisaster recoveryscenario?

Infact,itcan.Hooray,onepointforoldschoolbackuptechniques!Intheoutsidebackup scenario,whereyourebackingupentireVMdiskimages,youvegotgreatdisaster recoveryoptions.Becauseyouvebackeduptheentireserver,possiblyevenincludingits memorystateataspecificpointintime,youcanrecovertheentireserverprettyeasily. WhatsevenbetteristhefactthatVMsactuallyhaveverylittleideawhatphysical hardwaretheyrerunningon.Remember,allaVMsees,forthemostpart,isanabstract, virtualizedhardwareenvironment.SoifyourentireHyperVserverdies,youcanjust restoreallyourVMstoanotherHyperVserverorevenspreadthemoutacrossmultiple otherHyperVservers,evenatdifferentlocations.Oncerestored,theVMswillstartwith littlecomplaintbecauseasfarastheOSsinsidetheVMsareconcerned,nothinghas changed. ThisabilitytorelocateaVMtoanyavailableHyperVhostistheexactthingthatmakes livemigrationpossible.Inalivemigration,arunningVMismovedtoadifferentHyperV host,oftensothattheoriginalhostcanbetakenofflineformaintenance.Itworks. Well,itworkstoapoint.Yourestilllimitedtowidelyseparatedpointsintimeforyour disasterrecoverybecauseyourbackupsarepointsintime;theyrenotcontinuous.Itsgreat thatyoucanrestoreaVM,evenincludingitsmemorystate,butifwhatyourerestoringis5 daysold?Youvestillgotsomebadnewstodelivertotherestofthecompanybecauseodds aretheresalotoflostdata. Theresmorebadnews,too.WhenIwriteaboutdisasterrecovery,Imreallywritingabouta completeserverfailuremeaningyouvelosttheHyperVhost,too.Ifyourerelyingon backupsofVSSsnapshots,thendisasterrecoverywillstillhavetostartwithreinstalling WindowsandHyperV.AlthoughnewerversionsofWindowsServerinstallfasterthan ever,itsstillnotinstantaneous.ItdbefastertorestorethoseVMimagestodifferent, alreadyupandrunningHyperVservers,butthatassumesyouhavesomeofthosewith availableprocessingpower,diskspace,memorytoallocate,andsoon.Ifyoudont,then yourdisasterrecoverywillstillbealittleslow.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

ManagingbackupsisthesameoldBackup1.0story.Youmustshuffletapes,makesureyou knowwhichonesarethelatest,andifyouredoingfull+incremental+differentialbackups, youstillhavetomakesureeverythingstaysintherightorderforasuccessfulrestoreor disasterrecovery.

LetsonceagainforgetBackup1.0.LetsevenforgetBackup2.0.Iwanttowriteaboutwhat Iwishvirtualizationbackupscouldlooklike.Itmightnotbepossible,buttheonlywaywell eventuallymeetallourbusinessneedsistopushthetechnologyalittle.Mywishlistis simple: Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible. Now,morespecifically,hereswhatIwanttoenablemywishlist: ContinuousbackupsofVMswithaslittleaggregateoverheadaspossibleThat meansIdprefernottohavetorunbackupsolutionsinsidetheVMsbecausethatis essentiallyduplicatedeffortandwastedcomputingpower. Full,asfastaspossiblebaremetalrecoveryofanentirevirtualizationserver, includingthebaseOS,hypervisor,andalltheVMs TheabilitytograbsinglefilesandfoldersfromaVMbackup,preferablywithout havingtorestoretheentirething,starttheVM,andsoon TheabilitytorollbackasingleVM,ortheentirevirtualizationhostserver,toa particularpointintimeImhavingtroublethinkingofspecificscenarioswhenI mightwanttorollbacktheentirehost,butImnotlettingmylackofimaginationget intheway:Iwantthecapability. Idontwantandthisisabigpointformetohavetowaitfortapedrivestocopy filesbacktodiskHonestly,Idontliketape.Sure,youhavetouseitbecauseitsthe easiestwaytogetdataoffsite,butIprefertapestobePlanB.Inotherwords,I wantmyPlanAbackuptobeonnice,fastdiskspacesomewhereinmydata center;ifmywholedatacenterfloodsorwhatever,Imhappytodealwithtape.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

WhytheTapeHate? Itsjustauserperceptionthing.Ifauserwantsafile,theydonttendto understandwhyittakes6hoursformetogettherighttape,restoreafile, andsoon.If,however,theentiredatacenterfloods,everybodyinthe companytendstobeabitmoreunderstandingaboutwhythingsaretaking solongitsclearlybeyondanyonescontrolatthatpoint.ThatswhyI preferahierarchicalstoragesystem:diskbasedbackupsfordaytodayuse, andtapesasabackuptothat. SowhatdoesvirtualizationBackup2.0looklike?Isittechnicallypossibletomakethiswish listareality?

Ithinkitis.ThinkingabouttheBackup2.0techniquesIveoutlinedinpreviouschapters, hereshowIdimagineitworking: Youdstartwiththeoutsidetechniquerunningthebackupsolutionrightonthe HyperVhost,andrunningnothingspecialinsidetheguestVMs.Thistechnique involvesthelowestprocessingoverheadprobablylessthan3to4%ofthehosts totalcomputingpower. Youdneedtorelyondeduplicationandcompressionbecausetheymakedisk basedbackupsmorepractical(diskspaceisstillmoreexpensivethantapespace). Bytakinguplessdiskspaceonabackupserver,youreenablingmorebackupstobe keptforlonger. Youdsimplymonitorforchangestothediskblocksonthehost,capturethose changes,andtransmitthemofftothebackupserver.Thisisgoingtocaptureevery changetoboththehostOSandtotheVMdiskimages,innearrealtime.Figure7.4 illustratesthis.Essentially,everythingthathappensonaHyperVhostcomesdown toblocksstoredonthehostsphysicaldiskstorage.Byinterceptingthosechangesat theWindowsNTFSfilesystemlevelbymeansofafilesystemfilteryoucan capturethechangeddiskblocks(whichareonlyafewkilobyteseachinsize)and transmitthemtoabackupserverforlongtermstorage.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Thebackupserverknowswhichdiskblocksgowithwhichfile.Therefore,itsnotjust keepingagiantrepositoryofdiskblocks;itknowswhichblockscomprisethehostOS, whichblocksmakeupagivenVMs.VHDfiles,andsoon.ThereareafewkeyfactsthatI needtohighlightaboutthis: Wehaveacopyofeverydiskblockthathaseverchangedonthefilesystem. Weknowwhattimeeachchangewasmade. Weknowwhatfileeachchangewentto. Thepreviousthreefactsmeanwecanreconstructanyfileatanypointintime, simplybygrabbingthediskblocksassociatedwith(a)thatfileand(b)thatpointin time. Windowsalreadyincludesthetechnologyneededtomounta.VHDfileandbrowseit asanactivedisk.


WecouldusearestorescenarioliketheoneillustratedinFigure7.5.Here,weveusedthe backupsolutiontoassemblethediskblocksforaspecificVHDfileataspecificpointin time.WeverebuiltthatVHDfileontoafileserveronthenetwork,thenmountedthatVHD filetoaworkstation.ThatprovidesaccesstothefilesinsidetheVHD,whichcanbecopied toarealdiskdrive,thenmovedtowhereveritistheyneedtogo.Thesametechnique couldbeusedtorecoveraVHDandmountitasadriveonaSQLServer,andthenSQL ServercouldattachadatabasefromthatVHDaneatwaytoaccessanearlierversionofa database.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure7.5:Restorescenario. ThisisagreatrestoretechniquebutBackup2.0candobetter.Remember,computersare supposedtosaveuswork,notcreateintermediatestepsforus.Whynotsimplydesigna backupserverthatcoulddirectlyexposeaspecificsetofdiskblocksasafilesystem?In otherwords,wedontneedtoextractthediskblockswewantandreconstructafile;we shouldsimplybeabletodynamicallyaccessthedesireddiskblocksastheysitinthe backuprepository,exposingtheresultingfilethroughstandardfilesystemmechanisms. And,whilewereatit,whynotsimplybuildinthetechnologyneededtomounttheVHD?In thisfashion,theVHDwouldappearasashareddriveonthebackupserveritself.Figure 7.6showswhatImtalkingabouthere.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure7.6:Faster,easierstepstorestoringfiles. Thestrikingthingaboutthisisthatitdoesntinvolveanyradicalnewtechnologies. EverythingIvesuggestedherecanalreadybedoneinindependentways;werejust combiningthemtocreateabetterbackupandrestorecapabilityforourselves.Bysitting downandthinkingaboutwhatweactuallywantfrombackups,asopposedtowhatvendors havetraditionallygivenus,wevebeenabletodrawtogetherexistingtechnologiestocreate somethinginfinitelymorevaluable. ItstheBlockthatChangesEverything IfyoulookatwhatImsuggestinginFigures7.5and7.6,itsreallynotthat differentfromwhatHyperVandVSScanalreadydo.VSSgrabssnapshotsof VMs,whichyoucanthenbackuptodiskortape.Youcanrestorethose, mountaVHD,andrecoverfilesexactlyasIvesuggested.Suchabackup solutionwouldrunontheHyperVhost,notwithintheguestVMs,andwould useaminimumofcomputingpower(albeitalotofdiskspacebecauseVSS doesntsupportdeduplicationorcompression). VSSonlydownsideisitsscope:ItfocusesonsnapshotsoftheentireVM.You cantjustconstantlytakesnapshots;therestoomuchoverheadinvolvedand waytoomuchdiskspace.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Mysuggestionisjusttogetmoregranularandgrabdiskblocksnapshots insteadofentireVMsnapshots.Thatway,yourecontinuallygettingalow overheadstreamofdata,andyourebackingupthelatestchangesona continualbasis.Thatbasicallyminorchangeinscopeindividualdiskblocks versusentireVMsmakesthenearrealtimebackuppossible,andthats whatletsusoperatewithmuchlessdataatrisk.ThatsBackup2.0: continuousbackups,notpointintimebackups.

Disasterrecoveryrecoveringanentire,baremetalserverintheeventofadisasteris straightforward.Simplygrabthemostrecentdiskblocksfortheentireserveranddump thembackontotheserversdisk.IimagineyoudhavesomekindofbootableCDorDVD withaminimalOSonit,capableofmountingtheserversphysicaldisksandreceiving streamedindiskblocksfromthebackupsolutionasshowninFigure7.7.Youdgetthe entireserverhostOS,registry,alltheVMs,andeverything,towhateverpointintimeyou needed.

Figure7.7:Abaremetalrecovery. Theneatbitisthatyoucouldrecovertootherhardware,too,providedthenewhardware wasofthesameprocessorarchitecture,hadthesamebasicconfiguration,andsoon.That makesrealdisasterrecoverylikeoffsiterecoveryarealpossibility.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

ThisisthesamebasicdisasterrecoverymodelIveproposedinpreviouschapters.Itoccurs tome,however,thatbyaddingalittlereplicationaction,youcouldreallyenablesome interestingdisasterrecoveryscenarios.Forexample,byreplicatingthecontentsofthe backuprepositorytoanotherphysicalserverinadifferentphysicallocation,youdbe assuredofdisasterrecoveryevenintheeventofatotalfacilityloss.Youcouldpotentially replicatethosediskblockstoaninthecloudserviceprovider,whocouldpotentiallygive youtheabilitytorecoverentireserverstoVMsthatrunattheserviceprovidersfacility creatingacloudbaseddisasterrecoveryfacility.Youdneedtodosomemathonthe bandwidthrequired,butrememberthatdatadeduplicationandcompressionwouldhelp reducethenecessarybandwidthsomewhat,andyoucouldhaveacontinuousreplication streamatallhoursofthedayandnight.Itbearssomeadditionalthoughttoseeifthatsa practicaladditiontoBackup2.0ssuiteofcapabilities.

ManagementoverheadkindofgoesawaywithBackup2.0,oratleastgetsalotsimpler.Im notsuggestingthatyoullneverneedtapesagain,becauseyouabsolutelyshouldbebacking upthediskblockrepositorytotapeforoffsitestorage(unlessyoucangetthereplication thingfiguredout,whichwouldbeverycool).Figure7.8illustrateshowtapebackupswould fitintothescheme;thethingtorememberisthatthoseareredundantbackups.Iimagine makinganightlybackupofthedaysnewestdiskblocks;theresnobackupwindow becauseyourenotbackinguplivedataortakingproductionserversoffline,sohowever longittakestowritethedatatotapeisfine.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Anytimeyoustarttalkingaboutvirtualization,therearespecificconcernsthatcometo mind.Virtualizationisjustabitdifferentthannormalcomputing,andtherearefactors involvedthatwewanttomakesurewevefullyconsidered.

Performanceisabigoneofthosefactors.AsIpointedoutearlier,simplyrunningabackup solutioninsideeachVMseemslikeawasteofcomputingpower.Allthethingsyouneedto backupareononemachine,butyourespendingmultipletimestheneededcomputing powersimplybecauseeachVMisresponsibleforthedataunderitscontrol. Ithinktheoutsidescenarioprovidestheanswertothis.ProvidedyoucanbackuptheVM imagesfromthehostOSlevelandyoucanwhilestillhavinggranularaccesstothestuff insidetheVMimagesandIthinkyoucandothat,toothenthisisthewaytogo.Youre gettinganaggregatecomputingoverheadinthelowsingledigits,whichiscompletely acceptable.

Hereitisagain:granularrecovery.IdislikealotoftraditionalBackup1.0,thatis techniquessimplybecausetheyreprimarilygearedtowardfullfailuredisasterrecovery models,whereasmostofwhatwedealwithonadailybasisisrecoveringafileortwo. IthinkIveshownhowBackup2.0techniquesgrabbingdiskblocksinnearrealtime canprovideanylevelofgranularityyouneed,fromafullbaremetaldisasterrecoveryto recoveringasinglefile.GranularrecoveryshouldandunderBackup2.0,doesrequire minimaleffort;theabilityofaBackup2.0stylesolutiontodynamicallyexposeabackedup volumebydynamicallyassemblingtherightdiskblocksondemandwell,thatcovers minimaleffort.

ItsnotenoughtojustbackuptheVMVHDfilesandrelatedconfigurationfiles.Idorealize thatthoseVHDfilesarewhatcontainthedatayouactuallycareabout;withouta virtualizationhosttorunthoseVHDfiles,however,theyrenotnearlyasusefultoyour business.Backupandrecoveryisallaboutgettingbackonlineasfastaspossible;simply backingupVHDfilesdoesnotaccomplishthatifittakesacouplehourstorebuildahost forthoseVHDfilestoliveon. Iveworkedwithanynumberofconsultingclientswhodidntquitegetthatpointuntil theydidhaveacompleteserverfailure.Then,alltheVHDbackupsintheworldwere uselessuntiltheydbuiltanewhost. IveshownhowBackup2.0caneasilyscaletoafulldisasterrecoverymodelbystreaming diskblocksbacktowhateverphysicalserveryouwant.ThisrebuildsnotonlytheVMVHDs butalsotheentirehostOSandconfiguration,meaningyoucansimplyrestarttheserver andpickupbusinesswhereyouleftoffwithverylittlemanualeffort.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Atthispoint,wevecoveredWindowsServer,SQLServer,SharePointServer,Exchange Server,andevenvirtualizedservers.WhatelseisleftforBackup2.0toconquer?Plenty. Todaysbusinesseshavelotsofotherconcernsandneedswithregardtobackup,andinthe nextchapter,welladdresssomeofthem.Forexample,restoreisaverydifferenttask thandisasterrecovery,soIneedtolookathowBackup2.0mighthandlethelatter.And whatabouthighavailability?Youcertainlycantaffordforyourbackupsolutiontobedown whenyouneedit!Thereareotherissues,too:security,compliance,dataretention,mobile infrastructure,andmore.AndwhatifBackup1.0isntcompletelydead?Howcanyou integratethe1.0and2.0techniquesintoaconsolidatedbackupplanandwhyinthe worldwouldyouwanttodoso?Thatsallinthenextchapter.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Theresmoretoabackupstrategythanjustgrabbingtherightfilesandmakingsureyou canrestoretheminapinchalthoughthatsobviouslyabigpartofit.Asolidbackup strategyalsoconcernsitselfwithdisasterrecoveryinavarietyofscenarios.Youneedto makesureyourbackupsystemitselfhassomeredundancynothingsworsethanbeing withoutabackupsystem!Becausebackupsinherentlyinvolvedataretention,inthisday andage,youalsohavetoconcernyourselfwiththesafetyandsecurityofthatdataaswell asanylegalconcernsaboutitsretention.Thatswhatthischapterisallabout:Dealingwith theextrasthatsurroundabackupstrategy.IlllookathowtraditionalBackup1.0 techniquesaddressedtheseextras,andsuggestwaysinwhichwemightrethinkthemfora Backup2.0world.

Ivealreadywrittenquiteabitaboutdisasterrecovery,orbaremetalrecovery,whichis whatyoudowhenanentireserverdiesandyouneedtorestoreit.Inthebad,bad,badold days,disasterrecoveryalwaysstartedwithreinstallingtheserversoperatingsystem(OS) fromscratch,theninstallingsomekindofbackupsolution,thenrestoringeverythingelse fromtapeatimeconsumingprocessbecausespinningdataoffoftapeisntexactlythe fastestactivityintheworld. EventheBackup1.0mentalitygotsickofthatprocess,though.Today,mostthirdparty backupsolutionsprovidesomekindofrestoreCD,whichcanbeusedtobootafailed server.ThestrippeddownOSontheCD,oftenbasedonDOS,WinPE,oraproprietaryOS,is smartenoughtofindthebackupserverandreceivedatabeingstreamedacrossthe Internet;dependingonthesolution,itmightalsobesmartenoughtoreaddatadirectly fromanattachedtapedrive.Figure8.1showsanexampleofoneoftheserecoverydisksin action.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure8.1:Recoveringaserverbyusingarecoverydisk. Note SomevendorsmightmakeabootableUSBflashdriveorsomeotherformof removablemediabootable.Thatsfine,too,andactuallycanbefasterthana disk,providedyourserverscanbootfromtheselectedtypeofmedia. Noteverybackupsolutionreliesonadisk,thoughafterall,somefolksdoconfiguretheir serverswithoutopticaldrives.Otherbackupsolutionscaninsteadinstalltheirbaremetal recoverysoftwaretoaseparatepartitionoftheserversbootdisk,makingtherecovery softwareavailableasabootoption.Idontfavorthisapproachbecauseifyouloseawhole server,itsentirelypossiblethatyoulostthedisks,too,inwhichcaseyourrecovery softwareisgoneaswell.StickwithsolutionsthatprovideabootableCDorDVD,andsimply makesureyourservershaveanopticaldriveinstalled.Eventodayslowprofile,2U rackmountserverscanalmostalwaysbeconfiguredwithaslimlineopticaldriveusually thesameslimlinedrivesthatthemanufacturerusesintheirlaptopcomputers.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

AThirdOption:PXE AthirdoptionistohaveserverswhoseBIOSandnetworkcardssupport networkboot,usingIntelsPXEprotocol.Inthisscenario,yourbackupserver softwarewouldneedtosupportnetworkboot,meaningthattheserver wouldbeabletofinditonthenetwork,requestabootOSimage,and downloadthatimagefromtheserver.Thatimageisusuallythesamething thatwouldbeonarecoverydisk. MicrosoftmakesgreatuseofPXEfortheirautomateddeploymenttools;even theolderRemoteInstallationServices(RIS)supportednetworkboot scenarios.ItslesscommontoseePXEusedinconjunctionwithabackupand restoresolution,though,simplybecauseyourehopefullynotusingthe featurethatoften,sousingarecoverydiskissimpler,requireslesssetupand infrastructure,andiseasiertouseunderawidervarietyofsituations. Backup2.0isntmuchdifferentintermsofprocess:Youllusuallyuseabootdiskofsome kind,andthatdiskissmartenoughtolookforthebackupserveronthenetwork.Youmay beabletobrowseforaspecificserverimagetorestore,thentherestorationbegins.Other times,youmightbootusingthedisk,thengotothebackupserversconsoletoselectan imagetopushtotheserveryourerecovering. ThedifferencewithBackup2.0iswhatgetsrestoredbacktotheserver. BecauseaBackup2.0solutionwasstreamingdiskblockchangesinnearrealtimeupuntil theminutetheserverfailed,youregoingtolosealotlessdatathaninaBackup1.0style scenariowhereyourmostrecentfullserverbackupmayhavebeenfromaweekagoor longer.SoBackup2.0getsyoubackonlinewithlessdatalossiftheresevenanylossat all. Also,rememberthatBackup2.0reliesprimarilyonadiskbasedbackupstore.Thatoffersa coupleofadvantages:First,youwontbesittingaroundwaitingfordatatostreamofftape, whichevenwithtodaysimprovedmagnetictapeanddrives,isstilltimeconsuming.A Backup2.0solutioncanstartrestoringyourserverimmediately. Finally,Backup2.0doesntmessaroundwithfull,incremental,anddifferentialbackups.Or technically,Iguess,itdoes:Itgrabsafullbackupofyourserverinthebeginning,then continuallygrabschangeddiskblocks,whichistechnicallylikeanincrementalbackup.But youdonthavetokeeptrackofanyofthat,orfindtherighttapes,orrememberthecorrect ordertorestorethosetapes.TheBackup2.0solutionsimplyasksyouwhatpointintime youwanttorestoretheserverto,anditgetsthecorrectdiskblocksautomatically.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Now,youmightthinkthatstreaminganentireserversworthofdiskblocksacrossthe networkwouldbeprettytimeconsuminginandofitself.Imean,justtryingtocopya2GB fileacrossthenetworkcantaketime,andserversmighthavehundredsofgigabytesworth ofdiskblocks.ThatswhereyouwanttodigintosomeofthedetailsofaBackup2.0style solutionbeforeactuallybuyingone. Laterinthisguide,Illbediscussingcompressionanddeduplication,twotechniquesthat helpabackupsolutionstoreserverdatausinglessdiskdatathanthatdataoriginallytook ontheserveritcamefrom.Lessspaceondiskalsomeanslesstimeonthenetwork,so exactlyhowabackupsolutionimplementsitsrecoverycanmatteralot.Figure8.2shows whatyoudontwant:Asolutionthatexpandscompressedanddeduplicateddiskblockson thebackupserver,streamingeachdiskblocktotherecoveringserverexactlyastheyllbe writtentodisk.Inotherwords,aserverwith200GBofstoragewillhave200GBofdata transmittedacrossthenetwork;evenwithadedicated1000Mbpsnetworkconnection, youreprobablylookingatanhourorso.

