Sie sind auf Seite 1von 45

CONTRALORIAGENERALDE ANTIOQUIA

CAPACITACINENGESTIN AMBIENTAL

MODULOILEGISLACIN AMBIENTALENCOLOMBIA

AO 2009

TABLADECONTENIDO

1.ANTECEDENTES 2.POLITICANACIONALAMBIENTAL 3.ELDERECHOAMBIENTALENCOLOMBIA 3.1ReseaHistricadePolticaAmbientalenColombia 4.LACONSTITUCINPOLITICA 5.MECANSMOSDEPARTICIPACIONCIUDADANA 5.1AccindeTutela 5.2AccindeCumplimiento 5.3AccindeNulidad 5.4DerechodePeticin 5.5AccinPopular 5.6AccindeGrupo 5.7DerechodeIntervencin 5.8AccionesPblicas 5.9VeeduraCiudadana 6.LEY99DE1993YSUREGLAMENTACIN 14 6.1PrincipiodePrecaucin 6.2TiposyEstructuraJerrquicadeNormasAmbientales 6.3SistemaNacionalAmbiental(SINA) 6.4MinisteriodeMedioAmbiente 6.5EntidadesCientficasydeInvestigacinAdscritasalMedio Ambiente 6.6ConsejoNacionalAmbiental 6.7CorporacionesAutnomasRegionales 6.8EntesTerritorialesyPlanificacinAmbiental 6.9FuncionesdelosDepartamentos 6.10FuncionesdelosMunicipio,DistritosyTerritoriosIndgenas 6.11PlanificacinAmbientalEntidadesTerritoriales 7.NormatividadporRecursos 7.1RecursoAire 7.2RecursoAgua 7.3FloraTerrestre 7.4FaunaTerrestre 9 9 10 10 11 12 13 13 13 14 3 4 4 6 7

14 15 15 15 16 17 17 19 19 19 20 21 21 26 33 37

8.LICENCIASAMBIENTALES 9.CONCLUSION 10.BIBLIOGRAFIA 43

38 42

1. ANTECEDENTES ElsigloXXyloquellevamosXXIsonaosmarcadosporlaeconoma.Lavisin econmica del mundo y las relaciones entre las personas domina sobre las dems. Enestosaossehanmultiplicadomsde20veceslosbienesproducidosporla humanidad. La repercusin que los avances cientficos y tcnicos de los ltimos decenios han tenido sobre las condiciones de vida ha sido impresionante e inimaginablehacesolounasdcadasEstosehanotadosobretodoenelaumento de la duracin de la vida que ha sido de casi treinta aos desde comienzos del 1 siglo X X a la actualidad. El gran objetivo que ha motivado al mundo ha sido el desarrolloeconmico. Durante muchos siglos la temtica ambiental fue ignorada por el mundo el hombre no se preocupo por la ecologa, ellos crean que los recursos naturales eraninagotablesyquelatierrasepurificabaasimismaluegodelacontaminacin producidaporlaactividadhumana. Esta situacin fue cambiando cuando se vieron enfrentados al deterioro de la calidaddevida,habidacuentadeldesarrollo: Explosindemogrfica Contaminacinalaatmsfera,recursohdrico,efluentesindustriales. Desechosurbanos. Hacinamiento. uidosmolestos. R Paisajesdesagradablesy Malosolores.

Elfenmenoeconmicodelprogresoapartirdela iencia C ecnologa T Actividadesindustriales


1

ECHARRILUIS,Poblacin.EcologayAmbienteUniversidaddeNavarra(ESPAA)(Capitulo11 Repercusionespolticas,econmicasysocialesdelosproblemasambientalesp3.2007.

EltemadelambienteregistraantecedentesdesdelaantigualaRoma,perocomo Derecho(comodisciplina),comounbienquenecesitasertuteladoyprotegidopor un ordenamiento jurdico slo se reconoce en la dcada de los 60, cuando despusdevarioslustrosdeeuforiaeconmicacomienzaasentirselaamenaza a los ecosistemas, convirtindose en grave peligro para el futuro de la especie humana, cuyo origen es la determinada actitud del hombre respecto de la naturaleza. Como el problema ambiental ha superado el mbito social y econmico, se ha convertido en un problema poltico, y como consecuencia de ello, penetrando el mbitojurdicodandoorigenensentidomodernoalDerechodelMedioAmbiente comodisciplinaenlosaos70luegodelaConferenciadeEstocolmoycomouna respuesta, todava no muy eficaz a la problemtica ambiental del planeta, y surgiendoaslavaloracinpolticayjurdicadelhechoecolgico.Sibiensepuede afirmar que el derecho no es lo suficientemente idneo para proteger el medio ambiente, sera injusto desconocer que es un factor de proteccin e igualmente pensareneliminarloydejarsuproteccinsujetoalasleyesdelmercadoserauna posturaequivocada.Lanormaconvierteenpautagenerallaausenciadeacciones contrarias a la naturaleza, disponiendo sanciones efectivas e incentivos eficaces dentrodeunapolticacoherente. 2.POLITICAAMBIENTALNACIONAL A raz de todos los problemas enunciados en el capitulo de antecedentes se presento la necesidad de focalizar estratgicamente la Poltica Ambiental Nacional,orientndolaexclusivamentehaciaellogrodelasostenibilidadambiental del capital natural de la nacin, de manera que se garantice, por un lado su autonoma frente a las dems polticas pblicas para orientar la funcin de AutoridadAmbiental2 yporotroladosutrasversalidadatodasellas,paraorientar las estrategias de conservacin, restauracin y aprovechamiento sostenible de dichocapitalnatural. As, la Poltica Ambiental Nacional, podra ser redefinida como el conjunto de practicas,instituciones,ydeterminacionesdeunanacin,orientadasagarantizar lasostenibilidadambiental,entiempoyespacio,delcapitalnaturaldesuterritorio, yporlotantoserasimiladaaunvectordesostenibilidadambientaldelterritorio, que siendo complementario en su finalidad con todas las polticas pblicas enla bsqueda del desarrollo sostenible, responda a una visin de pas y a unos

Bajoelenfoquedelagestinambientalsistmica,lasaccionesdeautoridadambientaltieneque ver con el monitoreo y seguimiento de la calidad, cantidad y disponibilidad del los recursos del capital natural, con el seguimiento y control a los factores y/o agentes de presin por uso y/o deteriorodedichosrecursosyconlaadministracinymanejoambientaldelosrecursosdelcapital natural[VegaMespecficosqueregirnlaPolticaora,2001]

3 principios , este orientado al objetivo general de garantizar la sostenibilidad ambientaldelterritorioypuedasermaterializadoatravsdeunmarcoinstitucional adecuado.

3.ELDERECHOAMBIENTALENCOLOMBIA Colombia, ha sido catalogado como un pas pionero en el desarrollo y establecimiento de normas ambientales, surgiendo el Cdigo de Recursos Naturales (1974) y el Cdigo Sanitario Nacional (1979) sin embargo existen referentes normativos de carcter Ambiental desde el 1887, en el denominado Cdigo de Cundinamarca, que luego se convirti en el Cdigo Civil Colombiano encualhallamoslossiguientestextosquedemaneraincipientetratabanalgunos temas con un matiz ambiental. Como veremos los siguientes artculos: Artculo 994 del Cdigo Civil Colombiano: No se poda adquirir porprescripcin las obras quecorrompanelaireylohaganconocidamente,daoso. Proyectodecapacitacinengestinambientalparaunaproduccinmslimpia4 Artculo1005delCdigoCivilColombiano:Cualquierpersonaolamunicipalidad, podrn instaurar las acciones populares, como si fueran dueos los caminos. Artculo2359delCdigoCivilColombiano:Seconcedaaccinentodosloscasos de daos contingentes que amenace a personas indeterminadas o determinada. Artculo 918 del Cdigo Civil Colombiano: Uso de las aguas pblicas, si pasaba por una heredad le poda dar el uso domstico necesario sin necesidad de concesin. Artculo889delCdigoCivilColombianoconcesindeaguas. En1919laLey119Leyparcialdebosques. aley113de/18aguasyenerga. L ecretoLey1940,merceddeaguasyusos. D Ley2de1959,reservasforestales. 954CrearonlasCARSdelCAUCA,1960lasdelValle,Sin, 1 1961SabanadeBogota. 968laReformaSENA,EMPRESASPBLICAS,INDERENA 1 As se fue desarrollando el Derecho Ambiental en Colombia hasta en 1991, cuando con la Reforma Constitucional, se incorpor el tema Ambiental como PolticadeEstadoyfueascomoseconsagraronalolargodemismapreceptos de proteccin al medio ambiente y se desarrollaron varias principios

Los principios especficos que regirn la Poltica Ambiental Nacional debern ser derivados en concordanciaconlaDeclaracindeRo,conlaConstitucinNacionalyconelArtculo1delaLey 99 /93, Adicionalmente, de acuerdo con lo planteado, resultara pertinente incluir dos nuevos principiosdelapolticaambiental:elprincipiodeautonomayelprincipiodetransversalidad.

fundamentales y normas que han permitido afirmar que nuestra constitucin PolticaesEcolgicadesarrollandomasde34artculosdentrodesutexto. En Colombia los ministros cumplen un papel muy importante ya que son las manosderechasdelpresidente,losGobernadoresylosAlcaldes. AniveldeGobernacinylasalcaldasseencuentranlosSecretariosdedespacho quienessonagentesdirectosparacumplirlosplanesdegobiernoydedesarrollo. Es a travs de las leyes, cdigos y estatutos que el congreso manifiesta su voluntad. En la parte Nacional la legislacin la saca el congreso, para el departamento la asambleayparaelmunicipioelconcejo. Lasasambleaslosactosqueemitenseconocencomoordenanzas,losconcejos sacanacuerdosquesonsolamenteparasuorbita,losalcaldesemitenoficiosque rigenensuorbita. 3.1RESEAHISTORICADELAPOLITICAAMBIENTALENCOLOMBIA: (1887) Cdigo Civil Colombiana Se encuentra vigente y ac se encuentran las acciones populares, en esta poca se utilizaban para garantizarloscaminosreales(vaimportante),tambinestabacontemplada las concesiones de agua, se entiende que el agua es de dominio privado cuandonaceymuereenelmismopredio (1959)SecrearonlasCorporacionesAutnomasRegionales (1974)EnColombiasecreaelCdigodeRecursosNaturales,luegodela convencindeEstocolmo,trataaldetallemuchosrecursosagua,aire,flora yfauna,eslanormapioneradelegislacinambientalenelmundo. (1991)ConstitucinPolticadeColombia Cambiolanormaambientalse denominalacartamagna,eseltododeunestadoArt79y80habladela vidaqueesloambiental

ElestadoColombianoesparticipativoydemocrtico,dalaoportunidaddequelas desicionessetomenenconsenso,laconstitucinesparticipativa. PRINCIPIOSGENERALESAMBIENTALES:LaPolticaAmbientalColombiana seguirlossiguientesprincipios: l proces de desarrollo econmico y social se orientar segn los principios E universalesdeldesarrollosostenible. a biodiversidad del pas por ser patrimonio nacional y de inters de la L humanidad deber ser protegida prioritariamente y aprovechada en forma sostenible.

apolticadelaprobacintendrencuentalosderechosdelossereshumanos L aunavidasaludable,productivayenarmonaconlanaturaleza. Las zonas de paramos, subparamos, los nacimientos de agua y las zonas de recargosdeacuferossernobjetodeproteccinespecial. n la utilizacin de los recursos hdricos, el de consumo humanos tendr E prioridadsobrecualquierotrouso a formulacin de polticas ambientales tendr en cuenta el resultado de la L investigacincientfica.Noobstantelasautoridadesambientalesylosparticulares darnaplicacinalprincipiodeprecaucinconformealcualcuandoexistapeligro de dao grave e irreversible, la falta de certeza cientfica absoluta no deber utilizarse como razn para postergar la adopcin de medidas eficaces para impedirladegradacindelmedioambiente. lEstadofomentarlaincorporacindecostosambientalesyelusode E instrumentos econmicos para la prevencin, correccin y restauracin del deterioroambientalyparalaconservacindelosrecursosnaturalesrenovables. lpaisajeporserpatrimoniocomndeberserprotegido. E Laprevencindedesastresdeberserdeinterscolectivo,ylasmedidaspara evitaromitigardeobligacincumplimiento. aaccinparalaproteccinyrecuperacinambientalenunatareaconjuntadel L estado,lacomunidad,lasorganizacionesnogubernamentalesyelsectorprivado. El estado apoyar la conformacin de organismos no gubernamentales y podr delegarfuncionesdeellas. Losestudiosdeimpactoambientalsernuninstrumentobsicoparalatomade decisiones respecto de la construccin de obras y actividades que afecten significativamenteelmedioambientenaturaloartificial. Elmanejoambientaldelpasserdescentralizado,democrticoy participativo. araelmanejoambientaldelpasseestableceelSISTEMANACIONAL P AMBIENTALSINA. 4.LACONSTITUCINPOLITICA Tiene su origen en el siglo XIX en los congresos de angostura y Ccuta. La convencin en Rionegro en 1863 promulga una nueva carta fundamental que terminaconlaConstitucinexpedidaen1886lacualrigepormsdeunsiglo.En 1991 la Asamblea Nacional Constituyente expide la actual Constitucin que fue sancionadaporelentoncespresidenteDr.CesarGaviriaTrujillo. La actual constitucin solo ha tenido tres reformas durante los cinco aos de vigencia que estn contenidos en los actos legislativos 1,2 y3 de 1993. Estas reformassolamenteestnlimitadasaaclararyadicionaralgunasnormas,perono cambianlosaspectossustancialesdelacarta. LaConstitucinvigenteacogelaproteccinalmedioambientedesdevarias

perspectivas: odelodedesarrollosostenible,imposicindeldeberdeprotegerlosrecursos M naturales por los particulares y el Estado, lo cual permite limitar el ejercicio de determinados derechos, sobre todo de los econmicos, de la propiedad y la iniciativaprivada. Reconoceelderechocolectivoadisfrutardeunmedioambientesano,cuyo titulareslacomunidad. articipacinciudadanaenlaproteccindelmedioambiente. P Unaltogradodeautonomaenlasautoridadesambientales. Desdelapticadelaimportanciadeprincipiosyderechosprotegidosenmateria AmbientalenlaConstitucinPolticaanalizaremoselartculos79y80ylos mecanismosdeParticipacinCiudadana. Estederechoesnuevo,seconsideraunderechohumanobsicoyenopininde algunos,comounprerrequisitoparaelejerciciodeotrosderechoshumanos, econmicosypolticos. Un ambiente sano es una condicin sine qua non de la vida misma, ningn otro derecho puede desarrollar se en un ambiente alterado. Un razonable nivel de calidad ambiental es un valor esencial para asegurar la supervivencia no solamentehumanasinodetodalabiosfera.Loconstituyenlassiguientes manifestaciones: 1 Lavidaylasaludpersonalesnoseanlesionadosopuestosenpeligro comoconsecuenciadelacontaminacinoeldeterioroambientalprotegela integridadfsica. Unrazonableniveldecalidadambiental,aunquenoseaconocidoelagente quecontamina,tardeotempranounagravecontaminacindelambiente amenazalavidaylasalud. Disfrutardeunpatrimonioambiental. Proteccindelapropiedadprivadadeeventualesdaoscausadospor contaminacinoperturbacionesambientalesprovocadosporterceros.

2.

3. 4.

DERECHOFUNDAMENTAL:Sonpropiosdelhombre. Este derecho se extiende a la proteccin de todas las dimensiones necesarias paraelequilibriodelmedioenelcualsedesarrollalavida,Porlotantoincluyela vidahumana,laanimal,lavegetal,lademicroorganismosylaregulacinsobrelos recursos que existen en la naturaleza y que permiten el desarrollo de la vida misma.

Art.80DesarrolloSostenible. Darlebuenusoalosrecursosnaturalespara laconservacindelasgeneracionesfuturas Satisface las necesidades de la generacin presente sin comprometer la capacidad de las generaciones futuras para satisfacer sus necesidades. Los desarrollos econmicos y sociales se deben definir desde la sostenibilidad en todoslospasesseandesarrolladosoendesarrollo. CaractersticasdeunDesarrolloSostenible(PrincipiodeIgualdad) Sostenibleensentidofsico:Eslapreocupacinporlaigualdadsocialentrelas generaciones. Requierelasatisfaccindenecesidadesbsicasdetodaslasgeneraciones, incluyendolaaspiracinaunavidamejor. Requierelapromocindelosvaloresquealimentennivelesdeconsumo quepermanezcandentrodeloslmitesdeloecolgicamenteposibleya losquetodospuedanaspirarrazonablemente. Laevolucindemogrficaenarmonaconelambientepotencial productivodelecosistema. Eldesarrollonodebeponerenpeligrolossistemasnaturalesque sostienenlavidaenlatierra:Atmsfera,lasaguas,lossuelosylosseres vivos. Requierelaconservacindeespeciesmineralesyvegetales.

5.MECANISMOSDEPARTICIPACINCIUDADANA. NuestraConstitucintrajoconsigounaconcepcindeEstadoparticipativolocual permeo todo el desarrollo normativo en materia ambiental de ah que encontramos los siguientes mecanismos como herramientas que garantizan la participacinciudadanaentemasambientales. Los derechos consagrados sin ningn mecanismo autntico de proteccin no dejardeserunavagaexpresinconvalormeramentesimblico.LaConstitucin y la Ley previeron los siguientes mecanismos de proteccin: La Tutela, Las Acciones populares, la Accin de cumplimiento, El Derecho de Peticin, las Audiencias pblicas, Participacin en los procesos ambientales, Las Consultas Obligatorias a las Comunidades Negras e Indgenas, la Publicidad de las Actuaciones Administrativas Ambientales y La accin de Nulidad contra actos administrativosAmbientales.Mecanismosqueveremosenmanerasuscinta. 5.1ACCINDETUTELA: Artculo86delaC.P.yDecreto2591de1991y 306/82.

Toda persona tendr derecho, en todo momento y lugar mediante un procedimiento preferente, por si o por interpuesta persona, a la proteccin inmediatadesusderechosconstitucionalesfundamentales,cuandoestosresulten vulneradosoamenazadosporaccinuomisinporcualquierautoridadpblica. Estaaccinesunmedioparapediralosjuecesquedefinan(tutelen)rpidamente sus derechos fundamentales en caso de amenaza inminente o violacin por autoridades pblicas o particulares haciendo cesar los hechos amenazantes o violatorios. Algunos de ellos son el derecho a la vida ano ser sometido a desaparicin forzosa, a tortura ni a tratos o penas crueles, inhumanos o degradantes a la dignidad humana, a la igualdad a la libertad al honor, a la intimidad el buen nombre y la honra a poder adquirir derechos y obligaciones segnlaLeyanoservictimadelaesclavitudentreotro. La accin de tutela no requiere de abogado para interponerse, se recibe en un juzgado y tribunales del lugar de la amenaza o violacin. En caso urgente se puede formular de palabra, as cuando la interpone un menor o quien no sabe escribir. La accin debe narrar los hechos violatorios o amenazantes, tener las pruebasopedirquesepractiqueysuministrarlosdatosdequiensesealacomo 4 violadoroamenazadordelosderechos. lfalloserdeinmediatocumplimientopodrimpugnarseyentodocaso E seremitirparasueventualrevisin. Soloprocedecuandoelafectadonodispongadeotraaccinjudicial. Nopodrtranscurrirmsde10das. Eventualmente se utiliza para proteger el medio ambiente cuando se esta en conexidadconelderechoalavidaylasalud,ocuandoseusacomomecanismo transitorioparaevitarunperjuicioirremediable. 5.2ACCINDECUMPLIMIENTO:Articulo87delaC.P.yLey393dede1997. Toda persona podr acudir ante una autoridad judicial para hacer efectivo el cumplimiento de una ley o un acto administrativo. Sobre todo cuando se le ha pedidoysehanegadoexplcitamenteacumpliro,sinhaberresueltolasolicitud, nocumpledentrodelos10dassiguientesalrequerimientosoloprocedecuando losderechosquesequierenprotegernopuedendefenderseconlatutela,cuando no hay ni ha habido otros mecanismos para acudir a los jueces y tribunales, buscandoelcumplimientodelanormaoactoadministrativonicuandoelechode cumplirconllevagastosparalaentidadoautoridad.. asentencialoqueordenaeselcumplimientodeldeberomitido. L resentadalademandaeltramiteseadelantaenformaoficiosa,economa P
4

PROGRAMAPRESIDENCIALDELUCHACONTRALACORRUPCION,Herramientasparael ejerciciodelControlCiudadanop1782003

10

celeridad,eficaciaygratuidad. Quienespuedeninstaurarla: ualquierpersona C Losservidorespblicos:Procurador.Defensordelpueblo,Personeros, Contralores. Lasorganizacionesnogubernamentales. Sepuedeinstaurarencualquiertiempo. 5.3ACCINDENULIDAD: Artculo73delaLey99de1993.Art.14dec. 2304/89 Todapersonapodrsolicitarpors,opormedioderepresentantequesedeclare la nulidad de los actos administrativos, Proceder no solo cuando los actos administrativos infrinjan las normas en que deberan fundarse sino tambin cuandohayansidoexpedidosporfuncionariosuorganismosincompetentes,oen forma irregular, o con desconocimiento del derecho de audiencias y defensa, o mediante falsa motivacin, o con desviacin de las atribuciones propias del funcionarioocorporacinquelosprofiri. Procede contra actos administrativos por los cuales se: Expide., modifica o conceden permisos, licencias, autorizaciones y concesiones a una actividad que afecteopuedaafectarelmedioambiente. Paraestoscasosserequiere: Actoadministrativodecontenidoparticular Lopuedeinstaurarcualquierpersonasindemostrarintersjurdicoalguno. Notieneunprocedimientoespecial. Loespecialessiaplicaparaactosdecarcterparticular. ademandanecesitapruebaquedemuestreelactoafectaopuedeafectar L elmedioambiente. Tieneunacaducidadde2aos. 5.3DERECHODEPETICIN: Artculo23delaC.P.,artculo74delaLey99de 1993ylaResolucin33de1996.Art5a26,33 Y 75 del Codigo Contencioso Administrativo (CCA),16DEC2150/955dec266/00. Toda persona natural o jurdica tiene derecho a acceder a informacin sobre el monto de los recursos y destinaciones de los mismos en temas ambientales, a formularpeticionesdeinformacinenrelacinconloselementossusceptiblesde producircontaminacinylospeligrosquepuedaocasionar.