Figure8.2:Uncompressingandreduplicatingdataatthesource. Figure8.3showsaslightlysmartersolution:Leaveeverythingcompressedandde duplicateduntilitgetstotherecoveryserver.There,thebackupsolutionsrecoverydisk softwarecandecompressandreduplicatethedata.Lessdataistransmittedacrossthe networkthisway.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure8.3:Uncompressingandreduplicatingdataatthedestination. Thesesortsoffinedetailscanhelpspeedtherecoveryprocesstremendously.Asyoure evaluatingsolutions,askvendorsforbenchmarksforbaremetalrecoverytimes.They mightbeabletotellyou,forexample,howmanyminutesittakestorecoveryxgigabytesof dataacrossanetworkconnectionofymegabitspersecond.Iftheycant,itscertainlya benchmarkyoucanfigureoutonyourowninalabusingtrialsoftware.

Akeycapabilityforanybaremetalrecoverysolutionistheabilitytorestoreaservers imagetoadifferentservereitheradifferentphysicalboxortoavirtualmachine.Both capabilitiesphysicalserverandvirtualmachineareneeded.Insomecases,aserver mightfailentirely,leavingyouwithnochoicebuttogetanewphysicalmachinetoreplace it.Inothercases,youmightonlyneedafewdaystorepairaphysicalserver,meaning restoringtoavirtualmachinewillprovidealessexpensiveinterimoption.Beingableto restoretoavirtualmachinealsoprovidesvastlymoreflexibilityfordisastersthataffect yourentiredatacenter:Ratherthanneedinganoffsiterecoverylocationthathasdozens ofserversreadytogo,youcanjustdumpallyourserversintovirtualmachines. Expectsomelimitationsaroundthesecapabilities.Forexample,youobviouslyshouldnt expecttorestorea64bitOSontoolder,32bithardware.Serverhardwarewithvastly differentconfigurationsmaypresentproblems,too,althoughtheWindowsOShasbecome moreadeptatdealingwiththosetypesofchanges.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Tip HaveyourWindowsserialnumbersorlicensekeyshandy,andifyoureusing internalVolumeActivationlicenses,makesurethatanactivationserveris partofyourrecoveryplan.WhenWindowsdetectsmassivehardware changes,itmaydemandimmediatereactivation. Thefeaturetolookforasyoureevaluatingsolutionsisdissimilarhardware,whichoften meansthevendorhasprovidedtechnologiesformakingtherecoveryprocessonto differenthardwareorontoavirtualmachineabitsmoother.

HeresanideaworthyofourBackup2.0letsrethinkeverythingmotto:Whywaitfora disastertostartyourdisasterrecovery?Whynotjusthaveaspareserverreadytorunfor everyoneofyourservers? Hearmeout.Intherecent,badolddays,yousimplycouldntaffordtokeepaspareserver intheclosetforeveryproductionserveryouowned.Notpractical.However,withthe adventofhighperformance,reliablevirtualmachines,youcankeepaspare.Hereswhata reallyslickBackup2.0solutioncouldoffer:Onceanight,say,thesolutioncouldconstructa readytorunvirtualmachinefromyourcurrentbackups.Youdjusthavesomebighard disksomewhere,filledwithvirtualmachinefilesthatwereconstantlybeingrecreatedor updated.Whendisasterstruck,youwouldntneedtorecoveranythingyoudjustbootone ofthevirtualmachines.Weretalkingarecoverytimeofafewminutes! Dependingonhowyouvebuiltoutyourvirtualizationinfrastructure,thevirtualservers mightnotperformaswellasthephysicalones.Butslowerisfarbetterthancompletely gone,right?Andwithtodayslivemigrationcapabilitiesofferedinmostmajor hypervisors,providedyouveboughttherightmanagementtoolstoenablethefeature youcanalwaysshiftvirtualmachinestodifferentvirtualizationhosts,balancingthe workloadtogetthebestperformanceyoucanfromthemostcriticalresources.Andthose virtualserversmightwelljustbeaninterimstrategywhileyourepairaphysicalmachine orgetanewphysicalmachineinplace.

Aserverdies.Auserismissingafile.Someonesemailiscorrupted.Youconfidentlyturnto yourBackup2.0solution,havingreadthisbookandfullyembracedtheBackup2.0 lifestyle. Andyourbackupserverisdead. Whoops.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Highavailabilityisanappropriatefeatureforanymissioncriticalfunctionwithinyour business,andyourbackupsolutionshouldcertainlyqualifyasmissioncritical.Therearea fewdifferentwaysinwhichabackupsolutioncanbemademoreredundantandmore resistanttosinglepointsoffailure.

Obviously,runningyourbackupsolutiononredundanthardwarecanhelp.Redundant powersupplies,redundantdrivecontrollers,redundantnetworkcards,RAIDarraysfor disks,redundantfans,andsoonthosefeaturesareallwidelyavailablefrommostserver manufacturers,andareusuallyworththeextraprice. Dontforgetabouttheinfrastructurethatyourbackupsolutionrelieson,though.Having redundantnetworkcardsisnice,butitslessniceiftheybothplugintothesameswitch, andthatswitchfails.Someredundancyinyourinfrastructurecanhelp,too.Ofcourse,you havetodecidewherethetradeoffisforyourcompany:Redundancycostsmoney,andat somepointyoullhavetodecidehowmuchredundancyandexpenseispractical.

Redundantsoftwaresimplymeansthatyourbackupsolutionisrunningonmorethanone server,eitherinsomekindofclusterconfigurationorusingreplication.Acluster,forme, isntthemostefficientuseofresources.Hereswhy:Lookattheclusterarrangementin Figure8.4.

Figure8.4:Typicaltwonodecluster. Inthistypeofcluster,youhavetwocompletephysicalservers(theycouldbevirtual,too,I suppose),connectedtosomekindofsharedstoragelikeaStorageAreaNetwork(SAN). Yourbackupsoftwarewouldrunoneachserver,althoughonlyoneserveratatimewould beactive.Intheeventofafailure,theotherserverwouldtakeover,andwouldhaveaccess toallthesamestorage,soitcouldpickupwheretheotheroneleftoff. 137

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Forabackupsolution,thisiskindofinefficientandyoustillhaveyourstoragenetworkas asinglepointoffailure(althoughthoseareoftenredundantinandofthemselves,using RAIDarraysandthelike).Forabackupsolution,replicationoftenoffersabetterformof highavailabilityandbringswithitadditionalflexibilityforsolvingotherbusiness problems.

Withreplication,yourbackupsoftwareiscontinuouslystreamingcopiesofitsbackedup datatoanothercopyofthesamesoftware.Thatmeansyourbackupdatalivesintwo places,soifoneofthoseplacesgetsattackedbydinosaursorsomething,theotherplaceis stillabletoproviderestoreandrecoveryservices.Thiscanbeagreatwaytogetdataoff siteentirely,especiallyforsmallerbranchofficesthatmightnotbeabletomessaround withtapebackups.Figure8.5showswhatitmightlooklike.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Inthisexample,eachbranchofficehasitsownbackupserver,whichbacksupitslocal servers.Thebackupdataisreplicatedtothemainoffice,whosebackupserveralsobacks uptheproductionserversinthatoffice.Themainofficewouldlikelyhaveaccesstotape backupdrivesandanITstaff,sothemainofficesdataisredundantthroughtapebackups. ThebranchofficeswouldntneedtapebackupsorITstaffersbecausetheirdataisbeing maderedundantthroughreplication.Inaworstcasescenario,abranchofficeservercould berestoredfromthemainofficesbackupserver.Mightnotbeideal,andwouldntlikelybe asfast,butslowisbetterthanoutofbusiness. ThedownsideofthisapproachisthatyoumightwellbereplicatingdataacrossWAN links,mindyouthatyoudontcarethatmuchabout.Inotherwords,maybeabranch officehastwoservers,andyourebackingupthemboth,butyoureonlyreallysuper worriedaboutoneofthem.SoIllsuggestamodification:Yourbackupsolutionshouldlet youspecifywhichserversbackupdatawillbereplicatedupstream.




The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Server4,oneoftheserversinthefirstbranchoffice,hasdied.Restinpeace.Fortunately, Server4wasbeingbackedup,anditsbackupdatawasbeingreplicatedtothemainoffice. And,bystrangecoincidence,themainofficehasavirtualizationhost.Eachnight,themain officebackupservercreatesafreshsetofvirtualmachinesonthatvirtualizationhost.So whenServer4dies,someoneatthemainofficepushesabutton,andVirtualServer4starts up.Totaldowntime?Howeverlongittakestomakeaphonecallandpushabutton. VirtualServer4isstillbeingbackedup,sowhentherealServer4isfixed,someonepushes anotherbuttonandthecurrentServer4imageisrestoredtotheServer4hardware.Virtual Server4isshutdown,andServer4resumesitsexistence.Thatfailbackcanbedone duringamaintenancewindow,ofcourse,toavoidfurtherinconveniencingthebranch officeusers. Inthisinstance,havingthebackupdatareplicatedwasntcoveringforafailureinthe backupsystem,itwasofferingafasterandmoreconvenientrecoveryscenarioforafailed server.Thatswhatscalledinstantrecovery,anditsaveryusefulcapability. ChangingtheNatureofOffSiteRecovery Icanseethistypeoftechnologyreallychangingthewaycompaniesthink aboutoffsiterecovery.Today,manycompaniesinvestalotofmoneyin disasterrecoveryfacilities.Typically,companiesthatofferoffsiterecovery alsoofferoffsitetapestorage,andtheykeepavariedinventoryofhardware onhand.Ifyourdatacenteristoast,youpackupyourstaffandheadtothe offsitefacility.Yougetyourlatesttapesandsitbackforanicelongday(and night)ofrestores,gettingyourserversupandrunningontheloaner hardware.TypicalBackup1.0mentality,right? Imagineinsteadthatyourepayinganoffsitefacilitysimplytohostacopyof yourbackupsolution,withenoughdiskspacetoreplicateyourbackupdata. Allyouneedthemtoprovide,intheeventofadisaster,isabunchofHyperV servers.Whensomethingbadhappens,youmightnotevenhavetopackup thewholeteamjustgetontoaWebinterface,pushafewbuttons,andyour precreatedvirtualmachines(whichyourbackupsolutionhasdutifullybeen makingfromyourreplicatedbackupdata)moveovertoaHyperVhostand startup.YouestablishVirtualPrivateNetwork(VPN)connectionssothat youremployeescangettotherecoveredservers,manglesomeIPaddresses andDNSentriesperhaps,andyourebackonline.Heck,Iimaginesomeday therewillbeabackupsolutionthateventakescareoflittledetailslikeDNS entries. Offsitedisasterrecoveryfacilitiessuddenlybecomealotlessexpensive, becausealltheyneedissomegoodWANbandwidthandabunchofHyperV serversinadatacenter.Theycangetbywithalotlessvarietyofhardware, andtheycanenablefasteroffsiterecoverywithoutactuallyrequiringmany (ormaybeevenany)ofyourteammemberstoactuallygooffsite.Callit cloudrecovery,perhaps.Itsnothereyet,althoughyoucancertainlybuild yourownprivateversionofit;itllhappensomeday,though.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Backupscontaindata.Kindofthewholepoint,really.Butalotofcompaniesthesedaysare undersomeprettystrictregulationsonhowlongtheymustkeepcertaintypesofdata,and howlongtheymaykeepcertaintypesofdata.Workingthosedataretentionpoliciesinwith yourbackupsolutioncanbeawfullytricky.Inatapebased,Backup1.0world,itusually meanscyclingtapesoffsite,andkeepingthemforhoweverlongyourerequiredtokeep thedata.InaBackup2.0world,youcangetjustabitmoreflexibility. RememberthateachdiskblockbackedupinaBackup2.0stylesolutionistimestamped, andthatthebackupdatalivesprimarilyondisk,nottape.Itsthereforeveryeasytospecify minimumormaximumretentiontimesfordifferenttypesofdatathesolutionsimply makessurethateachdiskblockstaysaroundforthatlong,andremovesanythingthatsno longerneeded. ThatideagetsabitmoreexcitingwhenyourememberthataBackup2.0solutionmightuse diskblocksasitslowestformofgranularity,butthatitalsorelateseachdiskblocktothe realworlddataitrepresentslikeafile,oramessage,oradatabasetable.Figure8.7 showshowaBackup2.0solutionmightreassemblediskblocksintoanExchangemessage store,mountthatstore,andthendisplaytheindividualmailboxesandtheirmessages.By combiningthiscapabilitywitharetentionpolicy,asolutionmightallowyoutospecifythat allmessagesbekeptfor1year,ratherthanworryingaboutwhatthatmeansatadisk blocklevel.

Figure8.7:Managingindividualmessagesfromabackupstore. Obviously,dataretentioncanincreasetheamountofdiskspacethatyourbackupsolution requiresbutifitsabusinessrequirement,itssimplysomethingyouhavetoplanfor.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Nowthetricky,trickypart:Makingsureyourbackupsarecompliantwithyoursecurity policies,andwithanyexternallyimposedsecurityrequirements.Evenmanymidsize companiestodayfacetoughindustryandlegislativesecurityrequirements: Ifyoureinthemedicalindustry,youreprobablydealingwiththeHealthInsurance PortabilityandAccountabilityAct,commonlyknownasHIPAA. AnyonedealingwithfinancialserviceshastocomplywiththeGrammLeachBliley Act,orGLBA. AnypubliclytradedcompanieshavetomeettherequirementsoftheSarbanes OxleyAct,orSOX. AnycompanywhoacceptscreditcardshastodealwiththePaymentCardIndustry (PCI)DataSecurityStandard(DSS),whichisenforcedbycompanieslikeVisa, MasterCard,andAmericanExpress. FederalcontractorsofanysizeareoftensubjecttoChapter21oftheConsolidated FederalRules(21CFR)andvariousFISMArequirements.

Andthatsjust(mainly)intheUS;manyothercountrieshavesimilarrulesandlaws. Typically,theseallboildowntoafairlycommonsetoftechnicalrequirements: Yourdatahastobeprotectedagainstunauthorizeddisclosure.Thatbreaksdown intoafewpieces: o Youusuallyneedtoencryptyourdatabothondiskandintransitacross yournetwork o Youneedtobeabletoplaceaccesscontrolsonyourdata,sothatonly authorizedindividualscangettoit Youhavetoprovethatthecorrectaccesscontrolsremaininplaceonyourdata. Thatnormallymeansyouhavetocaptureanychangestoaccesscontrols,suchas filepermissions,inatamperevidentauditlog Youhavetotrackwhoactuallytouchesyourdata,whichalsomeansatamper evidentauditlog

Auditors,thefolkswhocomealongtocheckandmakesureyouredoingallthesethings, arefunpeoplewhocompletelyunderstandifyourbackedupdatadoesntcomplywith theserules.Youwish.Inreality,dataisdata;auditorsdontcarewhereitisorwhyits there,butithastofollowtheserules.

Onepopulartechniqueformakingiteasiertocomplyiscalledislanding.Figure8.8 illustrates;basically,youdesignateoneormoreserversthatwillcontainallthedatathat youhavetofollowtheruleson,andeveryplaceelseyoudontfollowtherules.See,these variouslawsonlycovercertaintypesofdata:HIPAAcovershealthcareandpatient information;PCIDSSconcernsitselfwithcreditcardholderdata.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure8.8:Creatinganislandofcompliance. Theideaisthatthelawsorotherrequirementsonlycareaboutsomekindsofdata,soyou sequesterallthatdataandjustmanagecomplianceonafewservers.Ofcourse,ifyoure caughtwithdataofinterestoutsidetheisland,youreprobablyintroubleandmightpay somefinessoitpaystobeveryclearwitheveryoneinthecompanyaboutwhatis supposedtolivewhere. Withthisislandingtechnique,youcanhaveaseparatebackupserverbecauseyour backedupdatawillhavetobecompliantjustlikelivedatais.Tomakesureyourbackup solutioncanbemadecompliant,takealookandseeifitcandothefollowing: Encryptdataondisk.Ifyoursolutioncantencryptdataondisk,thenatleastseeif itiscompatiblewithWindowsEncryptingFileSystem(EFS)orBitLocker technologies,whichcanhandletheencryptionforyou. Encryptdataonthenetwork.Thisreferstobackedupdiskblocksthatareflying fromserverstothebackupsolution,orfromthebackupsolutiontoaserverunder recovery.Again,ifthebackupsolutioncantprovidethis,youcanalwaysuse WindowsnativeIPSecurity(IPSec)featurestocreateencryptednetworkchannels betweenserversalthoughIPSecimposesadditionalprocessingoverhead. Note ItspossibletoobtainnetworkcardsthathandleIPSecencryptionin hardware,placinglittleornooverheadontheserveritself.Thesecanbe usefultohavewithinyourislandofcompliance.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Auditallaccesstodata.ABackup2.0solutionmakesiteasytogettodata,soits goingtoneedtokeepanauditlogofeveryaccesstothatdata.Unfortunately,simply loggingtotheWindowseventlogsisusuallynotsufficient,simplybecausethatlogis prettyfarfromtamperproofortamperevident;administratorscanclearthelog veryeasily,erasinganyevidenceoftheirownwrongdoing.Typically,acceptable logsareinadatabaselikeSQLServer,whichcanbeindependentlysecured, encrypted,andsoon. Note Logconsolidationsolutions,suchasMicrosoftsAuditCollectionService (MACS;partofSystemCenterOperationsManager),mayprovidean acceptablewaytoturnWindowsSecurityeventlogintoatamperproofor tamperevidentauditlog. Securethedata.Youcantsimplyallowallusers,orevenalladministrators,access tobackedupdata.Youneedawaytosecurethedatasothatonlyauthorized individualscangettoit.Insomecases,thismaymeanconfiguringabackupsolution sothatonlymembersofaSecurityAdministrationteamcanaccessbackedup data. Note Onewaytoapproachthisistocreatededicateduseraccountsthathave permissiontoaccessbackedupdata.Theseaccountswouldhavelong, complicatedpasswords,whichwouldbebrokenintotwoormorepiecesand oftenwrittendownandstoredinasafe.Thatway,twoormorepeopleare neededtoaccesstheaccount,andthustoaccessthedata,ensuringthatno onepersoncangettothedataunobserved. Auditconfigurationchanges.Becausetheconfigurationofyourbackupsystemis criticaltomaintainingcompliance,youalsoneedtoauditanychangestothat configurationandstorethosechangesinatamperproofortamperevidentlog.

Ifyourcompanyisntsubjecttoexternalsecurityrequirementorsimilarlystrictinternal securitypolicies,thenyoureinluck.Youwonthavetoworryaboutanyoftheseconcerns.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

WithallthegloriesofBackup2.0,whyintheworldwouldyoueverwanttointegrate Backup1.0?Weliveinaworldthatrequiresflexibility.Youmay,forexample,simplywant anoldschooltapebackupofyourserversonanoccasionalbasisasanextralayerof redundancythebeltandsuspendersapproach,ifyouwill.Thatmayseemparanoidto some,butIsaygoforitthemorebackups,themerrier.Nopieceofsoftwareis100% perfect,meaningwhateverbackupsolutionyoureusingevenBackup2.0style softwaremayhavesomeimperfectionthatcausesaproblemforyou.Havinganold fashionedtapebackup,madeusingdifferentsoftware,providesaPlanBandprevents youfrombeingcompletelyinthelurchifaproblemdoescomeup. TheresnothingaboutBackup2.0sdiskblockbasedtechniquethatintrinsicallyprevents youfrommakingaparallelBackup1.0style,fileandfolderbasedbackuptotape;inmany instances,thetwocanrunsimultaneously.Butnotalways.Keepinmindthatmostbackup solutionsrelyonanagentofsomekind,whichbundlesupdataandshipsitofftothe backupserver.ManyagentsrelyonWindowsVolumeShadowCopyService(VSSorVSC, dependingonwhoyoutalkto)tocopyinusefileslikeSQLServerdatabases.VSSworksby creatingatemporarysnapshotondisk,anditsthatsnapshotthattheagentgrabsforits backup.Sometimes,evenwhennotusingVSS,agentshavetomakelocalcopiesofdataso thattheycanperformcompressionorencryptionorwhatever. Localcopies.Snapshotsondisk.Yes,yourBackup1.0backupagentsarewritingfilestodisk, andyouresimultaneouslyrunningBackup2.0agentisgoingtoseethosechangeddisk blocksandtrytobackthemup.Soyourebackingupthetemporaryfilesusedtomakethe backupofthebackupwithofImlost.Figure8.9showshowchaoticthiscanbe.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

TheresnoreasonfortheBackup2.0solutiontobegrabbingtempfilesandVSSsnapshots; itsalreadybackedupthatdatawhentheoriginaldiskblockshitthediskdrive;bybacking upthesetempfiles,itsjustdoingunnecessarywork. Thatswhy,ifyouregoingtotakeanormalbackupofaservertotape,itsoftenbestto suspenddiskblockimagingonyourBackup2.0server.Ideally,youcanhavetheBackup1.0 agentwritingtoanareaofdiskthatyoucantelltheBackup2.0agenttosimplyignore;that waytheresnooverlap. Note AsIimaginethemworking,itmightnotbeenoughtosimplyshutoffa Backup2.0agent;itwouldlikelyscanforchangesitmissedassoonasyou turneditbackon.ItdependsabitonhowyourBackup1.0agentworks:Ifit cleansupitstempfiles,theywontbetheretobeseenwhenyour2.0agent comesbackonline;ifyour1.0agentleavesstufflayingaroundindisk, though,your2.0agentwillseeitandbackitupunlessyoucanexcludea certaindirectorystructureorfiletypeorsomething.