11

El derecho de peticin genrico tiene tres formas especificas: quejas, reclamo, consulta. Dado que los dos primeros sirven para que los particulares den una informacinalEstado. Desdesumomentoderadicacin(confechayhora),lasautoridadestienenestos plazospararesponde:10dashbilesparalaspeticionesdeinformacinycopias dedocumentos(quepagarquienlospide),15paraquejasyreclamos,y30para consultas, al recibirlas deben solicitar al peticionario quelas complete siles falta algo. LaResolucin33de1996creelGrupodeQuejasyReclamosyregulolos siguientestemas: Peticionesengeneral15das. Informacinenrelacinconlaaccindelministeriodelmedioambiente. Solicituddecertificacinlegalmentecorrespondida. consultasverbales,oescritassobrelosfinesasucargo,losreclamos porelmalfuncionamientodelosservicios. Laspeticionespuedenserrechazadasenlossiguientescasos: 1. 2. Cuandosepresentaenformairrespetuosautilizandoamenazasofrases impropias,insultos,ofensasprovocadas. Cuandosearecurrentelamismapersonayyaselehayadirigidorespuesta sobreelmismoasunto.Enestoscasosdebeexpresarselarazndel rechazo.

5.4ACCIONESPOPULARES:Artculo88delaC.P.yLey472de1998. Creadasporexcelenciaparaprotegerlosderechoscolectivosydelambiente, relacionadoscon: Patrimonio LaLibrecompetencia Laseguridad. Lasaccionesoriginadaspordaosaunnmeroindeterminadodepersonas. Elambiente. Espacio. Lasalubridad Lamoraladministrativa. Enlasaccionespopularesquesurgidasdelaviolacindelderechocolectivoala moralidadadministrativaesdecir,lasqueseinterponganporcasosdecorrupcin, eldemandantetendrderechoarecibirel15%delvalorquerecuperelaentidad,

12

enraznalaaccinpopular.Enmateriaprobatorialosciudadanospodrnpediry obtener copia autentica de los documentos referidos a la contratacin, en cualquiermomento.Nohabrreservasobretalesdocumentos. AlincluirenlaCartalaproteccinalmedioambiente,esunpasofundamentalen eldesarrollodel nuevo derecho solidario eldao ambiental,losperjuicios delos consumidores,defensadelascomunidadesensuintegridadfsicaylosdaosque se les causen a las mismas por el ejercicio abusivo de la libertad econmica. Estas acciones son consideradas como REMEDIOS COLECTIVOS FRENTE A LOSAGRAVIOSYPERJUICIOSPUBLICOS Con esta accin se dot a los particulares de un instrumento para poner en movimiento al estado en la misin de dirimir los conflictos que se pueden presentarodeevitarlosperjuiciosquepuedasufrirelpatrimoniocomn. Con la preeminencia de esta accin se irradia una nueva dinmica al derecho pblicocolombiana,esdecirquedejarondeestarenelolvidoylosjuecesdeben deocuparsedeellasconmayorefectividad.Nosirvenparaperseguirlareparacin subjetiva de eventuales daos que pueda causar la accin o la omisin y son preventivas.

5.5 ACCIONESDEGRUPO:Art.88CPyley472/98 Se interponen mediante abogado por un conjunto no menor de 20 personas que renen condiciones uniformes respecto de una misma causa, que les ocasiono daos individuales, condiciones que tambin deben darse respecto de los elementos que configuran la responsabilidad. La accin de grupo se ejerce para obtenerelreconocimientoypagodelaindemnizacindeperjuicios. Se debe ejercer dentro de los dos aos siguientes a la ocurrencia del dao por quienes estn en las condiciones descritas, pero tambin pueden hacerlo el defensordelpuebloylospersoneros.Seinterponeantelajurisdiccincontencioso administrativasielperjuiciofuecausadoporunaentidadestatalounparticularen ejerciciodefuncionesadministrativas,dandolosdatosdelosaccionantes,elvalor estimadodelperjuicio,lademostracindelacondicindegrupoquelaLeyexige, loshechosdelademandaylaspruebasquesetenganosequieranpedirquese aportenalcaso. Caractersticas Nohacenrelacinexclusivaalosderechosfundamentalesconstitucionales, ninicamenteaderechoscolectivos.

13

Protegederechossubjetivosdeorigenconstitucionalolegal,peroaqu debedemostracinoexistenciaelperjuicioodao. Sepretendereivindicaruninterspersonal,conelobjetodeobteneruna compensacinpecuniariaparacadaunodelosdelgrupo.

5.6.DERECHODEINTERVENCIN:Artculo69y70delaLey99de1993. Cualquier persona, natural o jurdica, privada o pblica, sin necesidad de demostrar inters jurdica, podr intervenir en las actuaciones administrativas iniciadasparalaexpedicin,modificacinocancelacindeunalicenciaambiental, permisosqueafectenopuedanafectarelmedioambiente,oparalaimposicino revocacindesancionesporincumplimientodenormasambientales. 5.7AUDIENCIASPBLICAS:Artculo72delaLey99de1993. Los Procuradores, El defensor del pueblo, el Ministro del Medio Ambiente, las dems Autoridades Ambientales, los Gobernadores,los Alcaldes, o por o menos 100personaso3entidadessinnimodelucrocuandosedesarrolleopretenda desarrollar una actividad que pueda causar impacto al medio ambiente o los recursosnaturalesrenovables,yparalacualseexijapermisoolicenciaambiental, podrn solicitar la realizacin de una audiencia pblica que se celebrar ante la autoridadcompetenteparaelotorgamientodelpermiso. Secelebraraconanterioridadalactoquepongafinalaactuacin. Lacitacinlarealizarlaautoridadantelacualsepresentalasolicitud. 5.8VEEDURACIUDADANA:Ley850de2003. Mecanismo democrtico de representacin que le permite a los ciudadanos u organizaciones comunitarias ejercer vigilancia sobre la gestin pblica, privada, ONG,funcionandodadaunodepretensindeunserviciopblico,lavigilanciaes preventiva les esta prohibido: retrasar, impedir, o suspender programas o proyectoslavigilanciadebelimitarseslosobrelagestinpblica. 6.LALEY99DE1993YSUSREGLAMENTACIN La ley 99de 1993, desarrolla postulados ambientales dela Constitucin Poltica, losprincipiosyvaloresambientalesencaminadosaredefinirlasrelacionesentreel hombre y el medio natural y las funciones y el papel del Estado con respecto al medio ambiente y el desarrollo sostenible, generando un marco de poltica ambientalenColombia. 6 .1PRINCIPIODEPRECAUCIN:

14

Naci en Alemania, los aos 70, con el fin de precaver los efectos dainos o nocivos a la vida humana, de los productos qumicos, cuyos daos slo pueden observarse 20 o 30 aos despus, efectos sobre los cuales se dificultaba exigir certezacientfica. Enlaactualidadestaenplenadiscusinelpuntodecertezacientficaenmateria de los organismos genticos modificados o transgenticos es decir cualquier organismo vivo que posee una modificacin nueva de materia gentico que se hayaobtenidobajolabiotecnologamoderna.LauninEuropea,CoreayJapnse opone a que se abra este comercio aduciendo el principio de precaucin. Sin embargo nuestra Corte Constitucional manifest que al leer detenidamente el artculo, sellega a la conclusin, que cuando una autoridad quiera hacer uso de este principio debe tener en cuenta el cumplimiento de la totalidad de los siguientesrequisitos: 1.Queexistapeligrodedao. 2.Queesteseagraveeirreversible. 3.Queexistaunprincipiodecertezacientficaasnoseaabsoluto. 4. Que la decisin de la autoridad ste orientado a impedir la degradacin del medioambiente. 5.Queelactodebeserexcepcionalymotivado,ycomocualquierotroactopuede serdemandado.

6.2TIPOSYESTRUCTURAJERARQUICADENORMASAMBIENTALES. NormasqueconsagranPrincipiosyValoresambientales. Normasquereconocenderechoshumanos,ambientalesy/ocolectivos. NormasdePoltica,planificacinyGestinAmbiental. Normastcnicas. Manejo,uso,aprovechamiento,explotacin,conservacin,proteccin, preservacinyrestauracindelosrecursosnaturalesrenovables. Controlestecnolgicos,controlesdecontaminantes,ycontrolesde productosyprocesosproductivos. Normaspreventivasysancionatorias,policivosy/openales. Normasqueconsagranprocedimientosadministrativosy/ojudiciales. 6.3SISTEMANACIONALAMBIENTAL(SINA) Concibe la recuperacin y proteccin delo ambiental como una tarea conjunta y coordinadadelEstado,lacomunidad,lasorganizacionesnogubernamentalesyel sector privado. Es el conjunto de orientaciones, normas, actividades, recursos,

15

programas e instituciones que permiten la puesta en marcha de los principios generalesambientalescontendidosenlaLey99de1993.

El Ministerio del Medio Ambiente, es quien dirige y coordina el proceso de planificacin y ejecucin, armnica de las actividades, de las entidades que integran el SINA, siendo el rgano central, a partir del cual se desarrolla la estructura. IntegrantesdelSINA: MinisteriodelAmbiente,ViviendayDesarrolloTerritorial. CARS. Departamentos MunicipiosoDistritos. Estenuevoordenjurdicotiene3caractersticas: 1.Esexclusivoparaaspectosambientales. 2.Esjerrquicohaysuperiorysubordinados. 3.Esdescendente:Amedidaqueserelacionanlasautoridadesambientalesla jerarqua desciende de mayor a menor. Esto quiere decir que una resolucin u ordenenmateriaambientaldeuninferiorpuedeserapeladaantesusuperior. 6.4MINISTERIODELMEDIOAMBIENTE Este Ministerio fue creado por la Ley 99 de 1993, artculo 2 como organismo rector de la gestin del medio ambiente y de los recursos naturales renovables, encargado de impulsar una relacin de respecto y armona del hombre con la naturaleza y definir, la poltica y las regulaciones a las que se sujetaran la recuperacin, conservacin, proteccin, ordenamiento, manejo uso y aprovechamiento de los recursos naturales renovables, a fin de asegurar el desarrollosostenible. Acontinuacinveremosalgunasdelasfuncionesestablecidasenelartculo5de alLey99de1993: Formula la Poltica Nacional del medio ambiente y los recursos naturales, criteriosdelordenamientoambientaldelusodelterritorio. Regularlascondicionesgeneralesparaelsaneamientodelmedioambiente,uso, aprovechamiento, manejo, conservacin restauracin, recuperacin de los recursosnaturales. PrepararelordenamientoambientaldelterritorioconlaasesoradelPlaneacin Nacional.

16

Establecer los criterios ambientales que deben ser incorporados en los planes sectorialesyenlosotrosministerios,previaconsulta. Formular, conjuntamente con el Ministerio de Salud, la Poltica Nacional de poblacin, promover y coordinar el control de crecimiento demogrfico y hacer seguimientotelasestadsticasdemogrficas. Formular conjuntamente con el Ministerio de Desarrollo Econmico la poltica nacionaldeasentamientoshumanosyexpansinurbana. Determinar las normas ambientales mnimas y las regulaciones de carcter general sobre medio ambiente a las que deben sujetarse todos los que puedan generardaosalmedioambiente. Evaluar los estudios ambientales, expedir, negar o suspender las Licencias ambientalesdesucompetencia. 6.5 ENTIDADESCIENTFICASYDEINVESTIGACINADSCRITASAL MEDIOAMBIENTE

nstitutodeHidrologa,meteorologa,yestudiosambientalesIDEAM. I nstitutodeinvestigacionesmarinasycosterasINVEMAR. I ElinstitutodeinvestigacionesdeRecursosBiolgicos.ALEXANDERVAN HUMBOLDT. nstitutoAmaznicodeinvestigacionesCientficas. I nstitutodeInvestigacionesAmbientalesdelPacifico. I Objetivo:Tienencomoobjetivolainvestigacincientficaytecnologaque atribuyaalmejoramientodelbienestardelacomunidad,conservacindela calidaddelmedioambienteyaprovechamientosostenibledelosrecursos naturales.

6.6CONSEJONACIONALAMBIENTAL Estconformadoas: 1.ElMinistrodeAgricultura 2.MinistrodeSalud 3.MinistrodeDesarrolloEconmico 4.MinistrodeminasyEnerga 5.MinistrodeEducacinNacional. 6.MinistrodeTransporte. 7.MinistrodeComercioExterior. 8.DirectordePlaneacinNacional. 9.PresidenteConfederacindeGobernadores. 10.PresidentedelaFederacindeMunicipios.

17

11.ElpresidentedelConcejoNacionalGremial. 12.UnpresidentedelasComunidadesIndgenas. 13.UnrepresentantedelasONG. 14.UnrepresentantedelasComunidadesNegras. 15.UnrepresentantedelaUniversidad. 16.UnrepresentantedelasCARS. Funciones: Recomendarlaadopcindemedidasquepermitanarmonizarlasregulacionesy decisionesambientalesconlosproyectosdedesarrolloeconmicoysocial. RecomendaralGobiernoNacionallapolticaylosmecanismosdecoordinaciones detodaslasentidadespblicasoprivadasquetenganfuncionesquepuedan afectarelmedioambiente. Recomendarlasdirectricesparalacoordinacindelasactividadesdelossectores productivosyelSINA. Recomendarlosusosdelterritorioconlosproyectosyplanesdeconstruccinde ensanchedeinfraestructurapblica. CORPORACIONESAUTONOMASREGIONALES(CARS) Son entes corporativos, pblicos, creados por ley, integrados por los entes territoriales que constituyan un mismo ecosistema, geopoltica, biogeogrfica o hidrogrfica. Poseen autonoma financiera, administrativa, personera jurdica y patrimoniopropio. FuncionesdelasCARS:Artculo31delaley99de1993 Ejecutarlaspolticas,planesyprogramasambientalesdecarcternacional. Ejercerlafuncinmximadeautoridadambientalensujurisdiccin. Promover y desarrollar la participacin de las comunidades en los programasdeproteccinambiental. Participar con los dems organismos y entes competentes en su jurisdiccinenlosprocesosdeplanificacinyordenamientoterritorial,para queelfactorambientalseatenidoencuenta. Celebrarcontratosyconvenios. Promover y realizar investigaciones con las entidades cientficas y de investigacinyconelapoyocientficodelSINA. Asesoraralosentesterritorialesenplanesdeeducacinambiental,formal ynoformal.

18

Otorgarconcesiones,permisos,autorizacionesylicenciasrequeridasporla leyAPRAeluso,aprovechamientoomovilizacindelosrecursosnaturales renovables permisos y concesiones para el aprovechamiento de los recursos forestales, de uso de agua superficiales y subterrneas y establecervedasdecazaypesca. Ejercer la funcin de evaluacin, control y seguimiento ambiental de los usosdelsuelo,elaire,elaguaylosdemsrecursosnaturalesrenovables, loquecomprendeelvertimiento,emisinoincorporacindelassustancias, residuos lquidos, slidos, gaseosos a las aguas en cualquiera de sus formas, al aire, o a los suelos as como vertimientos o emisiones que puedan causar dao o poner en peligro el norma desarrollo sostenible de losrecursosnaturalesrenovablesoimpediruobstaculizarsuempleopara otrosusos.Estafuncincomprendelaexpedicindelospermisos,licencias ambientales,concesiones,autorizacionesysalvoconductos. Recaudarlascontribucionesytasas,tarifas,multasporconceptodeusoso aprovechamientodelosrecursosnaturales,yfijarsumonto. Fijarensureadejurisdiccinloslmitespermisiblesdeemisin,descarga, transporte, deposito de sustancias o cualquier otra materia que puedan afectarelmedioambienteyprohibir,restringir,oregularlafabricacin,uso, disposicin o vertimiento de sustancias causantes de degradacin ambiental. Estoslimitesenningncasopuedensermenosestrictosquelosfijadospro elMinisterio. Ejercerfuncionesdeevaluacin,controlyseguimientoambientalalas actividadesdeexploracin,explotacin,beneficio,transporte,usosy depsitodelosrecursosnaturalesnorenovables.Estocomprendelo relacionadoconlaslicenciasambientales. ImponersancionesymedidasdepolicaprevistasenlaLeyyexigirla reparacindelosdaosconsujecinalasregulaciones.Asesoraralos entesterritorialesenlaelaboracindeproyectosenmateriaambiental.

6.8ENTESTERRITORIALESYPLANIFICACINAMBIENTAL Enarasdeasegurarelinterscolectivoyunambientesanoyadecuado,protegido y de garantizar el manejo armnico y la integridad del patrimonio natural de la Nacin.Lasfuncionesdelosentesterritorialessesujetaralosprincipiosde: _ArmonaRegional. _Gradacinnormativa. _Rigorsubsidiario. 19

PrincipiodeArmonaRegional:LosDepartamentos,LosMunicipios,Los Distritos,Territoriosindgenas,RegionesylasProvincias.Ejercernsusfunciones constitucionales y legales relacionadas con el medio ambiente y los recursos naturales, con SUJECIN a las normas superiores y las polticas nacionales ambientales,manejounificado,racional,ycoherente. Principio de Gradacin Normativa: En materia normativa las reglas que dicten lasentidadesterritorialesenrelacinconelmedioambienteyrecursosnaturales renovables,respetaranlasdecarctersuperiorylapreeminenciasuperiorjurdico. Principio de Rigor Subsidiario: Lasnormas y medidas de polica ambiental, es decir, aquellas que las autoridades medioambientales para su la regulacin del uso,manejo,aprovechamientoymovilizacindelosrecursosnaturalesoparala reservacin del medio ambiente, bien sea que limiten derechos y libertades pblicasoqueexijanlicenciaopermisoparaelejerciciodedeterminadaactividad por la misma causa, podrn hacerse sucesiva y respectivamente mas rigurosas pero no ms flexibles, por las autoridades competentes del nivel regional, departamental,distritalomunicipal. 6.9FUNCIONESDELOSDEPARTAMENTOS(art.64Ley99de1993) Promoveryejecutarprogramasypolticas,ambientalesenelnivelsectorial. Dar apoyo presupuestal, tcnico y financiero y administrativos a las corporacionesautnomasymunicipios. Expedir con sujecin a las normas superiores disposiciones sobre el medio ambiente. Ejercer funciones de control y vigilancia del medio ambiente y recursos naturales,velarporelcumplimientodelosdeberesdelosparticularesyelestado ylaproteccinaambientesano. 6.10 FUNCIONESDELOSMUNICIPIOS,DISTRITOSYTERRITORIOS INDIGENAS(art65Ley99de1993). Promoveryejecutarprogramasypolticasnacionales,regionalesysectoriales. Dictarconsujecinalasdisposicionessuperiores,lasnormasnecesariaspara elcontrol,preservacinyladefensadelpatrimonioecolgicodelmunicipio. Adoptar los planes y proyectos de desarrollo ambiental que hayan sido aprobadosanivelregionalplanificacinambiental. Participar en la elaboracin de los planes, programas, proyectos de desarrollo ambientalaniveldepartamental. EjerceratravsdelalcaldecomoautoridaddepolicayconapoyodelaPolica Nacional,consujecinanormassuperiores,funcionesdecontrolyvigilancia. CoordinarydirigirconasesorasdelasCorporacionesactividadesdevigilancia ycontrol,queserealicenconapoyodelafuerzapblica.

20

DictarconsujecinalasnormassuperioresnormasdeordenamientoTerritorial delmunicipioysobreusosdelsuelo. Ejecutar obras o proyectos de descontaminacin de corrientes o depsitos de aguaafectadoporvertimientosdelmunicipio,ascomoprogramasdedisposicin, eliminacinyreciclajederesiduos,lquidosyslidosydecontroldelasemisiones contaminantesalaire. 6.11PLANIFICACINAMBIENTALENTIDADESTERRITORIALES Para garantizar la planificacin integral por parte del estado, del manejo y aprovechamiento de los recursos naturales a fin de garantizar el desarrollo sostenible,losplanesambientalesdelasentidadesterritorialesestarnsujetosa lasreglasdelaarmonizacin.Decreto48de2001yDecreto1865de1994. LosDepartamentos,municipios,ydistritoselaboraransusplanesdedesarrolloen lorelacionadoconelambiente,bajolaasesoracoordinacindelascorporaciones desujurisdiccin. InstrumentosdePlanificacinAmbientalRegional:LasCorporaciones AutnomasRegionalesylosGrandesCentrosUrbanoscontaranconlos siguientesinstrumentos: _ElPlandeGestinAmbiental(PGAR) _PlandeAccinTrianual(PAT) _PlanAnualdeInversiones(POAI) ComponentesdeunPlanRegional _ Diagnstico ambiental. Anlisis integral de los componentes, sociales, econmicos, culturales, que determinan el estado de los recursos, define estado de los recursos, identificar y caracterizacin de los problemas causasefectos,debertenerindicadores. Prospectiva ambiental de la jurisdiccin de la CAR. Partiendo del diagnstico que plantean los actores,los escenarios alargo y corto plazo, conmetasmedibles. Estrategias. Lneas de accin, pautas generales para dar solucin a los problemasydesarrollarpotencialesdedesarrollo. Mecanismosdeseguimientoyevaluacin.Elplandebetenerindicadoresa loscualesselesrealiceseguimientoymonitorearelavanceycumplimiento.

PlandeAccinTrianual(PAT)

21

Instrumentodeplaneacinqueconcretaelcompromisoinstitucionalparaellogro de objetivos y metas del Plan Ambiental Regional, documento que presenta el director dentro de los 4 meses despus de su posesin, en la anual define accioneseinversionesdentrodesujurisdiccin. PlanOperativoAnualdeInversiones(POAI) Instrumentodeplanificacinquepermiteconcretarlasprioridadesdefinidasenel plan de accin trianual, se desagregan las acciones por cada proyecto que se llevara a cabo durante un ao. Deber contener indicadores para evaluar su ejecucinfsicayfinanciera 7.NORMATIVIDADPORRECURSOS 7.1.RECURSOAIRE. Este recurso en aras de su proteccin, conservacin, uso, aprovechamiento, ha sido tratado por diversas normas entre las cuales se destacan: Decreto 02 de 1982, Decreto 948 de 1995, Resolucin oo5 de 1996, Resolucin 909 de 1996, Decreto2811de1974,Ley9de1979,Resolucin8321de1983,Resolucin619 de 1997, Resolucin 970 de 2001, Resolucin 058 de 2002, Resolucin 886 de 2004 y la Resolucin 415 de 1998 entre otras. El Ministerio del Medio Ambiente tiene como finalidad en materia del recurso aire las emitir las siguientes reglamentaciones: _ _ _ _ _ _ _ _ Reglamentedeproteccinycontroldecalidaddeaire. Establecennormasyprincipiosparalaproteccindelaatmsfera Mecanismosdeproteccin,controlyatencin. Fijacindenormasdecalidaddelaire. Estndaresdeemisin,normasdeinmisin. Lasemisionesderuido,oloresofensivos. Regulaelotorgamientodepermisosdeemisin. Controlyvigilanciaysanciones.