Withvirtualizationbecomingincreasinglypopular,werealsoseeinganincreaseinthe availabilityoftoolstohandlePhysicaltoVirtualmigrations,orP2Vmoves.Theresalso V2V,P2P,andV2P,ifyouwanttobepreciseinotherwords,movingaserversimageto whereveritneedstobemoved. Traditionalx2xmigrationtoolsworkprettymuchlikeanimagebasedBackup1.0solution: Theytakeasnapshotoftheserversharddrive,copyitelsewhere,andconvertitinto whatevervirtualformatorphysicalimagelayoutisneeded.Thedownsideisthattheyoften requirethesourceservertobecompletelyoffline,oratveryleastnotunderverymuchuse, sothattheycangetalltheserversfilesinaquiescentstate. ABackup2.0solution,incontrast,wouldmaketheperfectx2xmigrationtool,providedit hadsomeprovisionsforrestoringserverimagestodissimilarhardware(somethingI identifiedasusefulinthedisasterrecoverysectionofthischapter,also).ABackup2.0 solutioncouldeasilybackupeitheraphysicalorvirtualserver,andcandosowhileits running,grabbingchangesastheyhappenalmostinrealtime.Themigrationpartcomes whenyourestoretheserver,againeithertoaphysicalorvirtualmachine.Becausemanyof themajorvirtualizationvendorshavemadetheirvirtualdiskimageformatspublic,a Backup2.0solutioncouldevenproduceacompletevirtualmachineimagethatsreadyto beloadedontoahypervisorandstartedupacapabilityIvementionedseveraltimesin thischapter. Havingabackupsolutionthatcandodoubledutyasamigrationsolutionparticularlya migrationsolutionthatcandoondemandproductionofphysicalorvirtualimagesisa veryusefulbitofflexibility.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

WeveexploredBackup2.0inalmosteverydetailexceptforsomeoperationalrealities. AssumingyouobtainasolutionthatimplementsthetechniquesandtechnologiesIve discussedinthisandpreviouschaptershowdoyougoaboutactuallymanagingthat solutiononadailybasis? Inthenextchapter,Illlookatoneofthemostimportantaspectsofanybackup infrastructure:storagearchitecture.Asyoumightimagine,weregoingtodiscardthe notionthatmagnetictapesarethebeall,endallofbackupstorage,andlookatBackup Storage2.0,whichwillinvolvedisks,SANs,andyes,tapesaswell.Illalsoexplainhowsome newtechnologieslikededuplicationcombinewithsomeoldertechniqueslike compressiontochangethereasonsbehindmanyofourstoragechoices.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Chapter9:KeepingYourBackupsStorage Architecture
Storagehaslongbeenadifficultcompanionforbackups.Thefirstbackupswerestacksof punchedcards,althoughmagnetictapequicklycameontothescenetostoremoredataand permitsomewhatfasterrecovery.Eversince,wevestruggledwithwheretoputour backups.Buyinganewterabytefileserverinevitablymeantbuyinganotherterabyteof backupcapacity;somecompaniesusedandstillusefilefilteringtechnologiestoreduce theamountofdataontheirfileservers,primarilytohelpcontroltheamountofdatathat hastobebackedup. Thatstheuglythingthathappenswhentechnologyanditslimitationsstarttodrivethe businessratherthanthebusinessdrivingthetechnology.Sure,keepingerrantMP3filesoff yourfileserversmightbeagoodideaforanynumberofreasons,butingeneralshouldnt usersbeabletoputanybusinessrelateddataontoafileserverwithoutworryingthatit mightnotbebackedup?Isntallourbusinessdataworthbackingup? ThisiswherestoragecomesintotheBackup2.0picture.Forallthegreatthingsthat Backup2.0candointermsofbackingupourdataandallowingfastandflexiblerestore operations,itsuselessifitneedsmorespacethanwecangiveit.

Letsconsiderbackupstorageinthe1.0world,whichtraditionallyinvolvedmagnetictape. Today,evenBackup1.0solutionsareabitmoreflexible,allowingmultipleformsofstorage andevenahierarchyofstorage.Isthe1.0conceptofbackupstoragesuitablefora2.0 world?

InaBackup1.0world,backedupdatareflectstheintrinsicnatureofthebackupitself.In otherwords,thinksnapshots.Atypicalbackupfileconsistsofasinglefile,orperhapsa collectionofrelatedfiles,thatcontaindatastreamedfromasource.Figure9.1illustrates thisprocesswhichyouprobablywatchhappensooftenthatyouvestoppedthinking aboutit.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure9.1:Traditionalbackupprocess. Sotherearereallytwoproblemshere:First,werebackingupdataasitexistsataspecific pointintimemakingasnapshot,inotherwords,whichistheintrinsicproblemwith Backup1.0.Theotherproblemrelatestohowwerestoringthedata:Wereessentially dumpingeverythingintoonelogicalstructure.Eventhoughthatmaybesplitacross multiplephysicalfiles,itsasingle,usuallyflat,logicalentity.Theresareasonforthat,and itscalledmagnetictape.Magnetictapeisasequentialaccessstoragedevice;itdoesnt supportrandomaccessthewayaharddiskdoes.Becausemostbackupsarewrittento tape,itmakessensetostoretheminasinglestructurethatcanbesequentiallywrittento, andreadfrom,magnetictape.Andtheproblemwithsequentialaccessandmagnetic tapeisthatitsincrediblyslowcomparedwithrandomaccess.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

WhenIsSequentialAccessFast? Oneareawhereyouregularlyusesequentialaccessandgetreallyfastaccess speedsiswithopticalmediaCDROMs,DVDROMs,andsoforth.Those discsarewrittenmuchlikeanoldvinylrecord,withasingletrack,andthe laserhastofollowthatsinglepathsequentiallytogettowhateverdatayou want.Thereasonitssofastissimplythatthediscisspinningreally,really fast(around1600RPMforaDVD)sothelasercanmovefromthe outermostareaofthedisctotheinnermostinaflash. Tape,unfortunately,doesntsupportthatkindofspeed.Althoughmodern tapedrivescanwindandunwindtapeawfullyrapidly,theystillcantdoso fastenoughtosimulaterandomaccessthewayaDVDROMcan.Thetapeis moredelicatethanaDVDdisc,andtheresusuallyalotmoreofit,sincetapes havetostoremanygigabytes(600GBisntunusual,and1600GBis consideredstateoftheartrightnow)ofdata,whileaDVDonlystoresupto 8GBorso(evenaBluRaydisconlystoresabout50to60GB). ModernBackup1.0solutionstypicallykeepadditionalsupportingfiles,indexesofasort, thathelpthemquicklylocateagivenbitofdatawithinthatmonolithicbackupfile structure.Thus,whenthebackupfileislocatedonrandomaccessstorage,abackup solutioncantypicallydiveinandfindagivenmailboxmessage,orwhatever,prettyquickly. Theproblemisthatmostofusdontstoreourbackupfilesonrandomaccessstorage.In fact,inmanycases,thatbackupfileisbeingwrittendirectlytotape,whereitwillalwaysbe fairlyslowtoretrieve.

Thatisultimatelythedownsideoftapebasedstorage:theirspeed.Capacitycanbean issue,too,butthatsaquestionofspendingmoremoney:16petabyte(PB)tapelibraries arewidelyavailable.Tapedrivesaretypicallymeasuredinhowmuchdatatheycanmove inanhour,andevenatthehighendofthecurrenttechnologyaround450GB/hour thatsasnailspace,especiallywhensomeonesanxiouslywaitingforafile,orwhenthe bossistappinghisfootwaitingforyoutobringafailedserverbackonline.Keepinmind thathourisntthecompleterecoverytime:Oncethefilesarepulledofftape,youstillhave tohaveabackupsolutiongothroughthefileandlookfortheexactbitsofdatayouneed, andwritethembacktotheservertheycamefrom(ortoanalternativelocation).Heck, evenfindingtherighttapeespeciallyifitsoffsitecantakealongtime. Youhavetousesomecaution,too:Tapedrivespeedsareusuallymeasuredincompressed data.Soa430GB/hourtapedriveisntreallymoving430GB/hourofrawdata,itsmoving thatmuchdataaftercompression.Sothedatawillstillneedtobeuncompressedbeforeit canbeused.Capacitieslike1600GB(1.6TB)areoftenexpressedwithcompression assumed,andtypicallya50%compressionratioisassumed.Thatmeansnativecapacities maybesomethinglike800GB,andthe1.6TBnumberassumesyoureachieving50% compression,whichmeansona430GB/hourdrive,youdbemoving215GB/hourofraw data.Itsfunmath.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Somecompaniesgetfrustratedenoughwiththesespeedsandcapacitiesthattheycreatea sortofhierarchicalstorageplan:Backupserverswritetheirfilestolocalharddiskspace, thenstreamthatbackupfiletotapeafterthebackupiscomplete.Diskscanmovedataalot fasterthanatapedrive(think6Gbpsfordisksversussomethinglike.5Gbpsfortape makingdisksatleasttwelvetimesfaster,nottomentioncapableofrandomaccess).An advantageofthisapproachisthatthelatestbackupfileoreventhelatestfewbackup files,ifyouhavethediskspacearehandyonfasterdiskbasedstorageifyouneedthem. Ofcourse,ifyouneedsomethingolder,yourestillbacktotape.

Itsnotunusual,intheBackup1.0world,toseeadministratorsconsideringpurelydisk basedstoragesolutions.A1TBSATAdiskdriveisfarcheaperthana146GBtapedrive.Its alsofarfaster.Whynotjustrelyexclusivelyondisktodiskbackup? Tworeasons:Disksaremorefragilethantape,anddisksarelessportablethantape.Disk drivesdontdowellwithshockwhenbeingtransported;tapedoesntcare.Disksaremore susceptibletomagneticfieldsthantapes.Diskscanonlysurviveinanarrowertemperature rangecomparedwithatape.Foraneffectivebackupplan,youneedtomovecopiesoffsite, andtaperemainsthebestwaytodothat. ThatswhytheBackup1.0worldoftensettlesfordiskandtape,asFigure9.2shows.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Thisapproachgivesyoufastaccesstorecentbackupfiles,andtheabilitytoeasilyand safelycarrycopiesofthosebackupsoffsiteforsafekeeping.Infact,thistiered,or hierarchicalbackupstorageapproachhasbeeneffectiveinsolvingsomeofthetraditional problemswithBackup1.0,suchasrecoveryspeed.Itsstillconstrainedbytheinherent snapshotbasednatureofBackup1.0,butthiskindofstorageapproachmayserveuswell forBackup2.0.

Rethink.Iusethatworddeliberatelybecause,likebackupsthemselves,weintheITworld havebeendoingthingsthesamewayforalongtimeoutofsheerinertia.Letsstart,infact, byrestatingourmissionforBackup2.0: Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible. Thatsgoingtodriveafewprioritiesforbackupstorage.Weneedtokeepourbackups: Onfast,randomaccessstorage,becauseonlythatofferstheaslittledowntimeas possiblecriteriathatwerelookingfor. Offsite,aswell,becausefastrandomaccessstorageisnt100%reliable. Potentiallyforalongtime,sincewemayneedtorollbacktoafairlyoldpointin time,orretrievedatafromanoldpointintime.

Letsnotusewordslikediskandtaperightnow;letsfocuslessonthetechnologyfora momentandfocusinsteadoncapability.Sure,tapemightbeonewaytogetourdataoff sitebuttheremightalsobeotherways,soletsexplorethose.Disksaregreatrandom accessstoragedevices,butletsfocusonthatrequirementfast,randomaccessstorage overtheimplementationorthemedium.

InaBackup2.0world,wereconstantlycollectingchangeddiskblocksfrommultiple differentcomputers.Weneedtostoreeachdiskblock,alongwithanidentifierofwhereit camefrom,andthetimestampofwhenwecollectedit.Butwecantlosesightofthefact thatwewanttobeabletoretrieveallthediskblocksassociatedwithaparticularmachine, uptoaparticulartimestamp,ondemand.Inotherwords,stickingallthisdataintoatape centricsequentialfilestructureisntgoingtoserveourneedsverywell.Itsmorelikelythat thesediskblockswillneedtogointosomekindofdatabaseFigure9.3illustrateswhat Imtalkingabout.Letsnotworryforthemomentabouthowwellstorethatdatabase althoughdiskstorageisasafebetbutfocusinsteadonthecapabilitiesthisdatabasegives us.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure9.3:Creatingabackup2.0backupdatabase. Thistypeofstructureallowsanygivendiskblockchangetoberecalledveryquickly,and allowsalltheblocksforanentiremachineuptoacertainpointintimetoberetrievedvery quickly.Thistypeofapproachhasasingledownside:Ithasthepotentialtotakeupgobsof diskspace.Thisis,infact,whereBackup2.0goesfrombeinggreatonpapertopossibly beingnotsogreatinpractice:Ifyouaddupthetotaldiskspaceinvolvedineverydiskblock changeacrossallyourserverscanyoucomeupwithenoughspacetostoreallofthat? Whataboutgettingitoffsiteforsafety?Whataboutkeepingalotofitforalongperiodof time?Giventhesheeramountofdatainvolved,canBackup2.0meetourthreeobjectives forbackupstorage? Fast,randomaccessstorage Offsitestorage Longarchivalperiod

Wellhavetosee.Thisiswhereweneedtostartreallylookingatthestoragetechnology ortechnologiesthatthisisgoingtouse.

Letsgetbacktophysicalstoragemedia,andletsbehonestwitheachother.Thereareonly twopracticalkindsofmassstoragedevicesavailabletoustoday:diskandtape.Were goingtohavetofindawaytomakethemwork,becauseitsallwevegot.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Butdisksinparticularcomeinawidevarietyofimplementations:Relativelycheaplocal storageinsideaserver(orinanattachedstorageexpansioncabinetofsomekind), inexpensivenetworkattachedstorage(NAS)appliances,andsomewhatmoreexpensive storageareanetworks(SANs).AlloftheseofferRAIDcapabilitiestohelpprotectusinthe eventoneortwodrivescrashonus,andallofthesearewellunderstood,robust,mature technologies.iSCSIinparticularismakingNASandSANstoragelessexpensive,better performing,moreflexible,andsoon. Tapeswell,tapesaretapes.Mostbusinesseshaveautoloadersortapelibrariesthatcan automaticallychurnthroughseveraltapestostoretonsandtonsofdata,andsometape librariesareevendirectlyconnectedtoanetwork(althoughitsstillcommontohavea tapedriveorlibraryhangingoffthebackofadedicatedserverortapelibrarycontrollerof somekind). Youcanstartdraggingcloudsintotheconversationbecausecloudstorageisbecoming fashionable,butitsjustmoreharddrivesandtapeslocatedsomewhereelse;itisntreallya differentkindofstorage. Whatreallymattersisspeed,cost,andlocation.Remember,wehavethreerequirements forourbackupstorage: Fast,randomaccessstorage Offsitestorage Longarchivalperiod

Thefirstrequirementaddressesspeed.Thesecondaddresseslocation.Thethirdimpacts costthemost(afterall,ifwewerehappyonlybeingabletorecovertolastnight,we wouldntneedtostoreverymuchbackupdata,andsothepotentialcostofourBackup2.0 solutionwouldntbeveryhigh). AswithBackup1.0,theanswerisgoingtobeamixofbackuptechnologies.But,aswedid withBackup1.0inthefirstplace,weneedtorethinkwhatahierarchicalbackupstorage setupmightlooklikeandweneedtoconsiderallourmodernoptions.

LetsstartbyacceptingthefactthatourBackup2.0solutionisgoingtobebackingupdata todisk.Thatsgoingtogetusourfast,randomaccessstorage.Wecandecidehowmuchwe wanttospendondiskspace,andthatllconstrainhowlongofanarchivewecanmaintain infast,randomaccessstorage.Figure9.4showstheinitialphaseofourstorage architecture.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure9.4:Initialstoragearchitecture. Wehavefourserversthatwewanttobackup,andacentralbackupserveralongwith somediskstorageisholdingitall.Again,ourabilitytoprovidemorediskspaceisthe onlylimitationonhowmuchdatawecanstoreonsite,meaningthemorediskspacewe canthrowattheproblem,thelongerwecankeepbackupsonsite,andthefurtherinthe pastwecandivewhenweneedtorecoversomething. Backup<>Archive Dontthinkofyourbackupsystemasanarchive.Inotherwords,ifthereare specificpiecesofdataquarterlyfinancials,lastyearstaxes,personnel records,andsoonthatyouneedtopermanentlyarchive(orevenarchive foranumberofyears),yourbackupsolutionisnttheplacetodoit.Those archivesshouldbesomeplaceelseoftenontape,whichisprettydurable anddoesntconsumepowerwhenitisntbeingused.Youmightburnfilesto opticalmedia,whichisequallydurableandlowpower.Butjustbecauseyou needtokeepcustomerrecordsfor,say,10years,doesntmeanyourbackup systemneedstobecapableofstoring10yearsofdata. Mygeneralruleisthis:IfigureouthowfarinthepastIcangoinabackup systemuntilIstartrunningintodataIwouldnever,everrestore.Thatsall thedatamybackupstoragesystemsneedtohold.Inmanycases,Ifindthat tobeamonthortwo,possiblyevenaslongasaquarter,butanythingfurther backtendstobecompletelyuseless,sotheresnoneedtobackitup.Archive it,perhaps,butitdoesntneedtoliveonthelivebackupsystem.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Yourservicelevelagreements(SLAs)withyourusersplayanimportantrole here.Wecanretrieveanythingupto3monthsold,andwecandoitinan hourorso,isagoodSLA.Anythingolderthanthat,wecansearchthe quarterlyarchivesforbutthatmaytakeafewdays,becausewehaveto bringtheminfromoffsite,andtheresacostassociatedwithdoingso. ThatsagoodnextstepinanSLA:Establishingwhatcanbedone,andwhatit willcost,andhowlongitwilltake. Ournextstepistogetacopyofourbackupsoffsite.Notforlongtermstoragebutbecause wewanttobecoveredintheeventthatourdatacentercontainingourbackupserver burnsdownorsomethingawful.Wewanttogetacopyofourbackupdataoffsitefairly frequently,butwedontneedtokeepcopiesoffsiteformorethanouronsitebackupdata retentionperiodsay,3monthsorso. Onewaytodosois,ofcourse,tape,asFigure9.5shows.

Figure9.5:Movingdatatotape. AsIveacknowledged,tapeisagreatwayforgettingdataoffsiteinbulk.ThetrickisthatI dontneedmytapestobeanarchiveImjustusingthemtocovermyselfintheeventofa backupserverdiskfailure.SoifImonlykeeping3monthsofdata(inmyexample)inthe backupserver,thenmytapesonlyneedtobegoodforabout3months.Tapesdorepresent asnapshotofmybackupserversdata,soifIdolosemybackupserver,thenImatriskfor losingdatabecauseIvelostwhateverbackupsoccurredbetweenthelasttapebackupand thebackupserverfailure. Anotheroption,then,istomigratedatatothecloudtoachievemyoffsiteprotection. Figure9.6showswhatthismightlooklike.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure9.6:Movingdataintothecloud. Thisaccomplishesthegoalofgettingthedataoffsite,anditisntasimpracticalasitmay soundatfirst.Tobeginwith,cloudbasedstorageisgettingcheaperallthetime:Compareit withthecostofmakingtapebackupsandstoringthemoffsite,andyoumightfindthatthe twotechniquesarentworldsapartintermsofprice.Solutionsalreadyexisttomovedata offsiteinnearrealtime,usingadvancedcompressionandbandwidththrottling techniquesthathelpconserveWANbandwidth.Thistypeofbackupwouldbemoreupto datethanatapebackup,solessdataisatriskmeaningtheremightbejustificationfor somewhathigherpricingthantraditionaltapes.Thereareevensolutionprovidersout therewhocantakeyourbackedupdiskimagesandmovethemtotheirownvirtual machinehostserversalsolocatedinthecloud.Thatcanprovideanexceptionallyquick recoverytime,ifthatssomethingyoufeelyoullneedforyourbusiness. Youcouldalsoconstructyourownprivatecloud,replicatingbackupcontentfrom multiplebackupserverstoyourownbackupofthebackupserverperhapslocatedina differentoffice.Figure9.7illustratesthisidea.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure9.7:Privatecloudbackup. ThebackupreplicawouldactuallybeusingBackup2.0techniquestobackupthefrontline backupservers,meaningverylittledatawouldbeatriskatanygiventime.Ifaserverfails, itsbackupservercanrecoverit;ifabackupserverfails,thecentralbackupreplicacould recoverit.Yourcostsgoup,butyourabilitytosurvivemultipledisastersalsoincreases,so youregettingsomethingforthemoney. Havinganoffsitereplicacangreatlyimproveyoursituationintheeventofatotallocation failure,suchasaflood,fire,lossofutilitypower,meteorstrike,andsoon.Thebackup replicacanbeusedtorapidlyreconstructallyourlostservers,perhapsasvirtual machines,inanotherlocation.Rapidlyisthekey,there:Youwontbespinningdataoffofa dozentapesforhoursandhours,youllbeimmediatelybuildingvirtualmachinedisk imagesandgettingthemrunningonavirtualmachinehostperhapsevenoneyouve leasedforthisparticulardisaster. Thebackupreplicacouldalsoserveasasourceforarchivalactivities.UsingBackup2.0 techniques,thebackupreplicaitselfwouldbeabletomountdiskimages,meaningyou couldgrabfiles,folders,databases,andwhathaveyouandcopythemtotapetocreatea permanentarchiveofwhateverdatayourbusinesshasthatneedstobepermanently archived.Figure9.8illustratesthisaddition. 158

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure9.8:Addingtapearchivaltothemix. Again,thepurposeofthesetapesistopermanentlyarchivefilesthatneedtoberetained beyondyourfastrestorecapabilities.Typically,archivedfilesdontneedtobeaccessed veryoften,andwhentheydoneedtobeaccessed,itsforreferenceorreadonly purposes.Opticaldiscsmightalsobesuitableasanarchivalmedium,andyoucouldstore copiesonsiteaswellasoffsite,ifdesired.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Thepointofallthisisthatyoucanachievewhateverbusinessneedsyouhave.Thekeysare toclearlydifferentiatedifferentneeds: Usefastdiskstoragetocreateafastrecoverycapability.Establishareasonable periodoftimethatyoullretaininfastrecovery,ortier1storage. Getthatdataoffsitequicklyandfrequently.Ideally,getitoffsitetoanotherfast recoverysolution.Lessideally,getitoffsiteinsnapshotformlikelyontape. Periodicallymigratefilestoslower,tier2storageforlongtermarchivalpurposes. Again,archivefilesarentneededintheeventofafailure,theyreneededasalong termorpermanentreference.Archivingisntpartofyourbackupstorage architecture,althoughyourbackupsmaybeastartingpointforcreatingarchive copies.Youdontchoosetoretaintapecopiesfor5yearsbecauseyouthinkyoull needtorecoverthosefilesandbeginmakingchangestothem;youdosobecause someonemightneedtorefertothosefilesatsomedistantpointinthefuture. Backup<>Archive,Redux Abackup,forme,issomethingyoukeepbecauseyoumightwanttoreturn yourproductionenvironment(orabitofit)tothepointintimethatthe backuprepresents.Youmaywanttorecoveranaccidentallydeletedfile,for example,oryoumightwanttorestoreafailedserver,oryoumaywantto recoveracrasheddatabase.Backupsareforwhenthingsgowrong. Archivesarethingsyoukeepbecausethedatainthemhasinherentvalue. Youllneverwanttomakeittheworkingcopyagain,butyoumighthave needtorefertoit.Archivesarentusedbecausesomethingwentwrong,but becauseyouneedtolookatsomethingupfromthepast. WhenIrunacrosscompanieswhosavebackuptapesforayear(ormore),I diealittlebitinside.Doesanyoneseriouslycontemplaterollingbackthe productionenvironmenttoayearago?No,theydonot.Whattheyvedoneis createdanarchiveoutofabackupandlikely,thatarchivecontainsdata theywillneverneedtoreferto,likecopiesofoperatingsystem(OS)or applicationfiles. OnereasonImtoldthatdiskstorageisntsuitableforbackupstorageis becauseitstooexpensivetokeepenoughdatafarenoughintothepast.My problemwiththatisthatyoushouldntbekeepingbackupsforthatfarinto thepastatsomepoint,thebackuphasnovalueasalive,production system,anditsturnedintoanarchive.Whenitdoesso,itshouldbetrimmed downtothedatayoullactuallyneedtoreferto,andwrittentosecondor thirdtierstorage. Carefullyconsideryourbusinessspecificneedswithregardstobothbackupsandarchives. Thatllhelpyouproperlyplanfortherightamountofdiskspace,storagetiers,offsite storage,andsoon.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Ofcourse,diskspaceisstillnotfree,andsothelessofitwehavetouseforourbackups,the better.ThatswhyaBackup2.0solutionshouldalsoincludetwomajorfeatures compressionanddeduplicationtoreducediskcostsasmuchaspossible.Lessdiskusage onthebackupservermeanslessstorageusedateverysuccessivetierwhetheryoure movingdataoffsiteontapes,toacloudprovider,ortoanoffsiteprivatecloud.

Deduplicationisahotnewtopicintheworldofstoragemanagement,andtheresno reasonBackup2.0shouldntbeonthatbandwagon.Theideaissimple:Ratherthanstoring multiplecopiesoftheexactsamedata,yourstoreitonce,alongwithsomenotesaboutall theidenticalcopiesthatwouldnormallyexist. Youwouldprobablybeappalledattheamountofduplicatedataonyourservers.EveryOS file,forexample,isduplicatedacrosseachservernoneedtostorethemallindependently whenonecopywilldo.Sometimes,theOSwillwriteablockofdatawiththesameactual contentsaswerealreadyondisknoneedtostorethatdiskblockasachangebecause theresalreadyacopyofthesamedatainstorage. Withoutdeduplication,ourbackupstoragedatabasecouldlooksomethinglikeFigure9.9, withmultipleblocksofduplicateddatabothbetweenserversandevenwithinthesame servers.

Figure9.9:Duplicateddatainthebackupstoragedatabase. Deduplicationsavesusroom,byeliminatingtheduplicateddataandjustkeepingtrackof wherethemastercopyofthatdatalives.Figure9.10showswhatthatmightlooklike.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure9.10:Deduplicateddatainthedatabase. Theideaisthatthepointertotheactualcopyofthedataoccupieslessspacethanthedata itself,sotheresanetsavings. Therearenumeroustechniquesfordeduplicatingdata.Atahighlevel,withabackup solution,youcouldsimplylookatdiskblocks,whichareusuallyrelativelysmall.With largerdiskblocks,suchasan8KBblock,youmightuseatechniquecalledchunking,where youbreakdowneachblockintoasmallerchunksay,1KBchunks.Itllbeeasiertofind duplicationatthatlevel,meaningyoucansavespaceincrementally. Thetradeoffrelatestothepointersize.Ifduplicateddatawillbereplacedwitha12byte pointer,theresnosenseinlookingforduplicationatthe12byteorsmallerlevelbecause anyspaceyousavedwouldbecompletelyoffsetbythepointeryouhadtocreate. Note Inbackupsolutions,therearetwokindsofdeduplication,whichIllcall SourceandTarget.InSourcededuplication,thebackupsolutionwillde duplicatedatafromaparticularsource,likeaserver,butitwillallow duplicatedatatoexistbetweensourceslikebetweentwoservers.Youcan savemorespacewithTargetdeduplication,whichdeduplicatesalldata regardlessofwhereitcamefrom. Youwanttolookforasolutionthatoperatesatthesmallestpracticalchunksize,which maybethesizeofatypicaldiskblock.Somesystemsmayonlydeduplicateentirefiles, meaningyouremuchlesslikelytofindasmanyduplicatesandsavespace.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Compressionis,ofcourse,alongusedtechniqueforreducingstoragerequirements,and Backup2.0shouldmakegooduseofit.Infact,agoodsolutionwillactuallysupportmany compressiontechniques,asdifferenttechniquesworkbestacrossdifferentkindsofdata. Allcompressioninabackupsystemislossless,whichmeanstheoriginaldatacanbe completelyreconstructedupondecompression.Infact,compressionalgorithmsarereally justaveryadvancedformofdatadeduplication,functioningacrosssmallerandlargerdata setsandacrosspatternsaswellaspurelyduplicateddata.Forexample,supposeadisk blockcontainedthisdata,expressedinhexadecimal: 1730000AE4627DBCBCBCBCBCBC733475475475475 Acompressionalgorithmmightreducethatto: 173(0x4)AE4627D(6xBC)733(4x475) Theideaistotakerepetitionsoveracertainlengthandreplacethemwithsometokenthat allowsthepatterntoberecreatedduringdecompression.Shorterpatternsmightnotbe replacedatall,ifthereplacementtokenwouldbelargeroreventhesamesizeasthe patternbeingreplaced. Thenatureofdataitselfisusedbyothercompressionalgorithms.Forexample,asimple textdocument,storedasaplaintextfile,typicallyusesaverylimitedcharacterset.These characterscanbeexpressedin4bits,anddonotneedanentire8bitbyteyettheyare storedinfullbytesondisk.Sixcharactersmightlooklikethis: 00000110 00001000 00001101 00000110 Theupper4bitsofeachbyteareessentiallywasted;acompressionalgorithmcanbyte packthese4bytesinto2bytes,fora50%reductioninspace.Thissimplyinvolvescopying thelower4bitsofonebyteintotheupper4bitsofthepreviousbyte: 10000110 01101101 Solongasthedecompressionalgorithmknowshowtoreversethisprocess,itworks perfectly.Ofcourse,thisdoesntworkwithmorecomplexdata,illustratingtheneedfora compressionsystemtosupportmanydifferentkindsofalgorithms.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Commonlosslessalgorithmsinclude: Runlengthencoding(RLE) LZW(andvariantsLZ77andLZ78),whicharedictionarycoders DynamicMarkovCompression(DMC) Variousformsofentropyencoding Resource Ifyoureinterested,youcanreadaboutthespecificsoftheseandotherforms ofcompression nisagoodplacetostart,asitprovidesanindextosomeofthemore commonlyencounteredalgorithms. Betweencompressionanddeduplication,abackupstoragesystemcansavealotofspace. Itsrelativelystraightforwardforcompressionalgorithmstoachieve50%compression (whichiswhysomanytapebackupdevicemanufacturersassumethatrateofcompression intheirstatistics);deduplicationcaneasilyachieveanadditional20to30%reductionin space,meaningyourbackupstoragecanuseasmuchas80%lessspacethanthedataitis backingupactuallyconsumesinproduction.

Thelastconcern,ofcourse,isbeingabletouseyourbackedupdata,andthestorage architectureobviouslyplaysanimportantrole.InaBackup2.0solution,usingthedata meansbeingabletoreassemblethediskblocksforanentireserverharddrive,orjusta portionofit,quickly.Ideally,youshouldbeabletopushthoseblocksbacktotheiroriginal location,ortoanalternativelocation(suchasavirtualmachine)forrecoverypurposes. Youmightalsowanttheabilitytomountthoseblocksasaworkingdiskimagesothatyou canbrowseitandretrievedatafromitwithouthavingtopushtheblockstoarealserver. Lookforasolutionthatwillgiveyouflexibilityinhowyouaccessandutilizeyourbacked updata.

AlotofmydiscussiononBackup2.0thusfarhasfocusedonbackupandrestore:Making sureyoucanretrieveasinglefile,orasinglemailbox,orasingleotherpieceofdatawhen youneedto.Alongtheway,Ivemadementionofdisasterrecoverywhichiswhatyoull bedoingwhenanentireserver,oranentiredatacenter,crashesbutinthenextchapter, Imgoingtofocusexclusivelyonthatimportanttopic.Disasterrecoveryisadistinctsetof concernsfromnormalbackupandrestore,anditsanotherareawherewellreallyhaveto examineourassumptions,carefullyreconsiderouractualbusinessobjectives,andseewhat a2.0approachcanoffer.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Chapter10:WhenEverythingFails:Whats YourDisasterRecoveryPlan?
Muchofthisbookhasfocusedonbackupandrestoreratherthandisasterrecovery.The difference?Iregardrestoringassomethingyoudowithasinglefile,oragroupoffiles,or asingleemailmessage,oranentiremailboxsomethinglessthananentireserver.It mightbeadisasterthatafilewasaccidentallydeleted,butitstypicallyadisasterforone ortwopeoplenottheentirebusiness.Atruedisaster,inmyview,iswhenanentire servergoesdownorworse,whenanentiredatacenterisaffected. Thereasonmuchofthisbookhasfocusedonrestoresisthat,frankly,itswhatwespend moretimedoing.Itsnotallthatcommonforanentireservertofail,orforanentiredata centertoencounteradisaster.Itdefinitelyhappens,butwhathappensalotmoreis someoneneedingyoutopullasinglefileormailboxfrombackups. Inthischapter,however,Imgoingtofocusentirelyondisasterrecovery.Disastersdo happenfloods,hurricanes,powersurges,andsoforthcantakeoutentireserversoreven entiredatacenters.Onetime,Ihadtodealwithacompleteweeklongpoweroutagewhen someonerantheirpickuptruckintothetransformeronthecornerofouroffices propertytalkaboutadisaster.Infact,Illusethatstoryasakindofrunningexampleof whereBackup1.0reallyletmedown. WeregoingtostickwithourBackup2.0manifestobecauseitsjustasapplicableto disasterrecoveryasitistoasinglefilerecovery: Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible.

Youhavetoplanfordisasterrecovery.ItsbecomesocommonplaceforusITfolkstotalk aboutthecompanysdisasterrecoveryplanthatweoftenforgetthatalotofplanningis involved.Infact,areallylargenumberofbusinessleveldecisionshavetogointotheplan beforewetechnologistscanevenbeginourendoftheplanning.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Primarily,yourbusinessleadersneedtodecidehowmuchofadisastertheywanttobe abletosurvive.Herearesomeexamplesofcompletelydifferentscenarios: Aserverfailsbecauseofahardwareissueorcatastrophicsoftwareissue.Thisisnt theendoftheworld,obviously,butdependingontheserver,itcanbeprettybadfor business. Youloseutilitypowerforashortperiodoftime.Simplyhavingalotofbatteriesora backupgeneratormightbeagoodwaytomitigatethiskindofdisaster. Youloseutilitypowerforlongerthanyoucanpracticallymitigateusingbatteriesor agenerator.Thisusuallymeansyourelookingatbringingatleastsomeofyour applicationsbackonlineoffsite. Anaturalormanmadedisasterfire,flood,tornado,hurricane,orsomething elsestrikes,renderingyourdatacenteruseless.Again,youreprobablylookingat anoffsiterecoverytosurvivethis.

Thereasonyourbusinessleadersneedtoconsidertheseisbecausesomeofthesolutions canbeprettyexpensive.Theyllneedyourhelpinfiguringouthowexpensive,sothatthey candecideifitsworthittohavearecoveryplaninplaceforanygivenscenario. Youllalsoneedtorateyourdatacentersservices.Whatcanyoureallydowithoutinthe eventofafailure?Willeveryoneneedtoaccessresources,orwillthecompanyberunning onaskeletoncrew?Itsobviouslycheaperandeasiertoplanforextremedisasterscenarios thatinvolverestoringahandfulofservers,asopposedtoscenariosthatwillrequireyour entiredatacentertosomehowbereplicatedoffsite. Thesekindsofdecisionsalsochangedrasticallybetweencompaniesofdifferentsizes.If youworkforalarge,globallydistributedcompany,thenyoualreadyhaveoffsitedata centers;youjustneedtofigureouthowtoensurethatonedatacentercantakeoverfor anotherintheeventofadisaster.Smallercompaniesthatoperateoutofasinglelocation, however,cantgetoffsiterecoverywithoutpayingadditionalforitandthatcanbe expensive,dependingonhowyouchoosetodoit.Inastrangeway,itseemsthatifyou spendenoughonITlikehavinggeographicallydistributeddatacentersinvarious locationsdisasterrecoverycanactuallybecomealotcheaper.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

ThecompanyIllbeusingasmyBackup1.0casestudywasaretailer,with asingleheadquartersanddistributioncenterinthemidAtlanticregion. Wehadasingledatacenter,whichhousedeverysingleITassetwe ownedrightdowntotheofficephonesystem.Ourstoreswere,of course,independentandcouldoperateforsometimeifthehomeoffice datacenterwasoffline,butwithoutthatdatacenterwewouldntknow whatproductsstoreshadsold,andcouldntpracticallygenerate restockingshipments.Ourexecutiveswantedtobeabletosurvive anythinguptoandincludingacompletelossofthedatacenter,andso wecontractedwithanoffsiterecoveryfacility.Thebasicdealwas,when wecalled,theydhaveacertainsetofhardwarereadyforus,alongwith telecommunicationsservices.Wedhavetotakeitfromthere.

IntheBackup1.0world,wehadtwowaysofdealingwithafailedserver:Rebuildit,or recoverit. Rebuildingisahorriblethingtohavetodo,andIdontknowofanyadministratorwho looksforwardtoit.Youretalkingaboutstartingfromscratch:Installinganoperating system,installingapplications,andsoon.Presumablyyoucanrestoreapplicationdata frombackups,oryouvebasicallylosteverything.Veryfewcompaniesmaintaindetailed enoughdocumentationonserverconfigurationstoensureacompletelythorough,accurate rebuild,whichmeanstherearealwaysafewconfigurationitemsthatgetmissed.Ionce hadtorebuildanExchangeServercomputerthisway,andfortwoweeksafterwardnoneof ourremoteuserscouldaccessthecomputer.Wefinallyrealizedthatwedforgottentore configuretheservertousethenondefaultportnumbersthatourfirewallwasallowing through(whichis,bytheway,abigargumentinfavorofstickingwiththedefaultslessto worryaboutifyoudohavetorebuildfromscratch). Rebuildingtakeshours,ifnotdays,anditlocksdownsomeofyourmostskilledhuman resourcesforthatentireperiod.Becauseyoureusuallyrebuildingasfastaspossible,and underagooddealofstress,yourealotmorelikelytomakemistakesandmesssomething up,too. Youalsoneedsomeplacetorebuild.Intheeventofaserverhardwarefailure,thatmay meaneitheranewpieceofhardwareyoudidhaveacompleteserverjustsittingaround waiting,right?oravirtualmachine,assumingyouhaveavirtualizationinfrastructure, andavirtualizationhostwithavailablecapacity.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

TheretailerIworkedwithactuallydidmaintaincoldspareservers, meaningwehadtwoorthreeserverssittinginclosets,waitingtobeused incaseaproductionserverupanddied.Wetriedtominimizethe numberofservermodelsinourdatacenterwhichfranklyreducedour flexibilityagooddealsothatwecouldminimizethenumberofspares wedneedtokeep.Thiswasafewyearsago,andvirtualizationwasnt reallyanoption.Wedidhavemaintenancecontractsonallourserver hardware,butforafewspecificserverswecouldntreallyaffordany downtime,sohavingthesparewasawaytocutthatdowntimebyas muchaspossible.Itwasalsoexpensive,andwehadtohavemaintenance contractsonthespares,too.Wewerepayingformaintenanceon hardwarethatwedidntnormallyevenuse. Howdoesrebuildingfitourgoals? Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible. Prettypoorly.Youredefinitelynothittingaslittledowntimeaspossiblewitharebuild, andyoureprobablygoingtobemissingsomedata,dependingonhowoldyourmost recentapplicationdatabackupsare. Baremetalrecoveryistypicallyfaster.Theassumptionisthatyouhaveacompletebackup oftheentireserver,andyouwanttojustdumpthatontoafreshservereitherhardware orvirtualizedtogetyourserverbackonline.Ofcourse,howmuchdatayoulosedepends entirelyonhowrecentyourmostrecentbackupis.Howmuchdowntimeisinvolved dependsentirelyonhowyoumadethosebackupsinthefirstplace.Forexample,lets supposeyourbackupsareallontapedrives,andyouneedtorestoreanExchangeServer. LetssaythatExchangeandWindowstogethertakeupabout10GBofdiskspacefor operatingsystemandapplicationfiles,andyouvegotanother400GBofmailboxdata. Thats410GBtotal.Illgiveyouthebenefitofthedoubtandsupposethatyouhavethevery latestinDLTtapebackups,andcanfitanentirefullbackupononetape.Illassumeyouget typical2:1compression,meaningyoullbeabletopullallthatdataoffoftapeinaboutan hour(assumingatapedatatransferrateabout215GB/hourofraw,compresseddata). Assumingyoucanquicklylayhandsontherighttapeandthatyouhaveallofyourrecovery bootdiscshandy,youcanprobablyhavetheserverbackonlineinacoupleofhours losingonlythedatathatwascreatedormodifiedsincethetapebackupwasmade,of course.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Isthatreasonableforyourcompany?Twohoursisntbad,butIveneverbeenabletogeta CEOtoseeitthatway.Worse,mostofusintheBackup1.0worldareonlygrabbing backupseverynight,atbest,meaningiftheserverdiesatlunchtimeyouvelostaroundhalf adayswork.Nobodyisgoingtobepleasedaboutthat;manyofthemmayacceptitbecause theyvebeenconditionedtobelievethatitsthebestthatcanbedonebuttheyrenot happy. Ofcourse,ifyourenotgrabbingafullbackupeverytimeyoubackupaserverandmost ofusarentthentherecoveryisgoingtotakelongerasyoushuffletapes.Lastweekends fullbackup,afewincrementalsfromduringtheweek,andsoforthitaddstime,nomatter howfastyourtapedrivesare.Andofcourse,ifyourenotrunningthelatestspeeddemon tapedrives,yourenotgoingtobepullingthat420GBofdataoffoftapeinanhour. WhyIncrementalandDifferentialBackupsAreNoFun Ifyouthinkaboutit,bothincrementalanddifferentialbackupssaveustime onlyduringthebackupphase;whenthetimecomestousethosebackups, theyactuallyslowusdown. Youhavetostartwithyourmostrecentfullbackup,whichmeansyoure completelyrecoveringtheserversay,400ishGBofdatainmyExchange Serverexample.Thenyoustartinwiththemostrecentdifferential,orstart applyingincrementals,dependingonhowyourbackupplanworks,Every incrementalisoverwritingdatayouvealreadyrestored,andeachsuccessive incrementalisprobablyoverwritingdatafromthepreviousincrementals thatis,afterall,thewholepointofincrementals.My400GBExchange exampleusuallyresultedinabout10GBofincrementalbackupdataevery night,meaningthataThursdayafternooncrashmeansIhavetorecover around460GBofdata,increasingmytimeandtheamountoftapeloadingI havetodo. Fullbackupsarethebestchoicebutgettingafullbackupofeveryserver, everynight,isusuallyimpractical.Andyourestillatriskforallthedatathat getsmodifiedorcreatedduringtheday,evenifyouareabletograbafull backupofeveryservereverynight. Sowhatstheproblemwiththisplan?Ithonestlytakestoolong.Anhourisyourabsolutely bestcasescenarioforrestoring400GBorsoofdata.Iusedtoknowcompanieswhowould actuallyspinupmoreservers,justsoeachservercontainedlessdata,andcouldbe recoveredmorequickly;whentheyeventuallyrealizedhowmuchmoretimeandmoney theywerespendingonserversandmaintenance,theyconsolidatedeverythingandjust decidedtotryandfindawaytomakebackupsfaster. Theunderlyingproblemwiththisplanstarts,ofcourse,inhowthebackupsaremade. Recoverytakesalongtimebecausewetakeshortcutsonthebackupsideofthings,inorder togetallourdatabackedupduringamaintenancewindoworsomething.Backingup400+ GBofdataisaprettybigdealwhenyouhavemultipleserverslikethattoworryabout;we havetotakeshortcutslikeonlydoingweeklybackups,orusingincrementalbackups,just togetitallbackedupduringthetimewehavetoworkwith. 169