ACTIVIDADESCONTROLADAS _ _ _ _ _ _ Lasquemasdebosquenaturalydevegetacinprotectora,abiertas prohibidas Laquemadecombustiblesfsilesutilizadasporautomotores. Laquemaindustrialocomercialdecombustiblesfsiles. Lasquemasabiertascontroladasenzonasrurales. Laincineracindedesechosyresiduostxicosopeligrosos Lasactividadesindustrialesqueusen,generenoemitanMontreal

22

Lascanterasyplantastrituradorasdematerialesdeconstruccin.

ElDecreto02DE1982,regullassiguientesactividades:Estaesunanorma permisiva,laempresatienederechoademostrarquecontaminaono. _CalderasabasedeCarbn _Fbricasdecemento. _Industriasmetalrgicas _Plantasdeasfaltymezclasasflticas _Otrasindustrias. _Plantasdecidosulfrico _Calderas,hornos,yEquiposqueutilicencombustiblesslidosolquidos _NormasdeemisinparaPlantasdecidoNtrico. TIPOSDECONTAMINANTES Sontodosaquellosqueafectenlacalidaddelaireoelniveldeinmisin. _Ozonotroposfericoosmogfotoqumico,precursores _MonxidodeCarbono _Materialparticulado. _DixidodeNitrgeno _DixidoAzufre _Plomo _Contribuyendestruccinodisminucindelacapadeozono _Efectoinvernadero. OTRASACTIVIDADESREGULADAS _ _ _ _ Seprohbeelusodecrudospesados,concontenidosdeazufresuperiores a1.7%,paraserutilizadosenhornosocalderas. Seprohbelaincineracindellantas,baterasyotroselementosque produzcantoxico.Encampoabiertooparausarlocomocombustible. LosIncineradoresderesiduospatolgicoseindustrialescontarancon sistemasdequemadoyposquemadodegases,consistemasdecontrol Quemadebosqueyvegetacinprotectora.

PROHIBICIONES:

23

_ _

Prohbase a los particulares depositar o almacenar en las vas pblicas materialesdeconstruccin,demolicinodesechoenzonasdeusopblico, quepuedangeneraremisionesalaire. Las constructoras,los contratistas que desarrollen este tipode actividades no podrn almacenar por ms de 24 horas. Los materiales los debern cubrirensutotalidadoenrecintoscerrados. Lasconstruccionesdemsde3pisosdeberncontarconmallasde proteccin. Control de emisiones molestas a establecimientos comerciales: Los establecimientoscomercialesqueproduzcanemisionesalaire,tales como restaurantes, lavanderas o pequeos negocios debern contar con ductos o dispositivos que aseguren la adecuada dispersin de los gases, vapores o partculas y olores, y que impidan causar con ellos molestias a losvecinos. QuemasAbiertas:seprohbeenzonasurbanas.Ningnestablecimiento comercial, industrial y hospitalario podr efectuar quemas abiertas para tratar sus desechos slidos. Las fogatas domesticas o finesrecreativas se permitirnsiempreycuandonocausendaoalosvecinos.

CUMPLIMIENTODENORMASDEEMISIN _ Todaslasindustriasoactividadesquerequieranpermisodeemisiones atmosfricasestarnobligadasacumplirconlasnormasdeemisiones permitidasyestablecidasenelDecreto948de1995yestnsujetosa controlyseguimientodelasautoridadesambientales. Resolucin970de2001,estableciloslmitesylascondicionesquedeben cumplirlosquepretendaneliminarplsticoscontaminadosconplaguicidas: Plantasdeincineracinderesiduospeligrosos. Hornosrotatoriosdelasplantasdecemento:Mezcladosenproporcinde un40%conelcombustibletradicionalylaconcentracindeplaguicidasen losplsticosnosuperiora1.000ppm(0.1%enpeso). Unhornoconunatemperaturasuperiora1800Cyconunenfriadorala salidadelhornoa200oC. Sitrabajana1.100requierenunsistemadeprecalentamientootorrede multiciclones Tiempoderesidenciadegasesigualosuperiorde4segundos. Nodebepresentarsalidadellamasporelductodealimentacin. SistemadecontrolparapartculassuspendidasPSTdebehacersepor tratamientoensecoy/ohmedo.

_ _ _

_ _ _ _ _

SOLICITUDDEPERMISODEEMISIONES _ _ Nombreoraznsocialdelsolicitante. Localizacindelasinstalaciones.

24

_ _ _ _ _

_ _ _

Fechaproyectadadeiniciacindelaboresydeterminacinsisetratade emisionestransitorias. Conceptodeusosdelsuelo. Informacinmetereolgicabsicadelreaafectadaconlasemisiones. Informacintcnicadelaproduccinprevista. Descripcindelasobras,actividadoprocesoproductivo,flujogramacon indicacindelospuntosdeemisin,cantidaddepuntosdeemisiny descripcindelosductosochimeneas. Anexarinformacinsobreelconsumodemateriasprimas,combustibles Estudiostcnicosdeevolucindeemisionesdesusprocesosde combustinoproduccin. Diseosdelossistemasdecontroldeemisiones.

EMISIONESCONTAMIANTESDERUIDO _ EstetemahasidosolamentereguladoenlaResolucin8321de1983,enla Ley769de2002.ylaResolucin0627del7deabrilde2007(Monitoreos CalidaddeRuido). Elmisteriofijarlosestndaresmximospermisiblesderuidoyderuido ambientalparatodoelterritorioNacional. Establecernloshorariospermitidos,lapresinsonorateniendoencuenta losrequerimientosdesaluddelapoblacinexpuesta,alterenlos ecosistemas,perturbenlapazpblicaovulnerenelderechodelas personasadisfrutardelatranquilidad. Lasregulacionespodrnsobrefuentesfijasy/omviles,quetrasciendan azonaspblicasoalmedioambiente. Lasregulacionesambientalestendrnporobjetolaprevencinycontrolde laemisinderuidourbano,rural,domsticoylaboralquetrasciendael medioambienteoalespaciopblico. SectoresdeRestriccindeRuido SectorA:Tranquilidadysilenciohospitales,bibliotecasguarderas, sanatoriosyhogaresgeritricos. SectorB:Tranquilidadyruidomoderado,zonasresidenciales,parques, universidadesycolegios. SectorC:Ruidointermediorestringidousoscomerciales,industriales, oficinas,usoinstitucionalyrelacionados. SectorD:Zonassuburbanasoruraldetranquilidadyruidomoderado, explotacinagropecuaria,recreacin,descanso.

_ _

_ _

_ _ _ _ _

PROHIBICIONES _ Ruidoensectoresdesilencioytranquilidad.Prohbelageneracinderuido decualquiernaturalezaporencimadelosestndaresdefinidoscomoA.

25

_ _ _ _ _

Elusodealtoparlantesyamplificadores,lautilizacindeestosinstrumentos paraactosculturales,deportivos,religiososopolticosrequierenpermiso. Lageneracinderuidoquetrasciendasupropiedad. ElruidodemaquinariaindustrialenzonasclasificadasconoAyB. Seprohbecualquiergeneracinderuidoporfueradelosestndares. No se permite la construccin o funcionamiento de establecimientos comerciales o industriales susceptibles de generar ruido tabernas, almacenes,bares,discotecasysimilaresenAyB EnlossectoresAyB,nosepermitirelfuncionamientode establecimientosquepuedangenerarruido,yqueperturbenlatranquilidad, almacenes,tiendas,tabernas,bares,discotecasysimilares._Lasplantas elctricasdebendecontaminarconsilenciadores. Lapublicidad,promocindeventadeproductososerviciosodifusinde cualquiermensajepromocional,mediantealtoparlantes.Enzonaspublicas aningunahora.

RuidoporAeropuertos:Licenciasambientalesdeaeropuertosdebendeterminar normasparalaprevencindecontaminacinsonoraencuanto: _ _ _ _ Distanciadelaszonashabitadas Usosdelsuelodelaszonasaledaas. Nmerosdeoperacionesareas. Tipodeaeronavescuyaoperacinseaadmisibleporsusnivelesde generacinderuidos.

ElMinisterioylasCARS,podrnestablecermediasdemitigacinyamortiguacin de ruido para los aeropuertos existentes. Igualmente podrn restringir o prohibir paralasoperacionesnocturnas,queporsuubicacinperturbenlatranquilidadde sushabitantes. RuidoenVehculos: _ _ Seprohbeelusodebocinasenlosvehculosdeserviciopblico. Losvehculosdepasajerosnopodrnmantenerencendidosequipos televisivosoradialesquetrasciendanalaszonasdelospasajerosyqueles impidanelhabla. Eltransitodevehculospesadoestarrestringidoenlaszonade tranquilidad. Prohibicindelainstalacindedispositivosquegenerenruido,talescomo vlvulas,resonadoresentreotros. Elusodesirenassoloestpermitidoparaambulancias,vehculosdela Polica,militaresydebomberos.Seprohibenparticulares. Seprohbelacirculacindevehculosquenocuentanconsilenciador.

_ T _ _ _

26

readeAmortiguacindeRuido: Las normas de planificacin de nuevas reas de desarrolloindustrial, debern establecerunreadeamortiguacinderuidooelementosdemitigacinderuidos. Losdiseosdelasvasdealtotraficovehicularenreasurbanasdebencontar conzonasdeamortiguacinderuido. as construcciones de hospitales, zonas educativas. Bibliotecas, sanatorios L debernajustarseaespecificacionestcnicasparaprotegerlasdelruidovehicular oestablecimientoscomerciales. La operacin de equipos de construccin, demolicin reparacin de vas, generadorasderuidoambiental,enzonasresidencialesentrelas7:00pmy7:00 a.m,yencualquierhorariodomingosofestivosrequerirdepermisodelAlcaldeo autoridaddepolica.Elcualsuspenderelpermisoporquejade2personas. 7.2RECURSOAGUA Esterecursoenarasdesuproteccin,conservacin,uso,aprovechamiento,ha sidoreguladopordiversasnormasentrelascualessedestacan:Decreto2811de 1974,Decreto1541de1978,Decreto1594de1984Decreto2858de1981Ley9 de1979Resolucin769de2002,Resolucin839de2003entreotras.La reglamentacindeesterecursoesunaspectoprioritariodelmedioambiente,un granporcentajedelosproyectosdedesarrollotienenunefectosobreelrecurso hdrico.Laidentificacinyestimacindeestosefectossobrelacalidadycantidad delaguasonunasactividadesprioritariasenlasevaluacionesyEstudiosde ImpactoAmbiental.Respectoaesterecursoseregulanelaprovechamientodelas aguasnomartimasentodossusestadosyformas. A.Aguasmetericas B.Laprovenientedelalluvia. C.Deloslagos,cinagas,embalses. D.Lassubterrneas. E.Losnevadosylasutilizadas,servidasonegras. ElEstadogarantizar: Realizarlaclasificacindelasaguasyfijarsudestinacinyposibilidadesde aprovechamiento. Sealarlosmtodosdecaptacin. Fijarrequisitosparalossistemasdeeliminacindeexcretasyaguasservidas. Ejercer control sobrelas personas que usanlasaguas que las condicionesde tratamiento,distribucindelagua. Controlarlacalidaddelaguamedianteanlisisperidicosmantengaaptaspara suuso.