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Butthinkaboutsomething:Letssayyouhaveaserverthatgeneratesabout10GBofdata eachnightforanincrementalbackup.Thatmeansyourecreatingorchangingaround 10GBofdataduringtheworkday.Letsgoworstcase,andsupposethatthosechanges occurredduringasixhourperiod(everyoneshoweduptoworklate,tookalonglunch, andwenthomeearlyhappensallthetimeinyouroffice,right?).Thatmeansyoure changingabout1.6GBperhour,orabout.02GBperminute.Thatisntactuallythatmuch data.Assumingthechangesareevenlyspreadout(whichIrealizetheyrenot,butpretend tomakethematheasyonme),yourechanging.0004GBofdatapersecondthats500KB persecond,ifImgettingmydecimalplacescorrect,andbackingup500KBeverysecondis hardlyevenworkonamodernnetwork.Assumeeachserverisincludedonadedicated networkthatsonlyusedforbackupdata;ifeveryserverwasgenerating500KBofdata eachsecond,aspeedy10GbEthernetnetworkcouldhandleafewhundredserverswith ease(actually,somethinglike2,000serversifIhaventmisplacedadecimalpoint,butfew hundredseemsmorepractical).Figure10.1showswhatImtalkingabout,withseparate networkstocarryusertrafficandbackuptraffic.

Figure10.1:Creatingadedicatedbackupnetwork. Mypointisnotreallyaboutprecisionmath;itsthatwerenottalkingaboutimpossibleto achievenumbers,andthisisexactlywhatBackup2.0proposes:Continuousdataprotection, capturingchangesastheyoccur,ratherthanwaitinguntiltheybuildupintoanenormous pileofdatathatwesomehowhavetograbduringaonehourmaintenancewindow.Plus, bygrabbingdatacontinuously,wereatriskforlosingverylittledataintheeventofa failure.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Whentheentiredatacenterisaffected,offsiterecoverycanbeasolutionforgettingat leastsomeofthebusinessbackonline. HereshowoffsiterecoveryworkedatthatretailerImentioned:We droveovertotherecoveryfacility(whichbythewaywasinthesame state,soaregionaldisasterwouldprobablyhaveputitoutof commissiontoo).Wewouldhavecalledthemtoletthemknowwewere coming,andsincetheyhandledourbackuptapestorage,theywould startrootingaroundandgettingourlatesttapesforus.Wedshowup andstartfeedingtapestotapelibraries,andstartrestoringaboutahalf dozenservers.Wedidnthaveagoalofrestoringeveryserverfromour datacenterwehadidentifiedserversthatthecompanyneededto operateinasortofworstcasescenario,andweworkedonthoseservers first.Anythingelsewouldberestoredlater,aswegotthetime. Inourpracticeruns,thistookabouteighthours.Weweredelightedto getanew,fastersetoftapedrives(aftermakingsuretherecoveryfacility hadthem,too)thatcutthetimedowntofourhours.Forourneeds,this wasbasicallysufficient:Itgotusupandrunningquicklyenoughtostart collectingdatafromourretailstoresagain,andtostartprocessing restockshipments.Assumingoursoledistributioncenterwasnt completelyunderwaterorsomething. OurtechniquewaswhatInowcallacoldrecoverysite.Inotherwords,wedshowupand havenothingbuthardware,sometelecomlines,andaboxfullofmagnetictapes.Wedtake itfromthere,essentiallyreconstructingaportionofourdatacenteralmostfromscratch, usingfairlyrecentbackuptapes.Wesentdatabackuptapesoffsiteeverymorning,anddid aweeklycompletebackupofeveryserver,soourworstcasescenariohadusmissingabout adayofdataatmost. Wewereprettypleasedwithourselvesoverthisplan:Adayofdataatriskandadaytoget backonlineseemedprettyawesome.Ourexecutiveswereokaywiththeplan,too, becauseagaintheydbeenconditionstoacceptthatasbeingthebestthatcouldbe accomplished.Atthetime,whichwasyearsago,itwasaboutthebestthatcouldbedone. Theproblemisthatmanycompaniesstilloperatethatwaytheyhaventreevaluated theirconditioninginlightofnewtechnologiesandtechniques.Theyhaventsatdownand statedtothemselves: Backupsshouldpreventusfromlosinganydataorlosingany work,andensurethatwealwayshaveaccesstoourdatawith aslittledowntimeaspossible. Andthenaskediftheycancomeanyclosertothesegoals.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

LetsquicklysummarizehowBackup2.0solutionsshould,inmyview,operate.Youinstall somekindofagentsoftwareonyourservers.Thisshimstheoperatingsystemsfile system,givingtheagentasortofpreviewofeverydiskblockchangethattheoperating systemiswritingtodisk.Theagentclonesthatdiskblockinmemory,andtransmitsitto acentralizedbackupserver.Thatserverkeepsadatabaseofallthediskblocks,tagging eachonewithatimestampandtheserveritoriginallycamefrom.Thebackupserveralso doessomecompression,deduplication,andothermagictohelpreducetheamountofdisk spaceitactuallyneedstoconsumeforthatdatabase(asIdiscussedintheprevious chapter). Theresultisthatyoucanpushabutton,andqueryfromthedatabaseallthediskblocks thatgowithacertainserveratacertainpointintime.Yourenotlimitedtothegranularity ofmaintenancewindowsandtapebackups;everychangeiscaughtnearlyinrealtime,and youcanchoosetorestoretoanyparticularmoment. Allofthosediskblocksliveonfast,randomaccessdiskstorageinrealityprobablyaRAID cabineteitherdirectlyattachedtothebackupserverorperhapslivingonaStorageArea Network(SAN).Iimaginethatyoudkeepsomespecifiedperiodworthofdiskblocksin thatfashionsayseveralweeks.Youdperiodicallydumpolderdiskblocksonesthathad sincebeenoverwrittenbyneweronestoatapeforoffsitestorageorarchival,andyoud deletethosediskblocksfromthediskofthebackupserver.Ifranklycantimaginewanting torecoveracompleteservertomorethanafewhoursinthepast,letaloneentiredaysor weeks,butImsuretheresabusinessscenarioouttheresomewherethatwouldjustify retainingtheabilitytorestorethatfarinthepast.

Letsagreethattherebuildtheservermanuallyapproachistootimeconsumingandstick withbaremetalrecovery.InaBackup2.0world,allofyourdataissittingonnice,fast, randomaccessdisks.Soyourtimetogetthedataoffoftapeisexactlyzero:Youjustneed togetthedatafromyourbackupserversdiskstothediskofaphysicalorvirtualserver.In otherwords,abaremetalrecoveryisreallyjustabig,fancyfilecopy.Now,afast 430GB/hourtapedriveisanicethingtohave,butthatsonlyabout7GBperminute.A 10GbEthernetnetwork,ontheotherhand,ismuchfasterand10GbEthernetisntatall uncommonintodaysdatacenters,havingbeenintroducedinlate2002.Infact,both40Gb and100GbEthernetarecurrentlyindraftspecifications.Butamature10GBEthernet networkmoves10gigabitspersecond.Thereareeightbitsinabyte,sothats1.25gigabytes persecond.Inaminute,thats75GBabouttentimesasfastasasuperfasttapedrive. Evenassumingthenetworkisonly80%efficient,yourestillat60GBperminutes,orabit morethan8timesfasterthanaveryfasttapedrive.Ifyouneededtorestore420GBtoa server,itwouldtakeaboutsevenminutesacrossanetworklikethat.Sevenminutesto restoreacompleteserver,eithertophysicalhardwareortoavirtualmachine.When40Gb Ethernetisavailable,justarestorewouldtakeundertwominutes.Twominutes.Canyou imaginethatconversation?Theserverswhat?Down?Oh,canIputyouonholdforlike twominutes?<musicplays>Tryitnow.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

ANoteonMath Bytheway,IrealizethatthenumbersImtossingaroundhererepresenta perfectworld,andtheyreperhapsglossingoversomeassumptionslike assumingyouhavebuiltadisksubsystemforyourbackupserverthatcan pulldataoffthedriveat60GBaminute,andthatyourbackupservers operatingsystemandsoftwarecanspitdataontothenetworkthatfast.The pointisreallytoillustratethevastperformancegulfbetweentapedrivesand disk+networkdatatransmission;obviously,oneofthethingsyoushould evaluateasyoustartlookingatBackup2.0solutionsishowfasttheycan performinrealworldconditions. ThepointisthatBackup2.0srecoveryscenariolooksbetterbecauseitsbackupscenariois better.Bygrabbingdataasitchanges,wegetacompleteuptotheminutebackupforallof ourservers.Wecanthensendthatdatafromanygivenpointintime,nolessbacktoa server,ortoanalternateserver,wheneverwewantto,inlesstimethanittakestomakea propercupofcoffee.

Onceyouveturnedbaremetalrecoveryintosomethingapproximatingagiganticfilecopy operation,youcanreallystarttogetcreativewithyourrecoveryoptions. Forexample,whynotjustengineerapad,orextracapacity,intoallofyourvirtualization hostservers,sothateachonecouldsupportafewmorevirtualmachinesthanthey normallyran?Ifaphysicalserverdies,youcouldjustspinupanewvirtualmachine whichtakesafewsecondsandrestorethefailedservertothatvirtualmachine.You mightnotgetamazingperformancethatway,dependingonwhatthefailedserverdid (someapplicationsjustdontrunwellonvirtualmachines),butyoudbeupandrunningin areducedstateuntiltheserversoriginalhardwarecouldberepaired.Thenyoudjust restoretheserverbacktothatoriginalhardwareduringamaintenancewindow,andyoud besettogo. Virtualization,combinedwithBackup2.0techniques,offersapracticallyendlessarrayof recoveryscenarios.Recoverphysicalmachinestovirtualones.Recovervirtualmachinesto differentvirtualizationhosts.Recovervirtualmachinestophysicalmachines,ifneeded. Yougetatonofflexibility,anditcanallbedonequickly,providedyouvebuiltan infrastructuredesignedforthiskindofoperation.

Butwhatifyourentiredatacenterisaffected?HowcanBackup2.0servethen?Thefirst keyisgettingthatbackupdataoffsite,becauseifyouloseyourdatacenterthenyoure losingyourbackupserverandallitscontents,too.Tapeisobviouslyonewaytogetthat backupdatasafelyoffsite,butitsrevertingtoaBackup1.0,snapshotstyleapproach, meaningyoullalwayshavedataatrisk.Thatmightbeokayforyourorganization,andits certainlyaneconomicalapproach.Ioutlinedthisideainthepreviouschapter;Figure10.2 isareminderofwhatthismightlooklike.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure10.2:Movingbackupdataoffsiteviatape. Therecoveryplanhereistorunoutandgetyourtapes,andthentakeittowhereveryou plantoexecuteyourdatacenterrecovery. ColdRecovery ThatscenarioisessentiallythesameasthecoldsiterecoverythatIoutlinedearlier. Yourestillgoingtowaitfordatatostreamofftapeasyourecoveryourbackupserver,and thenyoullbecopyingmultiplesetsofdataacrossanetworktogetyourserversupand runningagain. Aslightmodificationofthisapproachistonotbackupyourbackupservertotape,but rathertoexport,fromyourbackupserver,diskimagesoftheserversitsbeenbackingup. Thatway,thetapecontainsimagesthatcouldinstantlybecomevirtualmachines,orbe usedtorecovertoaphysicalmachine,assoonasthedatagetsoffofthetape.Figure10.3 illustratesthisapproach.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure10.3:Exportingdiskimagestotapeforfasterrecovery. Imnottryingtopresentthisasanidealsolution,becauseIdontthinkitis.Itisan economicalsolution,though,anditwillworkwiththewidestpossiblevarietyofoffsite recoveryfacilities.Basically,iftheycanprovideyouwithatapedriveandavirtualization host,youreinbusiness. WarmRecovery Withthisapproach,youreplicateyourbackupdataoffsiteoveranetworkconnection, ratherthanontape.Therearetwomainadvantageshere: Youroffsitedataismuchmoreuptodatethanitwouldbeifyouusedtapes. Recoveryisfasterbecauseyouwontnecessarilyberestoringfromtape;youllbe recoveringfromdiskbasedstorageattherecoveryfacility. Figure10.4showshowthismightwork.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure10.4:Replicatingbackupdataoffsite. Therearesomeprettyobviousconcernswiththisapproach,firstandforemostofwhichis probablyWANbandwidth.Youreobviouslygoingtoneedalot,butyoucanmitigateand managethisabit.Forexample: Compressionanddeduplicationwillreducehowmuchhastogettransmittedby asmuchas80%,accordingtosomevendorclaims. ThrottlingcanreducetheimpactonproductionWANusage.Letthebackupserver transmitusingleftoverbandwidth. Thebackupservermightnotreplicateeverydiskblock.Forexample,alotofserver operationswillcontinuouslywritethesamediskblockmanytimesinsuccession. Thebackupservermightwaitforanidleperiod,andthentransmitthelastversion ofaparticulardiskblock.Youlllosesomegranularityofrecoverythatway,butyou mightnotcarewhenitcomestooffsiterecovery. IusedInternetinmymodel,butyoumightnotactuallyusetheInternet.Dedicated WANbandwidthtotherecoveryfacilitywouldprovideadedicatedpathforthedata tobeuploaded,althoughyoudobviouslyhavetobeabletojustifythecostofthat dedicatedbandwidth.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Letssayyougenerate100GBofbackupdataaday.Ifyoureducethatby60%for compressionanddeduplication(eventhoughmanyvendorsclaim80%),thats40GBto transmit.Ifjust5%ofthatwasrepeateddiskblocks,youcouldpotentiallyhavetojust send38GB.Assumethatsspreadevenly(oratleasttransmittedevenly)overa24hour periodandyouget1.6GBperhour,meaningyoudneedanuplinkspeedofabout3.5Mbps, whichisroughlyacoupleofT1linesintheUS(orevenanSynchronousDSLlineinsome areas).Notcheap,certainlyabout$6500/yearinmanyUScitiesusingdualSDSLlines butclearlynotimpossible,andforsomebusinessesitwouldbeworththeprice.Think aboutit:YoucouldcallyourrecoveryfacilityandletthemknowtoactivateMission Recovery.Theircopyofthebackupdatacouldimmediatelystartstreamingtovirtual machines,andinafewminutesyourmostcriticalserverswouldbeonlineatanoffsite facility,withperhapsafewhoursofdatalossbeingyourmaximumrisk.Youcanengineer thiskindofsolution. Note Exactlyhowyoureplicatethisdatadependsalotonthesolutionstackyouve assembledforbackups.Somebackupsolutionsmighthavenativesupportfor thiskindofoffsitereplication,includingbandwidththrottlingandother WANfriendlyfeatures.Inothercases,youmightneedaseparatesolutionto handlethedatareplication.Youllneedtoconsultwithyouroffsiterecovery vendortodeterminewhattechnologiestheycanworkwith,aswell. HotRecovery Hotrecoverygoesastepbeyondwarmrecovery,asthenameimplies.Ratherthanmerely storingyourbackupdataattheoffsitefacility,theyrerestoringthatdatatophysicalor (moreoften)virtualmachinesasyoutransmitittothem.Thatmeansrecoveryisjusta matterofstartingthosemachinesyoudontevenneedtowaitforarecoveryoperationto complete,becauseitsbeingdoneconstantly.Figure10.5illustratesthisidea.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure10.5:Ahotrecoverymodel. Thisisobviouslyaprettyexpensivechoice.Youlllikelyneedmoreupstreambandwidthto therecoveryfacilitytomakethiswork,andtherecoveryfacilityisobviouslygoingtowant tochargeabitmoretomaintainthiskindofarrangement.However,forsomeservicesin theirdatacenter,somecompaniesmayfindthepricejustified. Note Serviceisreallyanaccuratetermhere.Thingslikeemail,particular applications,andsoforththeseareallservicesthatyourdatacenter deliverstoyourusers.Someservicesmaybeworthyofexpensive precautionslikeahotrecoverymodel(althoughthatbecomesalotmore feasibleifyourcompanyalreadyhasitsownmultipledatacenters);other servicesmightwarrantwarmrecovery.Someservicesmightnotbepartof yourdisasterrecoveryplanatall.Italldependsonyourexactneeds. Today,mosthotrecoveryvendorsutilizevirtualization,whichhasmarkedlyloweredthe costofsuchservicesandputthemwithinreachofamuchbroaderrangeofbusinesses.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Note Backup2.0isnttheonlywaytoachieveahotsiterecoverymodel. Dependingontheapplicationsandservices,youmaybeabletouse geographicallydispersedfailoverclusteringandothertechniques.Thoseare beyondthescopeofthisbook,butIdowanttomakesureyoureawarethat therearemanyotheroptions,especiallyifyouroffsitefacilityissimply anotheroneofyourowndatacenters.

Believeitornot,theabilityforBackup2.0tohandlebaremetalrecoverycanmakea wonderfulmigrationtool.IfyourealreadybackingupyourphysicalserversusingBackup 2.0techniques,youcaneasilypusharecoverytoavirtualmachine.Figure10.6shows whatImtalkingabout.

Figure10.6:Disasterrecoveryasamigrationtechnique. Becausethebackupserverdoesntcarewhereitrestoresto,youcanenablesomepretty neatmigrationoptions: V2V,orVirtualtoVirtual:Migrateserversbetweendifferentvirtualizationplatforms orbetweenvirtualizationhostservers. P2V,orPhysicaltoVirtual:Migratephysicalcomputerstovirtualmachines. V2P,orVirtualtoPhysical:Migratevirtualmachinestophysicalmachinesgreat whenyourealizethataparticularserviceneedsawholecomputertoitself. P2P,orPhysicaltoPhysical:Migrateservicesfromonephysicalmachinetoanother, helpingeliminateolderhardwareandmovetonewerhardware.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

YouwouldntneedtomessaroundwiththeP2Vtoolsprovidedbyvirtualizationvendors, whichsometimesrequirethesourceservertobetakenoffline.Instead,youcanbasethe migrationoffoftheuptotheminutebackupavailableonyourbackupserver.Infact,you canevenrepeatthemigrationasmanytimesasneeded,doingtrialmigrationsoverand overuntilyouresatisfied,becausethesourceserverdoesntneedtobeinvolved.

Wevecoveredquiteabitofgroundintheprecedingtenchapters.Itstimetocircleback andlookatsomeoftheoriginalproblemswitholdschoolbackups,andseewhatwemay havesolvedwitha2.0approach.Itsalsotimetolookmorepreciselyatwhatsinvolved inredesigningyourbusinessbackupstrategy,andoutliningamethodologyfor determiningtherealcostofaredesign.Weshouldalsolookatsomeofthemorehumanor, shallwesay,politicalfactorsinvolvedinaredesign.Thatsallcomingupinthenext chapter. Then,inthefinalchapterofthisbook,Imgoingtolookatsomerealworldstoriesof Backup2.0techniquesinaction.Hopefullyitllgiveyouafeelforthevarietyofwaysin whichcompanieslikeyoursareutilizingBackup2.0,andinspireyoutoinvestigateyour ownsolution.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Chapter11:RedesigningBackup:IsItReally WorthIt?
WhatsitgoingtocostyoutoimplementBackup2.0,andisitworththetimeandmoney? Obviously,Icantgiveyouspecificnumbersbecausethosenumberswilldependonexactly whatyourebackingup,howdistributedyournetworkis,andanumberofotherfactors. ButwhatIcandoisshowyouhowtocalculatethatcost,andtocalculatethecostofjust stayingwithyourexistingbackupinfrastructure.Youcandothemathandfigureout whethera2.0inspiredredesignisgoingtobebeneficialforyou.

Beforewedothat,letsquicklyreviewwhatBackup2.0isallabout.Asalways,were focusedonabusinessgoalhere,andwerenotconcerningourselveswithpasttechniques ortechnologies.Hereswhatwewant: Backupsshouldpreventusfromlosinganydataorlosinganywork,andensurethat wealwayshaveaccesstoourdatawithaslittledowntimeaspossible. Theproblemwitholdschoolbackuptechniquesisthattheyrelyprimarilyonpointintime snapshotsandonrelativelyslowtapebasedmediaforprimarybackupstorage.That meansrecoveryisalwaysslowerthanitshouldbe,andwealwayshavealotofdataatrisk. Backup2.0proposesthatweusecontinuousdataprotection.Inatypicalimplementation, youwouldinstallagentsoftwareonallyourservers,andtheywouldbackupyourdatatoa centralbackupserver.Figure11.1illustratesthisarrangement.Thebackupserverwould keepyourbackupinformationondisk,makingitmorereadilyavailable.Withafast10Gbps Ethernetnetworkconnection,youcouldrestoreanentireserverinafewminutesfar fasterthanyoucouldfromeventhefastesttapedrive.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure11.1:Backinguptoacentral,diskbasedbackupserver. Ratherthangrabbingsnapshotsoftheentireserverorevenentirefiles,theagentwould shimtheoperatingsystems(OSs)filesystem,enablingittoseeeverychangebeing writtentodiskatadiskblocklevel.Becausetheagentwouldbeaccessingthisdatabelow thelevelofafile,itwouldnthavetoworryaboutopenfilesoranyothercommonbackup restrictions;itcouldsimplycopyeverydiskblockchangeasitwasbeingwrittentodisk. Figure11.2showshowthismightwork.InStep1,anapplicationmakesachangetodisk perhapssavingarowtoadatabase,writinganewmessagetoamessagestore,or modifyingafile.InStep2,thosechangeddiskblocksarecapturedbythefilesystemshim, andinStep3,theyaretransmittedtoabackupserver,whichsavesthediskblocksina database.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure11.2:Backingupdiskblocks. Becausethediskblocksaretimestamped,thebackupservercouldreconstructthe originalserversentirediskatanygivenpointintime.Byexposingthatinformationasa mountablevolume,andbyprovidingutilitiesthatunderstandhowtonavigatedatabases suchasSQLServerorExchangedatabases,youcouldretrievesingleitemsfromanypoint intime.Figure11.3showshowauserinterfacemightexposethatkindoffunctionality.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure11.3:Recoveringsingleitemsfromthebackupdatabase. Toreducethesizeofthebackupdatabase,thebackupservercouldusefileorblocklevel deduplicationalongwithcompression.Forexample,asillustratedinFigure11.4,the servercoulddetectdiskblocksthatcontainedthesameinformationand,asshownin Figure11.5,removetheduplicatesandsimplyprovideanoteofwhatblocktheywerea duplicateof.Vendorsimplementingthistechnique,alongwithcompression,claimupto 80%reductionsindatasize.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure11.5:anddeduplicatingthemtosavespace. Magnetictapewouldntnecessarilybeeliminated.Tapestillprovidesaconvenientwayto movedatasafelyoffsite.However,tapeswouldbeusedtobackupthebackupdatabase, ratherthanserversdirectly,asFigure11.6shows.Thiswouldeffectivelyeliminatebackup windows:Youcouldruntapebackupsalldaylong,ifyouwantedto,becauseyouwouldnt beimpactingyourservers.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

However,becauseBackup2.0dealsindiskblocksthatarecapturedinnearrealtime,you couldalsostreamthosediskblocksoffsitetoasecondbackupserverbymeansofaWAN orInternetconnection.Offsitemightrefertoanotherfacilityofyourownortoa contracteddisasterrecoveryfacility.Figure11.7illustratesthistechnique;itcanbevery usefulincreatingawarmrecoverysitethatcanbeginrestoringkeyserverstovirtual machinesintheeventofatotaldisasterinyourmaindatacenter.

Figure11.7:ReplicatingbackupcontentoffsitebymeansofaWANorInternet connection. ThesearethebasiccapabilitiesthatBackup2.0offers,andthecoretechniquesthatituses. Itsdesignedtoprovidebothrapidsingleitemrecoveryaswellasspeedywholeserver recovery,givingyoutheflexibilityofrestoringentireserverstothesamehardware,to differenthardware,oreventoavirtualmachine.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

LetsBeClear ThecapabilitiesIvewrittenaboutherearelargelywishfulthinkingonmy part,meaningthatImnotwritingaboutanyspecificvendororsolution. Thatsdeliberate:Idontthinkweshouldacquiretechnologybasedonwhats available.Rather,Ithinkweshoulddefinewhatwewant,thenpushthe marketplacetodeliver. Thereareabsolutelyvendorswhoofferatleastsome,ifnotall,ofthe capabilitiesIvewrittenabout.SomeofthemusethephraseBackup2.0and somedont.Thekeyforyouasatechnologypurchaseristofocusonthe capabilitiesyourbusinessneeds.Whenyoufindavendorwhocandeliver exactlythosecapabilitiesforthepriceyoufeeltheyreworth,youvefound yournewbackupsolution.

LetmequicklysummarizethekeycapabilitiesofaBackup2.0solution: Continuousdataprotectionisthekeyelement,leavinglittleornodataatriskin theeventofafailureofanykind.Therearemanywaysinwhichtoimplementthis, butmypreferenceistofocusonstreamingchangeddiskblocks.Doingso,rather thangrabbingentirefiles,bypassestheneedtoworryaboutfilesthatareconstantly openandprovidesmoregranularrecoverycapabilities. Mountablerecoveryimagesareanotherkeyelement.Youshouldessentiallybe abletobrowseyourbackupsasiftheywereafilesystem.Dependingonyour environment,thismightincludetheabilitytomountspecifickindsofdatabases suchasSQLServer,SharePoint,orExchangesothatyoucanrecoversingleitems withouthavingtorestoretheentiredatabase. Variablerecoverytargetsoffertheabilitytorecoveraservertodissimilar hardwareoreventoavirtualmachine.Thiscapabilityprovidesmaximumflexibility forrecoveryscenarios. Datacompressionanddeduplicationreducetheamountofdiskspaceconsumed bythebackupsolution. Tieredstorageallowsyoutotransferorcopybackupdatatotapeforoffsite storage. Replicationallowsyoutotransferorcopybackupdatatoanotherbackupserver forredundancy,offsitestorage,centralization,orothergoals.

Yourbackupsolutionhastoprovidethesecapabilities,plusanyothersthatyouve identifiedasimportanttoyourbusiness.Redesigningyourbackupinfrastructuremeans acquiringacompliantsolution,thenredesigningifnecessaryyourdatacenterto supportthatsolution.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Ifyourelikemostcompanies,youprobablyalreadyhaveabackupplaninplace.Thatmost likelyinvolvesoneofthreebasicscenarios: Backuptapedriveshangingdirectlyoffservers,whichbackuptothatdrive Backuptapelibrarieshangingoffadedicatedbackupserver,whichusessoftware agentstograbsnapshotsandstreamthemtotheserver,whichthenstreamsthe datatotape Acombinationofthesetwo,asFigure11.8shows

Thethirdoptionisactuallyfairlycommon;companiesstartwiththecentralizedtape backupscheme,thenattachtapedrivesdirectlytoafewkeyserverstoenablemore backupstotakeplacewithinagivenbackupwindow.

Figure11.8:Typicaltapebasedbackup. MyfirstITjobwasasanAS/400operator,andmymainjobwasbacking upthesystemeverynight(tothisday,Ihatenightshifts).Iremembermy elationwhenwepurchasedanewtapebackupdrivethatwascapableof backingupthewholesysteminhalfashift,usingjustonerackoftapes.It replacedasystemthattookalmostthewholenightandtworacksof tapes.ThatswhenIfirststartedtothink,Wow,ourexpectationsfor backupandrecoveryareawfullylowifthisiswhatexcitesme.Thatwas thebeginningoftheBackup2.0conceptforme:Backupsthatactually meetbusinessrequirementsratherthanfitwithintechnologylimitations.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Itsnotevenunusualtohaveasortofhybridmodel,wherethebackupservercollects backupinformationondisk,thenwritesittotape,thusprovidingmorebackupcapacityin ashortertimeframe.Thebackupservertypicallydoesntstoremorethanadayortwoof snapshots,butthatsoftenenoughtoproviderecoverytothemostrecentimage. RedesigningthisschemetofittheBackup2.0modelisntdifficult.Youreobviouslygoingto needtoacquireaBackup2.0continuousdataprotectionsolution;feedcontinuousdata protectiontoyourfavoritesearchengineandseewhatcomesup.Youcanalsojusttry searchingonBackup2.0,asseveralvendorsarestartingtousethattermtodescribetheir products. Caution PleasedontassumethatavendorsuseofthetermBackup2.0guarantees thattheydelivereverysinglecapabilityIvewrittenabout.Icantcontrolthe marketingdepartmentsofeveryvendoroutthere;usethisbooktodevelop yourownlistofcriteriaandrequirements,andrevieweachsolutionthat youreconsideringaccordingly. Youwillhavetotouchallyourservers,orusesomecentralsoftwaredeployment mechanism:YouregoingtowanttouninstallordisableyouroldBackup1.0styleagents oneachserver,andinstallagentsforyournewBackup2.0solution.Inalllikelihood,you cancontinueusingyourexistingbackupserver,withitsattachedtapelibrary.Youllwant tochangeanyserversthathavedirectlyattachedtapedrivesandhavetheminstead streamdiskblockstoyourbackupserver.Figure11.9showsthenewarrangement;at worst,youmightneedtoadddiskstoragetoyourbackupserver. Note Frankly,determiningtheamountofdiskstorageyourcentralbackup serverwillneedisprobablythebiggestchallengeinmovingtoBackup2.0. Everysinglevendorisdifferentinthisspace;workwiththemtodetermine somediskspaceestimates.Justrememberthatyourplanwillprobablybeto movebackupdatatotapeonsomescheduledbasis,andrememberthatyour backupsystemisntnecessarilysupposedtobeadataarchivalsystem.You dontneedtokeepeverythingforever;youneedtokeepenoughtobring yourbusinessbackonlineintheeventofadisasterortorecovercorrupted oraccidentallydeletedfiles.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure11.9:ConvertingtoBackup2.0. AskyourBackup2.0solutionvendoriftheyoffercompressionanddeduplication,andfor somerealisticexpectationsonhowmuchspacethatwillsave.Letssayits60%.Dosome analysistoseehowmuchdiskspaceactuallychangesonyourserversonadailybasis. Decidehowmanydaysintothepastyouwanttokeeponlive,diskbasedstorage.Thendo themath: Multiplyyourdailydiskchangebythenumberofdaysyouwanttokeep Multiplythatresultbytheaveragediskreductionnumber(say,.7for70%)

Adda10%padforgrowthandmismeasurement,andyoushouldhaveanideaofhow muchdiskspaceyourbackupserverwillneed. Youalsoneedtolookatthenetworkyourbackupserverwillberunningover.Youmight havealreadybuiltadedicatednetworkinyourdatacenterforbackuptraffic;ifso,itwill probablybejustfineinthenewBackup2.0world.Ifnot,youmightwanttoconsiderdoing soandconsiderafast10GbpsEthernetnetworkforthatpurpose.Remember,thisisthe bigchangefromBackup1.0:Yourenotusingthatbackupnetworksolelyatnightduring yourmaintenancewindow;youreusingitcontinually,soitneedstobefast,andideallyit needstobededicated.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Note Yourinvestmentinafastbackupnetworkisnottoenablefastbackups, contraryasthatmightsound.Theinvestmentistoenablefasterrecovery. Remember,withcontinuousdataprotection,yourbackupsarealwaysupto date;thegoalistobeabletogetthemoffthebackupsystemandontoyour actualserversasquicklyaspossible.Thatswhya10GbpsEthernetnetwork dedicatedforbackupsisagreatidea.Itsnotalwaysanecessity,ofcourse,but itsgreatifyoucanaffordit. Addupyourcosts: YourBackup2.0solution,whichislikelygoingtobelicensedbasedonthenumber ofserversitwillbackup Newdiskstorageforyourbackupserver,ifneededThiscanbepricey;ideally,you wantastorageareanetwork(SAN)forthispurpose,althoughiSCSImakesaSAN lessexpensivethanolderfibrechannelSANtechnology Ifyouneedtoimplementadedicatedbackupnetwork,factorinthepriceofnetwork cards(ifyourserversdonthaveunusedEthernetports),cabling,switches,and otherinfrastructureequipment

Thosearenumbersyoushouldbeabletocomeupwithprettyreadily,givenaquotefroma fewvendorsandperhapsatriptoasearchenginetocheckpricesonthenetworking equipmentordiskstorage.Next,youneedtofigureoutwhatitcostsyoutodonothing. Why?Idontwantyouchangingyourwholebackupinfrastructureonmysayso(Iknow youwouldntanyway).Itshouldbeabusinessdecision,basedonwhatyoullgainfromthe investment.

Determiningthecostofyourgrandfathersbackupstrategy,unfortunately,isatough thingtoworkoutbecauseyouredealingwithrisknumbers,nothardandfastpricing.Ask anycompanyHowmuchmoneydoweloseperhourifsuchandsuchaserverisoffline andyouprobablywontgetaveryaccurateanswer;mostbusinessessimplydontknow. Butletslookattherisksassociatedwithdoingnothing. Inasimplerestorescenario,costsareactuallyabiteasiertofigureout.Letssaysomeone asksyoutorecoverafilefromaweekago,thatyouhavethenecessarytapesinhand,and thattherecoveryinformationisonlyonthosetapesitsnotsittingondisksomeplace. Howlong,onaverage,willittakesomeonetocompletelyrestorethatfile?Figurethatout, andthenfigureouthowmuchboththatpersonandthepersonwaitingonthefilearebeing paidforthatperiodoftime.Now,multiplybythenumberoftimesyouhavetodothisina year,andthatswhatBackup1.0costs.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Note Ifyoudonthaveawayoftrackinghowoftenthisisdoneinayear,you shouldgetsomekindofHelpdeskticketingsoftwaresothatyoucantrackit. Thatshouldalsoletyoucomeupwithanaveragetimetorestore.Ifyou arenttrackingthatinformation,itbecomesverydifficulttomakeacasefor improvingthesituation. Illgiveyouanexamplefrommyownpast:Ittookus,onaverage,30 minutestorecoverasinglefile.Wehadtopulltapesoutofoursafe,load them,locatethefileinthebackupsoftwaresindex,thenletitspinthe tapetotherightlocationtoretrievethedata.Frankly,30minuteson averageisprettygood.Ouradministratormadeabout$60,000ayearat thetime,andthefolksintheofficeprobablymadeasimilaramount,on average.Irecalloneyearwherewedidatleastthreeoftheseoperations aweeksoabout150ayear.Thereareabout1,920workinghoursina year,andthesebackupoperationsconsumedabout75ofthem.That meansthiskindofrecoveryoperationcostusabout$4700peryear.I knowthatsnotahugenumberasingleserverusuallycostsmorebut itaddsup.Andwewerearelativelysmallcompany;$5kayearin overheadwasahealthypercentageofourITbudget. Note FeatureslikeWindowsPreviousVersions(VolumeShadowCopy)were implementedspecificallytohelpreducethatcost.Bygivingusersaself servicemechanismandbyusingfasterdiskbasedstorageforrecent backups,youcouldprobablyreducethatcostbyalot.ButPreviousVersions hassomesignificantlimitations,includingitssnapshotbasedmethodology andthelimiteddiskspacemostcompaniescangiveit. Calculatingthecostofanentireserverdisasterorworse,adatacenterdisasteris obviouslymuchmorecomplicated.Howmanyusersareimpacted?Howmuchoftheir productivityislost?Arecustomersdirectlyimpacted?Ifso,howmuchinsaleswillyou misswhiletheserverisdown? Consideradatabaseserverthatservesasthebackendforanecommerceapplication.If thedatabaseislostthroughcorruptionorfailure,oryouneedtorestoretheentireserver forsomereason,howmuchinsalesdoesthecompanyloseperhour?Inmostcases,a singlehouroflostsalescanjustifyeventhemostexpensivebackupinfrastructureredesign. YoualsohavetoconsidersomeofthemajortechnicalandbusinessadvantagesofBackup 2.0.Thesecantalwaysbemeasureddirectlyinmonetaryterms,buttheydoofferflexibility andimprovementsthatabusinesscanappreciate.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

WanttoknowwhatIliketodo?Sincethiswholehowmuchdoesafailurereallycostus questionissohardtoreallynaildown,Iliketohavealittleconferencewiththecompany executives.Howmuchareyouwillingtospend,Illask,tomakeitsothatIcanhaveyour datacenterbackonlinewithinafewhoursofitburningdown?Thatkindoftellsyouhow muchtheshareholdersarewillingtospendoncontinuousdataprotection.Thesecond questionis,Now,whenIbringyoubackup,howmuchworkinthemiddleofadisaster, mindyouareyouwillingtoredoafterIgetthesystembackonline?Howmuchmoney areyouwillingtospendtomakethatanswernone? Iveoftenbeenshockedbytheanswers.Ionceestimatedthataconsultingclientofmine wouldlose$10,000perhouriftheyweretotallyoffline.IputtogetheraBackup2.0style recoverysolutionthatwouldhavecostabout$30,000.Easymath,Ithought.Iaskedthose twoquestionsoftheCEO,andhesaid,Idspend$250kayeartogetbackonlinewithinan hour,andanother$250kayeartoensureIdidntlosemorethan10minutesofworkwhen wecamebackonline.Well,then.Iwasclearlyunderpricingmyself!Mindyou,hedidnt haveanyhardnumbersthatwasjustagutinstinctfromthepersonwhohadtoanswerto theownersandsometimes,thatsabetternumberthanyoumightthink.

AsIvewritten,sometimesitcanbedifficulttoreallyquantify,indollars,thecost associatedwithnotmovingtoaBackup2.0styleapproach.Whatcansometimeshelpisto understandsomeofthespecificbusinessandtechnologyadvantagesofthisnewapproach sothatyoucanperhapsquantifythoseadvantages.Doingsocanhelpyoujustifythecostof aredesignintermsofbenefitgainedratherthanriskavoided.

Backup2.0,atitsheart,offerstheabilitytofinallygrabasolidbackupofeverysingleserver inyourenvironment,enablingyoutorecoveranythingfromawholeservertoasinglefile, toaspecificpointoftime,withinseconds.Literallyseconds,especiallywithindividualfiles orgroupsoffiles;perhapsminutes,dependingontheinfrastructureyoubuild,forwhole servers. Andwhenitcomestowholeserverrecovery,Backup2.0supportsavastarrayofnew options:Recovertoavirtualdatacenter,eitheronsiteoroffsite.Recovertodissimilar hardware.Recovertothesamehardware.Whateveryouwantyoucanflextheseoptions asneededforanyparticularscenario.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Backup2.0offersafarsuperiorapproachforExchangeServer,whichisperhapsoneofthe mostmissioncriticalpartsofanybusinessinfrastructurethesedays.Recoverindividual messageswithouthavingtorestoreanentiredatabase,andwithouthavingtostreamthose individualmessagesoutyourdatabaseoneatatimethewayBackup1.0does.Backup2.0 givesyoutheabilitytosearch,find,andrecovermessageswithoutimpactingthe productionExchangeServer,whilestillgivingyoutheabilitytorecoverentireserverswith afewbuttonclickseithertophysicalorvirtualhardware,givingyoutheflexibilityto quicklycomebackonlineafteralmostanykindoffailure.

SQLServerhasalwaysbeenabiteasiertodealwithintermsofrecoveringdatabases,but Backup1.0still(usually)requiresyoutorestoreanentiredatabasetoaSQLServer someplacetimeconsumingandpotentiallyimpactfulonproductionservers.Backup2.0 shouldletyouaccessbackedupdatabasesdowntoindividualtables,evenwithout actuallyrestoringthedatabasetoaproductionserver.AswithExchange,thisgranular, lowimpactabilitytorecoveranythingfromasingletabletoanentireserveroffersyou flexibility,speed,andefficiency.

AsSharePointgrowsmoreandmoreembeddedinourorganizationstakingarolenot unlikeExchangesintermsofitscriticalitytoourbusinessestheabilitytogranularly recoverspecificitems,orrestoreanentireSharePointserverorfarm,becomesevermore important.Backup2.0canmeetthechallenge,providedyouselectasolutionthats specificallydesignedtosupportthiskindofSharePointbackupandrecovery.