27

Promover y fomentar la investigacin y anlisis pera aguas interiores y de las marinasparaasegurarpreservacindelosbiolgicos. Someter a controllas aguas que se conviertan en contaminacin y determinar lasactividadesquequedaylasmedidasderecuperacin. Dominio de las aguas: Las aguas son dominio pblico, inalienables e imprescriptibles, excepto delas propiedades privadas adquiridas con arregloala ley (nace muere en una misma heredad). De igual forma el cauce, el lecho, las playas, las reas ocupadas por los nevados, una franja paralela a las mareas mximashasta30metrosylosdepsitosdelasaguassubterrneas. Todapersonatienederechoautilizarlasaguasdedominiopblicoparasatisfacer sus necesidades elementales las de su familia y se sus animales siempre u cuandonocausenperjuiciosaterceros.Esteusodebehacersesinderivaciones, ni maquinarias, deteniendo o desviando el cauce, ni contaminando las aguas de talformaqueimposibilitensuusoporterceros. Por ley se puede hace ruso de las aguas de dominio privado, para consumo domsticosolamente.Elaguasepuedeusarpor: 1.MinisteriodelaLey. 2.PorConcesin. 3.PorAsociacin. Todapersonapublicaoprivada,naturalojurdica,requieredepermiso,parahacer usodelasaguaspblicasosuscauces,salvocuandosetratedebaarse,lavar ropas,oparaabrevadero. EnumeracindeUsos:Elaguapuedeusarsepara: 1.Abastecimientodomstico. 2.Riegoysilvicultura. 3.Abastecimientoabrevaderos. 4.Generacintrmicaonuclearelectricidad. 5.Usoindustrial. 6.Explotacinmineraytratamientodemineral. 7.Explotacinpetrolera. 8.Inyeccinparageneracingeomtrica. 9.GeneracinHidroelctrica. 10.Generacincinticadirecta. 11.Flotacindemadera. 12.Transportedemineralesysustanciastxicas 13.Acuiculturaypesca. 14.Recreacinydeporte.

28

15.Usosmedicinales. PrioridadesparaOtorgarConcesiones: 1.Consumohumano,colectivo,urbano,comunitario. 2.Utilizacinparanecesidadesdomesticasindividuales. 3.Usosagropecuarioscomunitarios,acuiculturaylapesca. 4.Usosagropecuariosindividuales,acuiculturaylapesca. 5.Generacindeenergahidroelctrica. 6.Usosindustrialesymanufactureros. 7.Usosmineros. 8.Usosrecreativoscomunitarios. 9.Usosrecreativosindividuales. Las concesiones slo conceden el derecho al uso, y no se pueden varias las condiciones,requieredemodificacindelaresolucin. Lasconcesionespuedennegarse,ytendrnquesustentarse. Control de obras de captacin: Las obra de captacin de agua, debern estar provistas de elementos de control que permitan conocer la cantidad de agua derivadadelabocatoma. La concesin puede traspasarse: Requiere autorizacin previa, cuando se realizatradicindelbienqueposeeunaconcesinestadebesolicitareltraspaso ensesentadas,paraserconsideradonuevoposeedor. RequisitosdelaSolicitud: Identificacindelsolicitante,yaseapersonanaturalojurdica. Nombredelafuentededondesepretendederivardelaguaodeseausar.del predio,municipios,comunidadesquesevanabeneficiardelagua. Declaracindelefectoambiental. Informacinsobredestilacindelagua. Cantidaddelaguaquesevaautilizaenlitrosporsegundo. Informacin sobre los sistemas para la captacin, derivacin, conduccin restitucin de sobrantes, distribucin, drenajes, inversiones, cuanta de las mismas,elterminoenquevanarealizar. Informarsiserequiereservidumbre. Trminodelaconcesin. Extensinyclasedecultivosquesevanaregar. Trmite:Laautoridadambientalrealizaralassiguientesactuacionesparael otorgamientodeunaconcesindeaguas. isitaocularacargodelinteresado,conintervencindefuncionarios. V

29

Avisoparalosinteresados,10dasdeanticipacin,paraquelosinteresados puedanintervenir,antesdelavisitaoenellas,lasrazonesporlascualesse oponen,ylosdocumentos. Severifica:Losaforosdelafuentedeorigen,siexistenpoblacionesquesesirven de las mismas aguas, si existen derivaciones para otros usos, si las obras proyectadas van a ocupar predios que no sean del dueo, lugar y formas de restitucindesobrantes,sinosepuedenrestituiralcausedeorigen,explicarlas razones,lainformacindesolicitante,ladeclaracindeefectoambiental.Despus derealizarlavisita,en15dasseemitirlaresolucin Estasobrasdebendeestarprevistasdeaparatosquepermitanmediryconocer deaguaderivadayconsumirla,encualquiermomento. Se deber mantener en condiciones ptimas para garantizar su correcto funcionamiento. Las obras de rectificacin de cauces o de defensas de taludes marginales para evitar inundaciones y daos en los predios ribereos, debern obtenerpermisoyentregarlasmemoriasyplanosnecesarios. En la resolucin de concesiones se denindicar el sitio deafluirlos sobrantes de aguasusadasenriegosparaquevuelvanasuscaucesypuedanserusadaspor otrospredios. Cuandounaovariaspersonaspretendanconstruiracueductosrurales,para serviciosderiegoderequiereautorizacinprevia. Trmino de la concesin: (10) La naturaleza y la duracin de la actividad, que seaeconmicamenterentableysocialmentebenfica,paralosserviciospblicos uobrasdeinterspblico50aos.Sonprorrogables.Lasconcesionessepueden cederotrasladar(dentrodelos60dassiguientessedebeinformaralaautoridad ambientalparaqueautorice),suspender,revocaromodificar. PermisosdeExplotacin,ocupacindelasplayas,caucesylechos:La extraccinprobartedeparticularesydeentidadespblicas,dematerialesde arrastredeloscaucesolechosdelascorrientesdeodepsitosdeaguas,como piedra,arenaycascajo. Requisitos: 1.Identificacindelsolicitante. 2.Nombredelacorrienteodepsitocuyocauceolechopretendeexplorar. 3.Sectordondeseestablecerlaexplotacin,conexactitud. 4.Clasedematerialquesepretendeextraer. 5.Explotacionessimilares,aprovechamientosviaductosodemsquepuedan afectarseconlaexplotacin.

30

6.Sistemasymtodosdeexplotacin. 7.Declaracindeefectoambiental. 8.Planodelsector. Esterequierequeelavisoseaenprensadecirculacinenlazona.Quepretenda construirobrasqueocupencaucesdeunacorriente,debesolicitarautorizacin. Paralosserviciosdeturismo,recreacin,turismodecorrientes,lagoso depsitosserequiereautorizacin. Uso,ConservacinyPreservacindelasAguas. Sinpermisonosepodralterarloscauces,nielrgimenylacalidaddelasaguas, niintervenirsulegtimouso. ObligacionesdeUsuarios: Aprovecharlasaguasconeficienciayeconomaenellugaryparael objetoprevisto. Noutilizarmayoraguadelaotorgada. Construirymantenerlasobrashidrulicasencondicionesadecuadas. Evitarquelasaguassesalgandelosdepsitosquelasdebencontener. Permitirlavigilanciaycontrol,ydatossobreusosdelagua. Realizarreforestacinenlosnacimientosdeagua. OBRASHIDRALICAS Alusuarioqueselehayaotorgadounaconcesin,yeldueodeaguasprivadas enlatan obligados a presentar para su estudio y aprobacin los planos y diseos delasobrasnecesariasparacaptar,controlar,conducir De las concesiones de aguas para consumo humano se requiere de concepto previodelministeriodesaludparasuotorgamientoorenovacin. Sepermitenautorizacionesespecialeshastaporeltrminodeunao,parala realizacindelosestudiosdeaprovechamiento.Estostendrnlaprimeraopcin encasodesolicitarselaconcesin,frenteaotrassolicitudes. PERMISODEVERTIMIENTODec2811/74,Dec1594/84 Sicomoconsecuenciadeunaprovechamientodeunaguaencualquieradelos usos, se han deincorporar alas aguasdesechos o sustancias serequerir para ello permiso de vertimientos el cual se puede tramitar conjuntamente con la concesin.

31

ClasesdeVertimientos: 1. Vertimientoporusodomstico:Candolasaguasservidasnopuedanllegar al sistema de alcantarillado pblico, se deber obtener permiso de vertimientoylasaguasdebernsertratadasdetalformaquenodeterioren lafuentereceptora. 2. VertimientodeResiduosLquidos. 3. Vertimientoporusoagrcola,riegoodrenaje. 4. Vertimientoporusoindustrial. Elgradodetratamientodelosvertimientosdependerdelosusosdelostramos, delosefectosalasalud,delasimplicacioneseconmicasoecolgicas. Requisitosparaeltrmite:Todaslasconcesionesdeaguadebentenerpermisode vertimiento, deben hincar la clase, la cantidad y la calidad de los desagues. La aprobacinsedarconfundamentoenlaclasificacindelasaguas. Elpermisodevertimientonosirveparaexcluirlaresponsabilidadcivil,penalen quepuedanincurrirlospermisionarios. Plazo:Lospermisosdevertimientoseotorganhastaporcinco(5)aos.Son prorrogables. PROHIBICIONESDEVERTIMIENTOS _ _ _ _ Seprohbeladescargaderesiduoslquidosenlascallescalzadas,canales, sistemasdealcantarilladoyaguaslluvias. Nosepodrnutilizarlasaguascomositiodedisposicinfinalderesiduos slidos Seprohbesintratamientoresiduosslidos,lquidos,gaseosos,quepuedan causardaooponerenpeligrolasalud. Seprohbelautilizacindeaguasdelrecurso,delacueductopblico,o privadooelalmacenamientodeaguaslluviasconelpropsitodediluirlos vertimientosconanterioridaddeladescargaalcuerporeceptor. Seprohbeelvertimientoderesiduosliquidasnotratadosprovenientesde embarcaciones,enaguassuperficiales,dulcesomarinas. Noseadmiteningntipodevertimientoen:Cabecerasdelasfuentesde aguasyenunsectoraguasarribadelabocatomayenlasaguasque declarenespecialmenteprotegidas. Seprohbeellavadodetransporteareoovehculosenlasorillasoen loscuerposdeaguas.

_ _

VARIAS

32

_ _

Laindustriaqueenrazndesuuso,viertanaguasporintervalode temperatura,nopodrnincorporarlasacorrientessinpreviaadecuacin. Sefijaranenzonasenquequedaprohibidodescargarcantidadesy concentracionesquesobrepasanloslmitespermisibles.Aguanegra, domstica,industriales.