Finally,Backup2.0isperhapsthefirsttimewevebeenabletoproperlyaddressour growingvirtualinfrastructure.Treatvirtualmachinesasyouwouldarealone,withlow overhead,blocklevelbackupstoacentralizedserver.Youreessentiallyabletotake virtualizationoutofthemix,treatingvirtualserversexactlythesameasyouwould physicalones.

IvefoundthatredesigningforBackup2.0istypicallynotthatexpensive.Letstakeaworst casescenario,whichinmyconsultingworktypicallymeanshavingto AcquireaBackup2.0softwaresolutionoftenthemostexpensivepartofthe proposal Implementabackendbackupnetworkinthedatacentertocarrythebackup solutionstraffic Perhapsupgradeoracquiretapelibrariestoprovideasecondtierofbackupstorage


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Inatypicalsmalltomidsizebusiness,thesecostsareoftensmallenoughtobeconsidered incremental.Itsimpossibleformetoprovideaccuratepricequotesbecauseeverybusiness willbeslightlydifferent,butrestassuredthatthecostistypicallyinlinewith implementingamoretraditionalbackupsolution.Inotherwords,figureoutwhatyour existingBackup1.0solutioncostsyou,andyoureprobablylookingatsimilarcoststo implementBackup2.0.Oftenless,asyoullusuallybeabletoreuseyourexistingbackup server(s)andtapedrive(s),andifyoualreadyhaveabackendnetworkforbackuptraffic, youllbeabletoreusethataswell.Inabestcasescenario,infact,yourereallyjust swappingyourcurrentbackupsoftwarefornewbackupsoftware,andthatsrarelya massiveinvestment. PerhapsthebiggestconcernIrunacrossiswiththecompanysCFObecausecomputer softwareisoftendepreciatedoveralongerperiodoftimethanevencomputerhardware. Inotherwords,ifyourCFOdoesntfeelhesdepreciatedyouroldbackupsoftware,there maybesomeresistancetobuyingnewsoftware.Thatswheretheprosandconssideof theargumentcomesin:Youmightneedtoidentifysufficientbenefitthatlosingthe depreciationontheoldsoftwareisjustified.Alsobesuretofactorinanysoftware maintenancefeesthatyoupayontheoldsoftwareandthatyoullpayonthenewsoftware; becausethosemaintenancefeesarerecurring,theyretypicallynotdepreciatedatalland thosefeescansometimesconstitutethebulkofthecostofasoftwareproductoveragiven periodoftime.

Thefinalthingyoullprobablyhavetodealwitharetheinevitableofficepoliticsthat surroundanykindofmajorITchange.Thekeytosuccessinthisarenaistobeprepared withfactsandtoaskthateveryoneinvolvedtrytoavoidbecomingreligiousaboutthe issue. Itcanbedifficult:Wetechnologyfolksgetattachedtoourtoys,andwedontreallylike changeverymuch(althoughweenjoyinflictingitonotherswhenitssomethingwere excitedabout).Thegoalshouldbetohaveeveryoneagreetofocusonthebusinessneeds, andonhowthoseneedscanbebestachieved.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Ifindthatthereareusuallyjustafewcategoriesofoppositiontochangingacompanys backupstrategy.Executiveleveloppositionisusuallyfocusedoncost,oftenwiththeadded twistrelatedtothedepreciationofyourexistingsolutionwhichIvealreadywritten about.Executivesjustneedtounderstandthecost/benefitargumenttodecidewhetherthe purchaseisworthit.Thisbookshouldhelpyoubeabletoarticulatethebenefits,butdont argueforanewsolution.Instead,presentthebenefitsandthecostsinanunbiased, businesslikefashionyoullearnmorerespectwiththeexecutivesandhelpthemreally decideifBackup2.0isworthit. Middlemanagerialoppositionusuallycomesfromadesiretoavoidchange.Thats understandable,aschangeiswhatcausesproblemsinmostITenvironments.Thekeyhere istohaveasolidplanforimplementation,andtomakeitclearthatyoudontwantto proceedwithoutsuchaplaninplace.Thatmayinvolverunningoldandnewsolutionsin parallelinalimitedpilotforsomeperiodoftimesothatyoucanunderstandandmitigate oraddressanyproblemsthatarise.Workwithinwhateverchangemanagementframework yourcompanyusesfollowingthatprocesswillhelprelievemanagerialconcernsinmost cases. Theresoftenafeelingthatswappingbackupschemeswillbedisruptive,butitdoesntneed tobe.Backup2.0canlivesidebysidewithBackup1.0inaphased,gradualapproachthat avoidsdisruptionandofferstimeforfamiliarization. ITprofessionalleveloppositionthatis,oppositionfromthefolkswhowillimplementand operatetheBackup2.0solutionisusuallysimplefearordislikeofchange.Everyonewill havetolearnanewsetoftools,newtechniques,andnewwaysofthinking.Mitigatethat fearbyclearlycommunicatingthebenefitsofBackup2.0.Typically,Ifindthatmost administratorsarentthrilledwiththeoverheadandtediumoftheirexistingbackup solution,andthebenefitsofBackup2.0fromthatlevelonceclearlyexplainedhelps overcomeresistanceprettyquickly.

Youknow,therealthingtorememberhereisthatBackup2.0isnew.ThatswhyIkeep callingit2.0,muchasIknowthatwillleadtothetermbeingoverusedbymarketingfolks (rememberWeb2.0?Thisisntthesame).Backup2.0isfocusedonawholenew approachtobackupandrecoveryanapproachthat,frankly,wasntevenpracticalor feasibletwodecadesagowhenourcurrentbackuppracticeswerecreated. Theproblemwitholdschoolbackupsissimplythattheyweredesignaroundthe constraintsoftechnology.Manyofthoseconstraintshavebeensolved,atthispoint,while Backup1.0hasmoreorlessfailedtokeepup.Backup2.0takesanentirelyfreshapproach, withanacknowledgementoftheproblemsofBackup1.0.Ratherthanboltingon solutionslikeopenfilemanagersandotherworkaroundstofixBackup1.0s problems,Backup2.0startsfromthegroundupwithanewwayofachievingouractual businessgoals.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Intheend,thatswhatBackup2.0isreallyallabout:meetingbusinessgoals.Ithinkyou shouldverycarefullyconsideryourexistingbackupsolutionsabilitytomeetyourreal businessgoals,andperhapsrestatethosegoalswithathisiswhatwedhaveinaperfect worldapproach.Thenstartevaluatingnewer,Backup2.0stylesolutionsanddetermine whethertheycantdoabetterjobofhelpingyoumeetthosenewer,morerealworldgoals thatyouvestated.Letthebusinessdrivethetechnology,nottheotherwayaround.

Well,thereyouhaveit:Backup2.0.Idontwanttojustleaveyouwithalistofcapabilities andasolidargumentfortheboss,though;Ialsowanttogiveyousomeconfidencethatthis stuffreallyworksintherealworld.Sointhefinalchapter,whichiscomingupnext,Im goingtosharesometalesfromthetrenchesreallifestoriesofadministratorswhoare livingwithBackup2.0rightnow.Itwontallbesunshineandrainbows,though:Youllread somegrittystoriesaboutimplementationsthatwerentwellthoughtout,andotherless thanperfectsituations.Why?Well,thoseareimportantlessonstolearn.Hopefully,youcan takethosestoriesandensurethatyourlifewithBackup2.0issmoothsailing.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Chapter12:TalesfromtheTrenches:My LifewithBackup2.0
Inthesecondchapterofthisbook,IsharedwithyousomeofthehorrorstoriesofBackup 1.0.Ididsoprimarilyasawayofhighlightinghowpoorlyourtraditionalbackup techniquesreallymeetourbusinessneeds.Inthischapter,Iwanttodotheopposite:share withyousomestoriesofBackup2.0,bothfrommyownexperienceandfromstoriesyou readershavesharedovertheyearlongproductionofthisbook.Nameshavebeenchanged toprotecttheinnocent,ofcourse,butIthinkyoullfindthesetobecompellingexamplesof howBackup2.0hasbeenapplied.Wherepossible,Illshareinformationaboutthe infrastructurethatgoeswiththesestoriessothatyoucanseesomeofthecreativeand innovativewaysBackup2.0isbeingusedinorganizationslikeyourown.

ImgoingtostartwithwhatIthinkmightbemyfavoritestory.Thiswassharedbyareader, althoughasImentioned,Immakingupnewnamesforeveryoneinvolved. Iworkforaprettylargeretailer,atthecorporateoffice.Wehaveabout 2000usersintheoffice,manyofwhomworkinourdistributioncenter. Wehaveabout40orsoservers,mostofwhicharefileservers.Wealso haveacoupleofExchangeservers,andofcourseActiveDirectory(AD). WealsohaveaSQLServerthathandlesourmaindatabaseofproducts, sales,andeverythingelse.Thatdatabaseisprettymuchthecenterofour universe. OurleadnetworkadministratorsnameisKevin.Kevinsetupouroriginal backupsystem,whichusessoftwareagentsoneachservertosend backupdatatoabackupserver,whichwritesthedatatotemporaryfiles ondiskandthendirectlytotape.WehavewhatIguessisapretty commontaperotationplan:Wemakeafullbackupofeverythingonthe weekendsandsendthatoffsite,thenkeepincrementalbackupsonsite fromeachnightoftheweek.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Ihadbeenpushingforacontinuousdataprotectionbackupsystem whatyouwouldcallBackup2.0,Iguess,foracoupleofmonths.Ihad finallygottenpermissiontobuyasystemforalimitedtrial,whichI decidedwouldinvolveourSQLServer(whichissoimportant)andoneof ourfileservers.KevinwasnotthrilledthatIwassteppingintohisturf withthebackupstuff,butIpushedaheadanddiditanyway.Herefused toturnoffhisoldbackupagents,whichwasfinebecauseIwasjusttrying todoasortofproofofconcept.Hewouldntevengivemespaceonhis backupserver,though,soIhadtomakedowithasomewhatolder machine.Iwasabletoputlotsofdisksintoit,though,andIwasableto setupadedicatedbackupnetworkforthefourserversinvolved.Im attachingadiagramofwhatthingslookedlikethen[seeFigure12.1].



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Thingsseemedtogoprettywellatfirst.Iwasabletopullbackupsexactly likeyouhavedescribedinyourbook,andwedidseveraltestsof mountingthosebackupsaslivedatabaseswithouthavingtodoarestore. Kevinkeptcomplainingthatthesystemwasntasstableorasreliableas backuptapes.Itoldhimthatifhewouldhaveletmeputitonhisbackup server,wecouldhavecopiedthebackupdatatotapeeverynightor weekorwhatever,buthestilldidntwanttocooperate. Thenithappened.Asprinklerheadbrokeinthedatacenteronenight (whoinstallswatersprinklersintheirdatacenter?)andwelostbothof theExchangeservers,theSQLServer,andoneofthefileservers fortunately,oneoftheonesIwasprotectingwiththenewsetup.Weare probablyluckytherewasntanelectricalfire!TheSQLServerwasactually clusteredandwelostallthepowersuppliesinthoseservers.Somuchfor acluster!Wewereabletocobbleenoughpartstogethertogetoneof theSQLServersonline,andoneoftheExchangeservers,buttheirdisks weremessedup.KevinandIwenttothebosstotrytocomeupwitha plan. ThishappenedonaThursdaynight,sowewerealmostaweekawayfrom ourlastfullbackup.KevinwasplanningtorestoretheExchange databasestotheoneserverhehadrunning.Myplanwastoinstall VMwareontheSQLServerboxIhadsaved,asitwasprettyhefty,andto bringSQLandthemissingfileserverbackonlineasvirtualmachines.The bossapprovedbothplans,andwesetouttodoit. SoKevinwaits3hoursforlastweekendsfullbackuptocomefromoff sitebeforehecangetstarted.IwasjustinstallingESX,whichtakesabout aminute,andIhadthevirtualmachinescreatedinanother10minutes orso.IusedourBackup2.0solutiontopushthemostrecentdiskimages fortheSQLServerandthefileservers,andwithinaboutanhourtotal, theywerebothupandrunningwithabsolutelynodatalossthatwecould detect.Iwasahero! OnceKevinfinallygotstarted,herealizedthathisTuesdaynight incrementalwasbadcorruptedtapeorsomething.Thatmakesittough torestoreanyoftheotherincrementalbecausetheyallstackup.Sowe werebasicallybacktoMondaynight3daysofwork,lost.Ofcourse,it tookhimmostofthedaytorealizethis,sowewoundupcallingtheboss athomeandbreakingthebadnews.HeWasNotHappy.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Well,thiswasntthefirsttimeoneofKevinsplanshadblownupinhis face,anditwasntthefirsttimesomeonehadhadabetterideaandbeen heldbackbyKevin.Bytheendoftheweek,Kevinwaslookingforanew job,andIhadhisjobandwasbusilysettinguptherestofmybackup network,movingmybackupsolutiontothebackupserver,andputting Backup2.0intofulluseinourdatacenter. Youhavetoloveastorywherethevillaingetshisjustdesserts(wellassumetheywere just)andtheherowinsthegirl.Orrather,winscontrolofthedatacenter. Actually,thisstorypointsoutareallyimportantpointaboutBackup2.0:Itdoesnthaveto immediatelysupplantyourexistingbackupscheme.Itcanlivequitehappilybesideit, coexistingforhoweverlongyouneedtocompletethetransition.Youcouldchooseto implementBackup2.0foryourmostcriticalservers,andcontinuebackingthemupvia youroldsystem,providingabeltandsuspendersapproachuntilyourecomfortableand confidentwithBackup2.0.KeepinmindthatBackup2.0makesitaloteasiertopractice fullserverrecovery,evenenablingyoutorecoverdiskimagestoblankvirtualmachinesin aslittleasafewminutes,insomecases.Thatmeansyoucanpracticeyourrecoveryskills, tweakyourBackup2.0installation,thendecommissionyouroldbackupscheme.

Thisonesfromareaderwhohadrespondedtomyprepublicationrequestforstories.He hadabriefsnippetincludedinChapter2ofthisbook,andhewrotebackintotellmehow itsbeengoingwiththeirnewBackup2.0solution. IwroteabouttheCrackberryWithdrawalthatyouincludedinChapter 2ofyourbookonBackup2.0.WevesinceimplementedaBackup2.0 stylecontinuousdataprotectionserverforourExchangeServers,anda coupleofmonthsago,oneofthemfailedagain.Actually,theservergot hitwithsomevirusthatcorruptedsomeoftheExchangedatabasesand wasstoppingtheBlackberryEnterpriseServersoftwarefromrunning. Theexecutiveswerereallyupsettheycanthandlebeingoff Blackberryformorethanafewminutes. Fortunately,thatsallthetimeittookus.Wefiguredoutthatthevirus hadhitduringtheeveningprior,andwewerentworriedaboutany emailsthathadbeensentorreceivedduringthattimebecausethey mightallcontaininfections.Sowejustrolledbacktheentireserverto about10minutesbeforethevirushadhit.Ittookmaybehalfanhourto dothat,verifythattheserverwasrunning,andgetupdatedvirus definitionsontheserversantivirussoftware(itgothitaboutanhour beforeitwasduetoupdatethoseautomatically).Backonline,and everyonehappy.Thankyou,Backup2.0!


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

ThisillustratesanothercreativeandusefulfeatureofBackup2.0:theabilitytorecovera servertoanypointintime.Youmightnotalwayswanttorecovertothemostrecent possiblediskimages,asinthiscasewhereyouwouldhavejustbeenrecoveringavirus. BecauseeachchangecapturedbytheBackup2.0systemistimestamped,youcanrestore toliterallyanysecondintimethatyoulike.Ifyoureabletodeterminewhensomething wentwrongasinthisreaderscaseyoucanrecovertojustbeforethen,andyouregood togo.

AlsoinChapter2ofthisbook,IrepublishedastoryfromanExchangeadministratorwho hadexperiencedaserverfailureandhoursofdowntimethatevenMicrosoftcouldbarely figureout.Helost2daysofmail,andhisexecutivesfigureditcostthecompanyabout $50,000,sotheywantedtoputabettersolutioninplace.Illfinishthatstorynow: Asyoucanimagine,executivemanagementfigureditcostthecompany about$50K,sotheydefinitelywantedtoknowwhathadhappenedand howitcouldhavebeenpreventedandhowitwouldbepreventedfrom happeningagain.LetsjustsaywantedtoknowmeansthatifIdidnt haveagoodanswer,mynamewasgoingonthetopofthenextlayofflist. Iwasseriouslycommittedtofindingabetterrecoverysolution. Afterevaluatingseveralpotentialsolutionsofvaryingprice(from$199to $100K),IlikedtheBackup2.0solutionwefound.Itsablockbased imagingrecoverysolutionthatcapturestheentireExchangeServer environmentandsupportsrecoveryanythingfrombaremetaltoan individualemailmessageinjustafewclicks,simplifyingtheentire recoveryprocess.WhatwastotallycoolwastheExchangehealth checks,whichmadesurethedataIwasbackingupwasabsolutely mountable.BeforeImadetherecommendationtomyboss,Iwantedto besureIwasmakingtherightchoiceandcheckedoutafewoftheir customers,whosaidtheywerehappywiththesolution,too. InadditiontocapturingandvalidatingyourExchangedata,thetool employsauniqueinstantreplaycapabilitythatdramaticallyreduces volumerecoverytimesfromhourstominutesregardlessofthedataset sizebeingrecovered.Afterarollbackisinitiated,thevolumeandstorage groupsareautomaticallyandimmediatelymountedfromthebackup server,providinguserswithaccesstoemailduringtherecoveryprocess. ApparentlytheycallthefeatureLiveReplay;allIknowisitsavedmefrom beingDeadAdmin. Youcanreadthewholestoryat onmyworst day?mkt_tok=3RkMMJWWfF9wsRow5%2FmYJoDpwmWGd5mht7VzDtPj1OY6hBssJJKtUg %3D%3D,ifyoureinterested. 202

The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

ThishighlightsanotheradvantageoftheBackup2.0concept,whichisthatindividual solutionvendorsarefreetoaddreallycreativefeatures.TheLiveReplayfeaturethis readerwroteaboutisagoodexample:Ratherthanhavingtocopytheserversentiredisk image,thissolutioncanmounttheExchangedatabasesdirectlyfromthebackupserver, whicheliminatesalotoffilecopyingtimeandgetsyoubackonlinefaster.Performance mightbesomewhatdegraded,butyoureonline,andyoucanalwayshandlethemoretime consumingdiskcopyduringamaintenancewindowwhenyourusersarentsoanxiousto getintotheiremail.

ThisstoryillustratesagreatuseofnotonlyBackup2.0butalsothegrowingpopularityof cloudstorageandtheuseofthecloudasarecoverymechanism.Thisisdefinitely somethingthatrequiresaclevervendortobeyourbusinesspartner,butIthinkitsagreat tale. Ourcompanyhasonlyabout30servers,includingseveralSQLServers andacoupleofExchangeservers,butweusethemtoprocessalmost$30 millioninsaleseveryyear.Soasyoumightimagine,theseserversare veryimportanttouswithoutthem,welose$80,000adayor$8000an hour.Wereasmallcompany,soitsdifficultforustojustifythecostofa completeoffsiterecoveryfacility.Evenwith$80,000adayatrisk,those recoveryfacilitiesareexpensiveandtheycantakealongtimetobring onlineafterafailure. WestartedlookingatBackup2.0afterIreadthefirstfewchaptersof yourbook,andweworkedwithacoupleofValueAddedResellers(VARs) whohaveimplementedtheirownservicestosupplementtheBackup2.0 solutionthattheyresell.Oneofthoseservicesisanetworkappliance thatsitsonournetwork.Basically,wereplicateourbackupdatatoit,and itreplicatesthatdataoffsite;itusesbandwidththrottlinganddoesalot ofthereplicationatnight,soitdoesntkillourInternetconnection.Ill includeadiagramofhowwehavethissetup[seeFigure12.2].


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Figure12.2:Offsitebackupdatareplication. Well,wefinallyputitalltothetestlastweek.Wedeliberatelyshutdown ourentiredatacenterhitthebigredSTOPbuttonthatsjustnextto thedoor,somethingIvealwayswantedtodoanddidalivetestofour disasterrecoveryplan. Whathappensiswecallthevendor,andtheyinitiateawarmrecovery ontheirend.Theyspinupabunchofvirtualmachinesintheirown virtualizationinfrastructure,thenrestoreourmostcriticalserversto thosevirtualmachines.Thentheybeginspinningupothervirtual machinesforwhatwecalloursecondtierservers.TheysetupaVirtual PrivateNetwork(VPN)fromtheirdatacentertoours,andourusers accessourserversfromacrossthatVPN.Becauseofthereplicationlag time,weweremissingafewhoursworthofdata,butitwasntmuch.In arealsituation,wemightevenbeabletogetmorerecentfilesandso forthfromthelocalbackupcopies,unlesssomethingreallybadhad happenedtothedatacenter.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Italltookjustacoupleofhoursbeforewewerebackonline.Payingfor virtualspaceisalotcheaperthantraditionaloffsiterecoveryfacilities, andourplanworkedperfectlyforus.Managementwasveryhappywe weregladtheVARwasabletohelpusputtogetheraplanlikethis. Itsalsoproventhemodeltous.Managementhasbeenconsidering openingasecondofficeelsewhereinthecountry,andwenowknowthat eachofourofficescouldactasawarmrecoverysitefortheother, simplybyreplicatingbackuptraffic.OtherthantheWANcosts,we wouldnthavetoinvestmuchinfrastructureinthat,whichisperfectfora smallercompanylikeours. ThisisreallyatestamenttothevalueofVARs,whocantakeagreatpieceofsoftwarelike aBackup2.0toolandsupplementitwithserviceslikethis,toreallycreateacomplete solutionthatsolvesallofacompanysbusinessrequirementseffectivelyandeconomically. And,asthisreaderpointsout,youcoulddothesamethingonyourownifyoualreadyhave morethanonesite.ConsiderFigure12.3.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

ByreplicatingbackuptrafficacrossyourWAN(ortheInternet),youcankeepcopiesof yourdatasafelyoffsitewithoutthehassleofshufflingtapes.Ifatimecomeswhenyou needtorecoveryourcompletedatacenter,yourdataissafelyinanotherphysicallocation. UsingBackup2.0,youcanrestorethosediskimagestophysicalorvirtualmachines, bringingcriticalcomputersonlinequickly.Backup2.0scontinuousdataprotection techniquesmakeitideallysuitedforthistypeofenvironment.