TASASRETRIBUTIVAS La utilizacin indirecta o directa de los ros, lagos y aguas subterrneas para introduciroarrojaraellosdesechosagrcolas,mineros,industriales,aguasnegras oservidas,nocivasqueseanelresultadodeactividadeslucrativas,sesujetaranal pagodetasasretributivasdelserviciodeeliminacin.LaLey99de1993,artculo 42 encontramos que la utilizacin directa o indirecta de la atmsfera, del agua y del suelo, para introducir o arrojar desechos en actividades lucrativas o no lucrativassesujetaralpagodetasasretributivasporlasconsecuenciasnocivas, yenelarticulo5numeral29delaLey99,comofuncionesdelMinisteriodelMedio Ambiente es fijar el monto tarifario mnimo de las tasas por el uso y aprovechamientodelosrecursosnaturales. El marco normativo de las tasas retributivas son el Decreto 3100 de 2003 que derogaalDecreto901de1997yel3440de2004quemodificaelDecreto3100de 2003, en cuanto a sus fundamentos, los alcances y objetivos. El artculo 17 del Decreto 3100 de 2003 obliga al Ministerio de Ambiente, Vivienda y Desarrollo Territorial a establecer las sustancias que sern objeto de cobro de la tasa retributivaporvertimientosylosparmetrosdemedidadelosmismos. LaResolucin273de1997establecenlosparmetrosbsicosdemonitoreoson: slidos suspendidos totales (SST) y la demanda bioqumica de oxigeno (DBO) Ademsenelartculo7delDecreto3100de2003seestablecequeLaautoridad ambientalcompetenteestablecercadacincoaos,unametaglobaldereduccin de la carga contaminante para cada cuerpode agua o tramo del mismo. Para la determinacin de la meta se tendr en cuenta la importancia de la diversidad regional, disponibilidad, costo de oportunidad y capacidad de asimilacin del recurso y las condiciones socioeconmicas de la poblacin afectada, de manera quesereduzcaelcontaminantedesdeelniveltotalactualhastaunacantidadtotal acordada. Lacontaminacindeuncuerpodependedeltamaoycalidaddelvertimientoas como el tamao de la fuente y su capacidad de asimilacin, en la actualidad no existe un diagnstico confiable sobre la contaminacin domstica a escala nacional, ni informacin suficiente sobre el estado del recurso hdrico que considere elementos como la capacidad de asimilacin del cuerpo receptor y el efecto nocivo real de los vertimientos. Se estima que los vertimientos de agua residuales de los centros urbanos alcanza 67m3/s, donde Bogota representa el

33

15%,Antioquia13%,ValledelCaucaylosdemsdepartamentospordebajodel 5%, con este caudal se podra abastecer una poblacin de 33 millones de habitantes. Lasfuenteshdricasseestndeteriorandoapesardecontarconuninstrumento econmicocomoeseldelastasasretributivaslascualesfuerondiseadaspara induciralosempresariosamermarlacargacontaminante,atravsdelainversin entecnologayprocesosproductivosmslimpiosqueutiliceninsumosconmayor eficienciaalavezquedisminuyenlosdesechos. Es necesario un marco regulatorio mas eficiente, consistente con el desarrollo econmico rpido, con polticas que promuevan la inversin en tecnologas mas modernas,msproductivasymaslimpias.Sueficienciasepuedemejoraren: Aumentarymejorarelmonitoreodelosvertimientos,elcualesimportantepara establecerlimitesbasesydefinirmetasdereduccin. Que el monitoreo sea mas representativo, por lo tanto es necesario el seguimiento en todo el proceso que asegure la integridad de la muestra, para evitarsualteracinyprotegerladelamanipulacinofalsificacin. eneracindeestadsticaseinformacinambientalanivelnacionalylocalque G genereunnexocientficoentrelasactividadesyeldeteriorodelmedioambiente. ayor participacin de los agentes involucrados y de la comunidad en la M definicindemetasyobjetivos. Cobro de tarifas diferenciadas para el sector urbano, agrcola eindustrial, con incentivostributariosparaaquellosquemuestrendisminucinenlacontaminacin desusvertimientos. Generar instrumentos de penalizacin ms eficaces por incumplimiento. En virtud del artculo 6 del Decreto 3100 de 2003, la autoridad ambiental deber ademsdocumentarelestadodelacuenca,tramoocuerpodeaguaentrminos decalidaddeterminarsilosusuariostienenonoplandecumplimientoopermiso devertimientoseigualmenteestnobligadasaefectuarprogramasde monitoreo delasfuenteshdricas. EnelDecreto3440de2004,sedeterminqueelcobrodelatasaretributivaser porlosvertimientospuntualesrealizadosaloscuerposdeaguaenelreadesus jurisdiccin, de acuerdo a los Planes de Ordenamiento del Recurso. De igual forma se determin que un 10% del recaudo de la tasa podr utilizarse para la cofinanciacinydiseosasociadosalosmismos. Lasautoridadesambientalesdeberndivulgarsemestralmenteunresumensobre elcobrodelastasasretributivasyestadodelosrecursos. Quienespagan:Todoslosusuariosquerealicenvertimientospuntuales.

34

Competencia del recaudo: Las Corporaciones Autnomas Regionales y los GrandesCentrosUrbanos. Sujeto pasivo: Debe presentar la declaracin semestralmente, sustentada con lascaracterizaciones.Laautoridadambientalcalculalacarga Muestreos: Deben ser de laboratorios normalizados, intercalibrados y acreditados. acturacin:Mensual. F Recursos:Lasresolucionesdeliquidacindetasasatributivas,poseenrecursos porvagubernativa,ademssepuedenpresentarreclamosyaclaracionesdentro delosseis(6)meses. as Empresas de Servicios Pblicos domiciliarios harn declaraciones L presuntivasporcontaminacindomesticaporkilogramo. S no se enva la declaracin la autoridad ambiental la establece presuntivamente. 7.3FLORATERRESTRE ElEstadopordisposicinlegaldebertomarlasmedidasparalaconservaciny evitar la desaparicin de especies o individuos de la flora, por razones de orden biolgico,gentico,socioeconmicoyesttico.Lasnormasqueregulaneltemade laproteccindeesterecursosonelDecreto2811de1974,Decreto2278de1953, Decreto 1791 de 1996, Ley 2 de 1959, Ley 299 de 1996, Ley 139 de 1994, Decreto1824de1994yelDecreto900de1997,entreotros. Sonelconjuntodeespecieseindividuosvegetales,silvestresocultivados, existentesenelterritorionacional. Aprovechamiento: En el manejo de suelos forestales se regulan los suelos forestalesporsunaturalezaylosbosques.Estosaprovechamientossedenominan reasForestalesyseclasificanas: reasforestalesproductoras:Debenserconservadascomobosquesnaturaleso artificiales,paraobtenerproductosforestalesparacomercializacinoconsumo. Sepuedendardedosformas: Directas:Cuandolaobtencindelproductoimpliqueladesaparicintemporalyla posteriorrecuperacin. Indirectas:Cuandolaobtencindefrutosnoimpliqueladesaparicindelbosque. reas forestales protectoras: La zona que debe ser conservada permanentemente con bosque natural o artificial para proteger los recursos u otros.

35

reas forestales productoras protectoras: La zona debe ser conservada permanentemente con bosque para proteger los recursos naturales renovables y que adems pueden ser objeto de actividades de produccin necesariamente al mantenimientodelefectoprotector. reas de Reserva forestal La zona de propiedad pblica o privada reservada para destinacin exclusiva al establecimiento o mantenimiento y utilizacin racionaldereasforestalesproductoras. Protectoras productoras y protectoras Se destinaran para el aprovechamientoracionalpermanentedebosques. Todaslasobras:vas.embalses.Represas.edificaciones.realizacinde actividadeseconmicas,REQUIERENLICENCIAPREVIA. Seconcedecuandosecompruebaquenoatentancontralaconservacin. No se podrn adjudicar baldos en reservas forestales, se podr otorgar concesin de baldos durante el tiempo necesario para que el concesionario establezcabosquesartificialesylosaproveche,nosereconocenmejoras. Si dentro de estas reas se requiere realizar actividades, diferentes al uso racional,serequerirsustraccin. Aprovechamientoforestal.ClasesPersistentes:Sonlosaprovechamientosque seefectanconlaobligacindeconservarelrendimientonormaldelbosque,con tcnicasquepermitanlarenovacindelbosque. Sepuedenhacersedirectasoporadministracin,medianteasociacin,concesin o permiso, si el predio es privado siempre requiere autorizacin. Se paga tasa retributiva. 30% del precio en bruto Se requiere estudio y plan de ordenacin de trabajos. nicas: Los que tcnicamente se realizan en lotes localizados en suelos que debenserdestinadosausosdiferentesalforestal.Sepagatasaretributiva.30% delprecioenbruto.Puedetenercomoexigenciaeldedejarlimpioellote,peroel deconservarelbosqueorenovarlo,lopuedehacerdirectamentelaAdministracin oparticularesconpermiso. Domsticos: Son aprovechamientos forestales domsticos los que efectan efectivamentenecesidadesvitalesdeusodomestico,nosepodrncomerciar.Se requierepermiso. Explotacin de aserros: Explotacin forestal por el sistema de aserro en baja escalayconfinescomerciales,adelantadasporcampesinosquetenganenellala nicafuentedetrabajo,necesitanpermisootorgadodirectamente. Industrias forestales: Las que realizan actividades de plantacin, aprovechamiento, transformacin, o comercializacin de bosques o productos primariosforestales.

36

Empresas Forestales Integradas: Las que efectan la utilizacin optima de la mayorpartedelasespeciesforestalesdeunbosque. TODASLASFORESTALESDEBENOBTENERPERMISO Las empresas forestales y de transporte: Estn obligadas a suministrar informacinde: Registrosdeproduccinacarreodatosestadsticos Permitirlainspeccindeinstalaciones,almacenamientos,procesamiento yexplotacin. Reforestacin:Establecimientoartificialderbolesparaformarbosques. Plantacinforestal:elbosqueformadoporreforestacin. Forestal industrial: establecida en rea forestal productora, destinada slo a producir. Forestalprotectoraproductora:Elaprovechamientodelaplantacin estacondicionadoalmantenimientodesuefectodeproteccindel recurso. Forestalprotectora:Laquesiembraexclusivamenteparaprotegero recuperaralgn. Asistencia tcnica. La persona natural o jurdica que solicite crdito para el establecimiento de plantaciones forestales industriales, deber demostrar que tieneasistenciatcnicaidnea. Certificado de Movilizacin: Todo producto forestal primario que entre al territorio nacional, salga o se movilice dentro de l debe estar amparado por permiso. Cualquier aprovechamiento, procesamiento primario, movilizacin o comercializacinde productos forestalesrealizados sin sujecin alas normas de este cdigo se decomisar, solo par razones econmicas o sociales, se podrn establecerexcepciones. Para la importacin de semillas o material vegetal de especies forestales se requierepermiso. Control fitosanitario. Toda persona que posea, aproveche, transporte, almacene, comercialice semillas, forestales material vegetal, deber conocerse el control fitosanitario. Obligaciones:

37

Loprediosruralescuandosuperenlas50He,tendrnlaobligacinenbosqueo repoblar con rboles maderables o industriales en una proporcin del 10% de la extensintotaldelterreno. Losbeneficiariosdeaguasdeusopblico,deberncumplirporsucuenta,con elplandereforestacindelahoyahidrogrfica. Todos los propietarios de predios rurales tendrn la obligacin de plantar y cultivarrbolesenlneaslimtrofesdesusrespectivaspropiedades. os propietarios de predios rurales tendrn obligacin de plantar y cultivar L rbolesenlaslneaslimtrofesdesusrespectivaspropiedades. Todoslaspersonasquecelebrencontratosconelestado(Dpto.Municipio)para construircarreteras,vas,caminoscarreteables,vaspblicasengeneral,debern entregarlasvasdelimitadosconrbolesornamentalesoindustrialesconcarcter permanentes. Todoslosmunicipiosprocedernaorganizarysostenerporlomenosunvivero de rboles maderables, ornamentaleso industriales y frutales adecuados parala respectivaregin. Las exportaciones de cualquier tipo de producto forestal requieren licencia del MinisteriodeAgricultura. Queda prohibido cortar, destruir, o daar las plantaciones de tagua, caucho, balata, chicle, Tol, juansoco, pita, henequn, piassaba, jengibre y palmas productorasdenuecesoleaginosas. Registro:Todaslasplantacionesforestales,cercasvivas,barrerasrompevientos, desombro,cultivosagrcolas,debenregistraseantelacorporacinysuministrar lasiguienteinformacinlacualemitirunaprovidencia,previavisitatcnica. Nombredelpropietario. Ubicacindelpredio,indicandojurisdiccin,yvereda. reaokilmetrosdecercaviva,nombredelasespeciesplantadas. odeestablecimiento. A iespropiedadprivada,copiadelaescritura,certificadodelibertad,contratode S arrendamiento,sielinteresadonoeselpropietariorequierelaautorizacin. Sistemaomtododeaprovechamiento. Extensindelreayvolumendelasespecies. 7.4 FAUNA TERRESTRE Decreto Ley 2811 de 1974 Cdigo de Recursos Naturales Su proteccin tiene como finalidad asegurar la conservacin, fomento y aprovechamiento racional dela fauna silvestre. La fauna que se encuentra en el territorio nacional pertenece a la nacin las especies de los zoocriaderos y los cotosdecazadepropiedadparticular.