Thisisafunstoryaboutthatfirst,franticweekinanewenvironmentandwhathappens whenthefolkswhoprecededyouwerethinkingclearly. SoIstartmynewjob,andIvebeenintheplacemaybeaweekwhen bothofourdomaincontrollersfail.Ofcourse,serverrecoveryisthemain partofmyjobdescription,soImsupposedtobethesuperhero.Thisisa smallenvironment,andthedomaincontrollerswereactuallyrunningin virtualmachinesanditwasthevirtualmachinehostthatfailed.Well,we getthethingbackonlinewith500usersyellingabouthowtheycouldnt doanywork,ofcourseandwefindthatwestillcantlogoncorrectly. Whatevertooktheserverofflinehadcorruptedsomethinginmemory, probablybecausethedomainwastoast. SoIgotothebossandtellhimthatweregoingtohavetorebuildthe domainfromscratch.Whataboutthebackups?hesays.Iexplainthat recoveringanentireforesttakesspecialtools,youhavetocallMicrosoft ConsultingServices,allthat.Thatswhenoneofmynewcoworkers fortunately,abitmoreinformedthanIwaspulledmeaside.Thisisnt reallyafullforestrecovery,hesaid.Wejustneedtobringthosetwo serversbackfromthepointintimetheywereat.Wedontuseanormal backupsolution,itcandothis. Well,whoknew.Iwasthinkingbackuptapes,butapparentlytheguywho hadmyjobbeforemeimplementedanewserverbasedsolution. Basically,Ihitadozenbuttonsorsoandbothdomaincontrollerswere backonline.Inlikehalfanhour.ThatswhenIstartedlookingintoBackup 2.0andfoundyourbook.Yourerightthisissomuchbetterthan backuptapesIcanteventellyou.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Itsanicefeelingwhenyoureabletomakeeverythingwork,especiallywhenyour environmenthastherighttoolsforthejob.Incorrespondingwiththisreader,Ifoundthat hisbiggestamazementcamefromthespeedwithwhichtherecoveryhappened.The companyhadinvestedinprettyfast,dedicatedEthernetconnectionsbetweentheirservers andthebackupserver,andthatbandwidthmadeallthedifference.Hetellsmenowthathe thinkshecouldactuallypulloffthesamerecoveryalotfasternowthatheknowswhat toolshehasavailableandhowtooperatethem.Interestingly,hisfirstexperiencewasdone almostentirelywithouttheproductsdocumentationhejustgotintotheUIandstarted working.Thatsasignofagreatpieceofsoftware,isntit?

WorkingintechnologyforasmanyyearsasIhave(andyouprobablyfeelthesameway), itstoughtoimaginehowusersenvisionitallworking.Storieslikethisareagreat reminderandagoodexampleofhowBackup2.0canhelpwiththelittledisasters,too. Heresafunnyoneyoucanuseinyourbookifyouwant.Igetacalllast weekfromoneofourusers,whosyellingintothephone.Ijustdeleted afilebyaccidentanditsgonecanyoustopwhateverisdeletingit beforeitstoolate?Hethoughttherewassomekindofprocessor somethingthatdeletedfilesonadelay.Sadly,weallknowthisisnot true.ButIdidnttellhimthat. WehaveoneofthoseBackup2.0solutionsyoutalkaboutinyourbook, anditgrabschangesastheyhappen.SoIjustpoppeditopen,mounted themostrecentpointintimeasadiskimage,andcopiedtheusersfile tomyworkstation.IemailedittohimwithanotethatIwasabletopull itoutbeforethefilewaspermanentlydestroyed.HethinksImahero. Thisisprobablyrepresentativeofwhatmostdisasterrecoverysituationslooklike.To youandme,notadisaster;totheuserwhodeletedthefile,itsatragedyinthemaking.We havetoplanforthewholeserverandentiredatacenterscenarios,butthefactisthatmost ofusspendmostofourrecoverytimegettingbackindividualfileshereandthere.

IrememberwhenIwasanAS/400operator,andweboughtanewtapedrivethatused massivelyhighercapacitytapes.Iwassoexcitedthatwecouldnotonlydothenightly incrementalbackupsusingasinglerackoftapes,inmostcaseswecoulddothemtojust oneortwotapes.Finally,Icouldkickbackandletthebackupsrunwithouthavingto remembertogochangetaperackshalfwaythrough.Backupswerealotfaster,too,which meantournightshiftusershadtodowithouttheirAS/400foralotlesstime.Ah,thegood oldBackup1.0days.Sometimes,though,buyingeverbettertapedrivesjustisnttheright answer.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

WhenIfirstgottomycompany,wewereusingprettydecenttapedrives. Fullbackupsontheweekendsrequiredanoperatoronsite,though, becauseyoudhavetochangerackstwoorthreetimestogeteverything. Aboutayearago,weupgradedthedrives,andyoucoulddothewhole runonasinglerack.WedloadtherackonFriday,setthebackupsfor automatic,andenjoytheweekend.Nomoreweekendunpaid overtime! Well,wejustaddedabunchofserversandthatrackoftapesisnt enough.Ofcourse,wevedownsizedabitsinceayearago,andnowIm theonlyonewhosresponsibleforbackups.SoImexpectedtofloat halfofmyweekendIcantakeoffearlyonFriday,butIhavetocomein onSaturdayafternoonstoswaptaperacks. Toheckwiththat,Itoldmyboss.Iaskedifwecouldupgradetonewer drivesagain,andhesaidnowaytheseonesareonlyayearold.ThenI startedlookingatBackup2.0solutions,anddiggingintowhatsomeof themcost.IpresentedaplantouseaBackup2.0systeminstead,andto juststreamthebackupdatatotapeduringtheweek.Youknow,when wereallhereanyway.Well,itwasntthatexpensive,sohegotapproval. Nowwecanrecoverrightfromdiskbasedstorage.Tapesarejusta backupofthebackup,reallywehavetosendsomethingoffsitejustin case,sothatswhatthetapesarefor.AndIgetmywholeweekend. Again,agreatillustrationofrethinkingthings.Ofcourse,youcouldaccomplishmuchthe samethingwithadiskbasedBackup1.0systembutwithBackup2.0,ofcourse,youre gettingcontinuousdataprotection,pointintimerecovery,andsoforth,sowhynotgothat routewhilesavingyourweekend?

HeresanotherfollowupfromChapter2.Imactuallygoingtoreprinttheoriginalstory, becauseitsshortandcompelling: IhavebackupsinthreeversionsofSQLServer,indevelopment, production,andtestingenvironments,onmultipleservers.Lotsof backups,inotherwordsprobably45to50instancestotal,withasmany as45databasesperinstance.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Wegrabfullbackupseverynight,andtransactionlogbackupsevery15 minutes.Soourmaximumdataloss,ifeverythinggoesright,is15 minutes.Wetestourbackupsbyrestoringthefullbackupstoourtest environment.Thathelpskeepthetestenvironmentcloselymatchedto theproductionenvironment,whichisvaluableforthesoftware developers,andhelpsusmakesurethosebackupsareworking.Weroll lastweeksbackupsintoadifferentfolderandgrabthosetotape. WegetfailurenotificationsthroughemailandSystemCenterOperations Manager,andwerelyonmanualinspectionofbackupjobsandfoldersto makesureeverythingworks. Rightnow,weretryingtoplaywithdifferentbackupschedulesandlook atusingdifferentialbackups,alltolessenthenetworktrafficandthe drivespaceoccupiedbythemanyfullbackups.However,weneedto keepourrecoverytimesshort,soweretestingtoseehowmuch overheadthedifferentialsaddtorecoverytimes. Crazy,right?Itsalotofwork,butitsalsoanincrediblycommonscenarioforSQLServer, especiallyinsmallerandmidsizeenvironments.IheardbackfromthisreaderjustasIwas startingtoputthischaptertogether.TheyvegotBackup2.0,andthenewsisgood: IwasabletosellthebossonaBackup2.0solutionbasedonwhatyou hadwrittenaboutSQLServer,butevenIwasntpreparedforhowmuch easierthingsare.WesimplyshutoffallthenativeSQLServerbackups, includingthetransactionlogs.Westillmakeanativefullbackupevery week,justtokeepthelogstruncatedandtohaveastaticcopytosend offsite,butwerebackingupabout2000instancesofSQLServermost ofwhicharesmall,fromdevelopmentenvironmentscontinuously.We neverhavemorethanaminuteortwoofdataatrisk.Wedonthaveto monitorbackupjobs,wedonthavetocopybackupfiles,andwedont evenhavetomanuallyrestorestuff.Whenitcomestimetoupdatethe testenvironment,wejustpointthebackupserveratadestinationandhit go.Wecanprovisionthetestenvironmenttomatchanydatabase,at anypointintime. AnothercreativeuseofBackup2.0.Obviously,movingfrom15minutesatrisktoaminute ortwoisabenefit,nottomentionalotlessmanualmonitoringandeffort.Butbeingableto quicklyrestoreadatabasetoatestenvironmentisabigbonus,andbeingabletodosoto agivenpointintimemustopenupalotofreallyvaluabletestscenarios,nottomention lessentheoverheadofmanagingallthatbackupdata.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Patchesandhotfixescanbejustasmuchacauseforproblemsasusererror,serverfailure, andotherdisasters.Heresastorythatsomeofyoumayrecognize,andacreativeuseof Backup2.0tosolvetheproblem.Ivechangedtheantivirusvendornamebecausethe actualcompanyisntimportantthiscouldhappentoanyone. Werunabout100servers,allofwhichrunXYZantivirussoftware.That companyissuedapatchorupdaterecently,whichwedulyinstalled. Unfortunately,ourserversstartedworkingnotsowellafterthat.A coupleofthemshutdownandwouldntrestart,even.Notgood. Whileoneofmycoworkerswasonthephonewiththecompanystech support,andanotheronewithMicrosoft,Iheadedforthebackupserver. WehaveabackupsolutionthatworksliketheBackup2.0kindsthatyou describeitcopiesdiskblocksandtimestampsthem.Theproblemis,I didntwanttorestoretheentireserver;Ijustwantedtorestoreafew files.Ilookedatthepatchwehadappliedanditonlyupdatedfourfiles, soIwentintothebackupsystemandgotthefouroldfilesout.Theywere slightlydifferentfromservertoserverprobablydatafilesofsome kindsoIjustgotthemfromeachserversbackups.Theneatthingis thatwecandothisminutebyminute,soIwasabletogetthefiles exactlyastheywereJUSTbeforethepatchwasintroduced. Putthefilesontheirrespectiveservers,rebooted,andallwaswell.Oh, andwerestillwiththatsamecompanyforantivirus.Hopefully,itwont happenagain,butatleastnowwedonthavetoexplicitlymakeabackup beforeinstallingpatches. ThisisactuallyascenarioIdontrecallwritingaboutinthisbook.Youknow,theAlways BackupYourServerBeforeInstallingPatchesnoticethateveryhotfixorpatchorservice packcomeswith.Whodoesthis?Somecompaniesdo,Iknow,buteasilyjustasmanydont. Andyes,weallshould;itsjustthatbackupstakesolong.Ortheydid,untilBackup2.0. Now,yourserversarealreadybackedup,sotheresnoneedtoperformaspecificprepatch backup.Justdropthepatchesinplace,andifyoudontlikewhathappens,rollemback fromyourbackupconsole.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

AnotherhorrorstoryfromChapter2involvedacompanythatwasbackingupalotof duplicatedfiles,dueinparttotheiruseofDFSreplicas.Thatstoryconcluded: Istartedlookingintoit,andrealizedthatthecompanyhasbeendoinga lotofDFSreplicasabout50to60GBworthrightnow,andtheyre addingmoreallthetime.Thisisthesamedatabeingbackedupoverand overagainindifferentlocations.Allthatduplicateddataiswhatscausing theproblem.Istartedtryingtofigureoutexactlyhowmuchduplicated datawehavesothatIcouldmakeabusinesscasetomanagement.In doingso,Ifoundthatmanyofourfileservershavemultiplecopiesofthe samefiles,allonthesameserver.Alotofthetimeitcomesfromusers homedirectories:Thetwoserversthathostthe\\Company\UsersDFS nodehavetensofthousandsofduplicatedfilesbecauseusersdrag commonlyusedfilesintotheirownhomefolders. Wewerebackingupatotalof13.2TBofdata,andcloseto30%ofitwas duplicateddata.Onethird!Werecurrentlytryingtofigureouthowto excludetheduplicates,butitsactuallyverytrickywecantjustnot backupusershomefolders! Ifoundacolleaguewhohadbeeninasimilarsituation.HiscompanyhasbegunaBackup 2.0implementation,andtheyselectedasolutionspecificallyforitsabilitytocompressand deduplicatethebackedupdata.Iinterviewedhimtolearnmore,andhereswhathesaid: Wehavealotofduplicateddataonournetwork,too,muchofwhichisin userhomefolders.Butyouknow,evenifyoudonthaveexactly duplicatedfiles,everyoneprobablyhasalotofduplicatedataatthedisk blocklevel.Continuousdataprotectionsolutionscanoperateatthedisk blocklevel,sowelookedforonethatdeduplicatedatthatlevel,too. Illgiveyouaspecificexample:Justacrossourdozenorsofileservers,we havecloseto24TBofdata.Withouroldbackupsystem,wecould compressthat,andwegotabouta2:1compressionratio,orabouta50% reductionindatasize.Thatsstill12TBofdataanawfullottobackup. WehaveprettynewDLTtapedrives,andeachtapeholdsabout800GB, soIthinkwereusingacoupleoftapestopullafullbackupofallthat.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Wehadoneofourdeveloperswritealittletoolthatanalyzedduplication atthediskblocklevel,andthatswhatreallyjustifiedtheBackup2.0 expenditure:Histool(sorry,Icantshareit)suggestedthatwecould reduceourbackupsizebyatotalof80%byusingbothcompressionand deduplication.Thats24TBto480GB.Ithinkeveryonesjawshitthe table.Wecouldeasilyfitanentirefullbackupononetape,anditalso madeitalotmorelikelythatwedbeabletoaffordthediskbased storagethatBackup2.0solutionsrelyon. Acoupleofmonthslater,andthatsprettymuchthelevelofreduction wereseeing.Rightnow,wevegotfiveofthefileserversonthenew system,withatotalofabout15TBofdata,andwereseeingfullbackups occupyabout300GBofspace.Ofcourse,wereallyonlydothatonce, thenthesolutionjustgrabschangesfromthatpointon. Deduplicationisavailableinalotofways,includinginsomeBackup1.0stylesolutions. ButhavingitbuiltintoaBackup2.0solutionnotonlygivesyouthebenefitsofBackup2.0 butalsomakesitalotmorepracticaltoimplementbecauseyouremakingmuchmore efficientuseofthebackupsolutionsstorage. Iwanttopointoutthatyoushouldspecificallylookfordiskblockleveldeduplicationfor maximumsavings,ratherthanhigherlevel,filebaseddeduplication.Thelattercanonly saveyouspacewhenentirefilesmatchup,whereasdiskblockleveldeduplicationisalot morelikelytofindagreaternumberofduplicates.Figure12.4illustrateswhatthiskindof deduplicationwilllooklike.



The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Inapreviouschapter,Icautionedyouagainstusingyourbackupsystemasapermanent dataarchive.Backupsshouldbeusedtostoreonlyasmuchdataasyoudwanttobring backintoproductionuseafteraloss;theyrenotnecessarilyintendedtostoredatafor yearsandyears.ButIdidhaveonereaderwhodisagreed: Ihavetotellyouthatwevebeenveryhappywithournewcontinuous dataprotectionsolution,especiallyasitappliestoourExchangeServer. Infact,despiteyourcautiontonotusethesystemasapermanent archive,wehavefoundittobeverywellsuitedforjustthat. Ourcompanypolicyrequiresustokeepabout3yearsworthofemails, andweusedtoleavethatinformationinExchange.Needlesstosay,our Exchangedatabasesbecameprettyunmanageable.Wevedecided insteadtojustspendthemoneyondiskspaceforournewbackup solution,toletitkeepalotofhistoricaldata,andtotrimdownour productionExchangedatabases. Ourbackupsolutionsuserinterfaceactuallyhasexcellentsearch features,anditunderstandstheformatoftheExchangedatabases.So wereabletosearcharchivedmessagesrightfromwithinthebackup solution,andwevealreadyhadacoupleoftimeswhenwevehadto accessindividualmessagesfromacoupleofyearsinthepast.Because doingthatdoesnttouchtheExchangesystematall,ourproductionmail servershavebecomemuchmoreefficient.Werelookingtocreatesome kindoftieredstoragehierarchysothatwecankeepevenlongerperiods ofhistoricaldata,ifneedbe,andwethinkourbackupsolutionwill accommodateusinthat. Diskspaceisprettycheap,evenredundantserverbasedstorage.Alot cheaperthanitusedtobe,atleast.Soforusitsaneasyinvestmentto make. Whichjustgoestoshowthatyoucantanticipateeveryonesbusinesspriorities.Illadmit thataBackup2.0stylesolutiondoesofferacompellingargumentforsecondaryuseasan archive,ifyourewillingtodedicatethediskspacetoit.


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Finally,mylaststoryisonethatsprobablyalltoofamiliartothoseofyouwhohaveto answercallsfromyourusers.IthinkitsagreatexampleofhowtoreallyputBackup2.0to cleveruse,too. WeuseaBackup2.0stylesolutiontobackupallourvirtualservers.Now, wedosomethingabitdifferentthanwhatsomeothersmightdo.Weput ourbackupagentinsidethevirtualmachine,andwebackupeverything thatway,butwealsobackupthevirtualmachinediskfilesthemselves.I know,itsredundant,buttherearecaseswhereitcomesinveryhandy. Perfectexample:Afewmonthsback,wehadausercallandtellusthat thepayrollsystemwasoffline.Wefiguredoutprettyquicklythatitwas duetosomecorrupteddatabasesthishashappenedbeforebutwe werealittleunsureofhowfarbackwecouldrollthedatabase,andwe franklywerentevensurewhichfilesweneededtorestore.Thesystem usesaproprietarydatabaseengineandthedataisspreadacrosswhat seemslikeamillionfiles. Anotheradminwasworkingthisproblem,andhewastryingtofigureout exactlywhichfilestopullfromthebackupsystem.Ifoundhimdigging throughthefileslist,andaskedwhatwasup.Heexplainedthesituation, andIsaid,Youknowwhat?Letsjustblowawaythewholevirtual machine.Helookedblank,thenrememberedthatBackup2.0madethat prettyeasy. Nowhereswhywebackupboththeinsideofthevirtualmachineaswell asitsdiskimages.ChoiceAistorestoretheinsideofthevirtual machine,basicallyrollingitbackasifitwasaphysicalmachine.Thatcan takeawhilebecauseyouregettingtheslowerdiskI/Oofthevirtual machine.Inthiscase,timewasafactor,sowerolledbacktheoutside ofthevirtualmachinethatis,itsdiskimages.Muchfasteroperation lessthan20minutes,ifIremembercorrectly. Agoodexampleofhowdifferentformsofbackupscanmeetdifferentneeds!


The Definitive Guide to Windows Application Server and Backup 2.0

Don Jones

Well,thereyouhaveit.Hopefullythesestorieshavegivenyousomeideasabouthow Backup2.0cansaveyoutime,money,andanguish,andhopefullythe11preceding chaptershavehelpedyouunderstandhowBackup2.0canfitintospecificnichesofyour organization. Inafewyearstime,ImbettingwellseemoreandmorecompaniesadoptingaBackup2.0 stylecontinuousdataprotectionsolution.Infact,itwontbelongbeforeBackup2.0is simplythestandardthateveryoneuses.Werecertainlyseeingmoreandmorevendorsin thisspace,providingavarietyofsolutions,whichindicatestheyrepayingcloseattentionto businessesneeds. Ifnothingelse,thisbookshouldhavepreparedyoutobeasmartershoppersothatwhen youstartevaluatingBackup2.0stylesolutions,youknowwhatfeaturestolookfor,whatto prioritize,andwhatyourbusinessfullrangeofneedsislikelytobe. Aboveall,IhopeyouveenjoyedreadingthisbookasmuchasIveenjoyedwritingit.Thisis thelongestbookIvewrittenforRealtimePublishers,andIwanttothankthemfor publishingit,andIwanttothankthebookssponsorfornotonlymakingthisproject financiallyviablebutalsoforgivingmethefreedomtoreallytelltheBackup2.0storythe wayIwanted. Goodluckwithyourbackups!