38

FaunaSilvestre:Eselconjuntodeanimalesquenohansidoobjetode domesticacin,mejoramientogentico,craolevante,oquehanregresadoasu estadosalvaje. PROHIBICIONES Hacerquemasoincendiosparaacorrarlar,hacerhuirodarmuertealapresa. Usar explosivos, sustancias venenosas, pesticidas o cualquier otro agente qumicoquecauselamuerteoparalizacinpermanentedeanimales. Usar instrumentos o sistemas de especimenes que no correspondan a las permitidasparaciertascazas. azarenreasvedadasoentiempodeveda. C Cazarocomercializarespeciesvedadas,oquenodenlatalla,ocomercializar susproductos. Adquirirconfinescomercialesproductosdelacazaquenorenenlosrequisitos legales. Utilizarproductosoprocedimientosquenoestnexpresamenteautorizados. Exportar individuos vivos de la fauna silvestre, salvo los destinados a la investigacincientfica. ClasesdeCaza: De Subsistencia: tiene como objetivo exclusivo proporcionar alimento a quien lo ejecutaosufamilia. Comercial: La que se realiza por personas naturales o jurdicas para obtener beneficioeconmico. Deportiva.Laquesehacecomorecreacinyejercicio. Cientfica:Seprcticaconfinesdeinvestigacin. Control. Con el propsito de regular la poblacin de una especie cuando as se requiera. Fomento: Con el propsito de adquirir ejemplares para establecimiento de zoocriaderos. Serequierepermisoparaelejerciciodelacaza,salvoladesubsistencia.El permiso no es transferible. Tiene que elaborar un estudio de inventario y de declaracindeimpactoambiental. 8.LICENCIASAMBIENTALES Las licencias ambientales han sido reguladas en los ltimos tiempos por el 1753/94Decreto1180de2003,Decreto1220de2005. La licencia ambiental es una autorizacin otorgada por la autoridad ambiental competente para la ejecucin de un proyecto, obra, actividad, la cual sujeta al

39

beneficiario de esta al cumplimiento de los requisitos, trminos, obligaciones, condiciones que la misma establezca en relacin con la prevencin, mitigacin, compensacin,correccin,manejodelosefectosambientalesdelproyectoquese autoriza. Lleva implcito todos los permisos, autorizaciones, concesiones para el uso aprovechamiento y/o afectacin de los recursos naturales que sean necesarios para el desarrollo del proyecto. La Licencia ambiental es PREVIA a la iniciacin delproyecto Plazo: Se concede por el tiempo que dure la ejecucin del proyecto y cobija las etapas de explotacin, construccin, operacin, mantenimiento, desmantelamiento,abandonooterminacin. Competenciaparaotorgarlaslicencias: Ministerio del Medio Ambiente CARS y las de Desarrollo Sostenible Grandes Centros Urbanos reas Metropolitanas. Las autoridades ambientales creadas medianteLey768de2002.Municipiospordelegacin. Requisitos: DiagnsticoAmbientaldealternativas: EstudiodeImpactoAmbiental. 1.Resumendelproyecto. 2.Delimitacindelreadelproyecto. 3.Descripcindeproyecto,localizacin,etapas,dimensiones,costos,cronograma de procesos, identificacin de los insumos, productos, residuos, emisiones, vertimientos riesgos inherentes, tecnologa a utilizar, sus fuentes y sistemas de control. 4.Determinacindelosrecursosnaturalesquesepretendanusar, aprovecharoafectar. 5.Caracterizacindelmedioabiticoybitico,socioeconmico,yculturaldellugar endondeserealizarelproyecto. 6. Identificacin y evaluacin de los impactos ambientales que se puedan ocasionar, indicando cuales pueden prevenirsen, mitigarse, corregirse o compensarse. 7.PropuestadeunPlandeManejo. Medidasdemitigacin,prevencin,correccin. Programa de monitoreo y control, para verificar al cumplimiento de las obligaciones, verificar estndares de calidad, indicadores de desempeo

40

ambiental,laeficaciadelasmedidasylapertinenciadelasmismasencada unodeloscasos. Plandecontingencia,atencindeemergencias. Costos proyectados en el plan de manejo en relacin con el valor del proyecto.

ElMinisterioentregarlostrminosdereferenciaparacadacasodeEstudiode ImpactoAmbiental. Procedimientoparaotorgarlicencia: Peticinporescrito. DiagnosticoAmbientaldealternativas(todaslasdelMinisterioylosNo.2y 3a)y7)delartculo9delDecreto1220de2005. Nombreyraznsocial. NombredelRepresentante,poderotorgado. CertificadodeExistenciayRepresentacinlegal. Descripcinexplicativadelproyecto. Descripcindelascaractersticasambientalesenelreadeinfluenciadel proyecto.Indicarsielproyectoafectaelsistemadeparquesnacionalesolas zonasdeamortiguamiento. Relacin de los recursos usados, aprovechados o afectados. Estudio de ImpactoAmbiental. Seotorgamedianteresolucin. Sepuedemodificarpor: Solicituddelinteresado. Cuandosepretendanvariarlascondiciones. Cuandonosecontemplaronenformasuficienteelaprovechamiento,usoso afectacindelosrecursosnaturales.

CambiodelSolicitante:Encualquiermomentopuedecambiarseelsolicitantepor peticindelosinteresados. CesindelaLicenciaambiental:Sepuedeceder,conautorizacindela autoridadambiental,serequierecopiadeldocumento.SuspensinoRevocatoria delasLicencias:cuandoseincumplecualquieradelascondiciones,obligaciones, trminos,exigenciasmedianteresolucinmotivada,previaalarevocatoriao suspensindeberrequerirseunavezalbeneficiario. Control y Seguimiento: Las autoridades ambientales deben realizar control y seguimientoalosplanesdemanejoambientalpresentadosyaprobadospor ella. SANCIONESAMBIENTALES

41

PROCEDIENTOSPARALAIMPOSICINDEUNASANCIN: Elpargrafodelarticulo85delaley99de1993estableciqueparalaaplicacin de medidas preventivas y sanciones a las personas naturales o jurdicas que infrinjan la normatividad ambiental, se seguir el procedimiento previsto por el decreto1594de1984estatutoquelomodifiqueosustituya. SANCIONES La sancin no es otra cosa que la consecucin jurdica atribuida a una persona natural o jurdica por la incursin en una contravencin de carcter ambiental. Segnelartculo85delaley99de1993,seclasificanas: ultas Consiste en el pago de una suma de dinero a favor de la entidad, la M norma establece multas diarias hasta por una suma equivalente a 300 salarios mnimosmensualesliquidadosenelmomentodedictarselarespectivaresolucin. Elpagodelamultanoeximealinfractordelaejecucindelasobrasomedidas que hayan sido ordenadas por la autoridad, ni de la obligacin de restaurar el medio ambiente y los recursos naturales afectados, ni del pago a terceros que sufranperjuicioparticularyexijanunaindemnizacindentrodeunprocesocivilo penalqueseadelanteantelaautoridadcompetente. Suspensindelregistro,licencia,concesin,permisooautorizacin Esla privacin temporal del derecho que confiere la ley y se impondr cuando quiera quemedianteamonestaciones,multaodecomiso,nohayasidoposibleobtenerel cumplimientodelanorma,yconllevaelcesedeactividadesqueconfundamento enunactoadministrativoestrealizandoelusuario. Cierre temporal o definitivo del establecimiento, edificacin o servicio, y revocatoriaocaducidaddelpermisodeconcesin.Consisteenponerfinalas tareasoactividadesquesedesarrollanenellugar.Elcierrepuedeordenarsepara todo el establecimiento o servicio, o slo para una parte o proceso que se desarrolleenl,ysehaceefectivomediantesellosobandas.Cuandoelcierresea definitivoimplicalaperdidadelpermisoolicencia. Cuando especficamente se trate de la suspensin o revocatoria de la licencia ambientaleldecreto1753de1994establecequelaautoridadambientalproceder a requerir por una sola vez al beneficiario de sta, para que corrija el incumplimientoenelcualhaincurridoopresentelasexplicacionesqueconsidere necesarias sobre las causas de su incumplimiento. En el mismo acto de requerimiento la autoridad ambiental competente fijara el plazo para corregir el incumplimientosegnlanaturalezadelasunto. Demolicin de obra a costa del infractor Se deben presentar simultneamentelossiguientesrequisitos:Haberadelantadolaobrasinpermisoo

42

licencia, y no haber causado dao evidente al medio ambiente o a los recursos naturales. DecomisoEseldecomisodefinitivodeespeciesoindividuosdefaunaoflorao de productos oimplementos utilizados paracometer la infraccin. Consiste enla aprehensinmaterialdelasespecies,productosoimplementos,yseperfecciona poniendolosbienesendepsitooenpoderdelaautoridadambiental.

9.CONCLUSION

43

La crisis del medio ambiente se ha ido acelerando durante la segunda mitad de este siglo, con la expansin capitalista. En ltima instancia, los procesos socioeconmicosytecnolgicosdesencadenantesdelacrisisambiental,seunen alaincapacidaddecomprensinhumanadelambiente,delmundoydelavidaen su compleja totalidad, para admitir la verdadera dimensin del hombre en la naturaleza. Es por esto que el hombre se ve en la obligacin de aplicar la Normatividad Ambiental vigente para garantizar la conservacin de los recursos naturales.

44

10.BIBLIOGRAFIA 1. ECHARRI Lus, Poblacin, ecologa y ambiente Universidad de Navarra (Espaa), Capitulo 11 Repercusiones Polticas, Econmicas y Sociales de losProblemasAmbientalesp3.2007. 2. VEGA MORA Leonel, Polticas Pblicas Hacia el Desarrollo Sostenible y PolticaAmbientalHacialaSostenibilidadAmbientaldelDesarrollo. 3. PRINCIPIOSBSICOSLey99de1993. 4. PROGRAMA PRECIDENCIAL DE LUCHA CONTRA LA CORRUPCIN, HerramientaparaelEjerciciodelControlCiudadanop.1782003. 5. Memorias Diplomado Gestin Ambiental Para la Produccin Ms Limpia Universidad Pontificia Bolivariana ao 2005. (Modulo de Legislacin Ambiental)p40

45