Sie sind auf Seite 1von 689

Patanjali: Vyakaranamahabhasya, Adhyaya 1

Patanjali: Vyakaranamahabhasya (Mahabhasya) Based on the edition by Franz Kielhorn (Bombay 1880-1885), revised by K.V. Abhyankar (Poona 1972-1996). With additional references of the edition Gurukuljhajjar, Rohatak (Rohtak) : Hariyana sahitya samsthan, 1961-1963, 5 vols. Input by George Cardona, formatted by Masato Kobayashi.

ADHYAYA 1 (unsegmented)

STRUCTURE OF REFERENCES: KA_n,n.n = Kielhorn/Abhyankar edition_ volume,page.line Ro_n,n.n = Rohatak edition_volume,page.line Pas_nn = Paspahnika s_nn = ivastra P_n,n.n.n = Pini_adhyya,pda.stra {line nn/of total nn} = (Breaks up longer discussions into discrete thematic groups.) BOLD = Ktyyana's Vrttikas #<...># = BOLD

THIS GRETIL TEXT FILE IS FOR REFERENCE PURPOSES ONLY! COPYRIGHT AND TERMS OF USAGE AS FOR SOURCE FILE. Text converted to Unicode (UTF-8). (This file is to be used with a UTF-8 font and your browser's VIEW configuration set to UTF-8.)

file:///C|/Users/student/Desktop/siddhanta%20...jali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (1 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

description: long a long A long i long I long u long U vocalic r vocalic R long vocalic r vocalic l long vocalic l velar n velar N palatal n palatal N retroflex t retroflex T

multibyte sequence: r R r l l

file:///C|/Users/student/Desktop/siddhanta%20...jali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (2 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

retroflex d retroflex D retroflex n retroflex N palatal s palatal S retroflex s retroflex S anusvara anunasika m visarga Unless indicated otherwise, accents have been dropped in order to facilitate word search. For a comprehensive list of GRETIL encodings and formats see: www.sub.uni-goettingen.de/ebene_1/fiindolo/gretil/gretdiac.pdf and www.sub.uni-goettingen.de/ebene_1/fiindolo/gretil/gretdias.pdf

(Pas_1) KA_I,1.1-5 Ro_I,1-4 atha abdnusanam . atha iti ayam abda adhikrrtha prayujyate . abdnusanam stram adhikrtam veditavyam . kem abdnm . laukiknm vaidiknm ca . tatra laukik tvat : gau ava purua hast akuni mrga brhmaa iti . vaidik khalu api : am na dev abhiaye . ie tv rje tv . agnim le purohitam . agne ayhi vtaye iti . (Pas_2) KA_I,1.6-13 Ro_I,5-7 atha gau iti atra ka abda . kim yat tat ssnlglakakudakhuravii artharpam sa abda . na iti ha . dravyam nma tat . yat tarhi tat igitam ceitam nimiitam sa abda . na iti ha . kriy nma s . yat tarhi tat ukla nla kra kapila kapota iti sa abda . na iti ha . gua nma sa . yat tarhi tat bhinneu abhinnam chinneu acchinnam smnyabhtam sa abda . na iti ha . krti nma s . ka tarhi abda . yena uccritena ssnlglakakudakhuraviinm sampratyaya bhavati sa abda . atha v prattapadrthaka loke dhvani abda iti ucyate . tat yath abdam kuru m abdam kr abdakr ayam mavaka iti . dhvanim kurvan evam ucyate . tasmt dhvani abda .

file:///C|/Users/student/Desktop/siddhanta%20...jali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (3 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(Pas_3) KA_I,1.14-2.2 Ro_I,8-14 kni puna abdnusanasya prayojanni . rakohgamalaghvasandeh proyojanam . rakrtham vednm adhyeyam vykaraam . lopgamavaravikraja hi samyak vedn pariplayiyati . ha khalu api. na sarvai ligai na ca sarvbhi vibhaktibhi vede mantr nigadit. te ca avayam yajagatena yathyatham vipariamayitavy. tn na avaiykaraa aknoti yathyatham vipariamayitum. tasmt adhyeyam vykaraam . gama khalu api . brhmaena nikraa dharma aaga veda adhyeya jeya iti . pradhnam ca asu ageu vykaraam . pradhne ca krta yatna phalavn bhavati . laghvartham ca adhyeyam vykaraam. brhmaena avayam abd jey iti . na ca antarea vykaraam laghun upyena abd aky jtum . asandehrtham ca adhyeyam vykaraam . yjik pahanti . sthlapratm gnivrum anavhm labheta iti . tasym sandeha sthl ca asau prat ca sthlaprat sthlni pranti yasy s sthlaprat . tm na avaiykaraa svarata adhyavasyati . yadi prvapadaprakrtisvaratvam tata bahuvrhi. atha antodttatvam tata tatpurua iti . (Pas_4.1) KA_I,2.3-9 Ro_I,11-12 imni ca bhya abdnusanasya prayojanni . te asur , dua abda , yat adhtam , ya tu prayukte , avidvsa , vibhaktim kurvanti , ya vai imm , catvri , uta tva , saktum iva , srasvatm , daamym putrasya , sudeva asi varua iti . te asur . te asur helaya helaya iti kurvanta par babhvu . tasmt brhmaena na mlecchitavai na apabhitavai . mleccha ha vai ea yat apaabda . mlecch m bhma iti adhyeyam vykaraam . te asur (Pas_4.2) KA_I,2.10-14 Ro_I,12-13 dua abda . dua abda svarata varata v mithy prayukta na tam artham ha . sa vgvajra yajamnam hinasti yath indraatru svarata apardht . dun abdn m prayukmahi iti adhyeyam vykaraam . dua abda . (Pas_4.3) KA_I,2.14-17 Ro_I,3 yat adhtam . yat adhtam avijtam nigadena eva abdyate anagnau iva ukaidha na tat jvalati karhi cit . tasmt anarthakam m adhigmahi iti adhyeyam vykaraam. yat adhtam . (Pas_4.4) KA_I,2.18-3.5 Ro_I,13-15 ya tu prayukte . ya tu prayukte kuala viee abdn yathvat vyavahrakle sa anantam pnoti jayam paratra vgyogavit duyati ca apaabdai . ka . vgyogavit eva . kuta etat . ya hi abdn jnti apaabdn api asau jnti . yath eva hi abdajne dharma evam apaabdajne api adharma . atha v bhyn adharma prpnoti . bhysa apaabd alpysa abd . ekaikasya hi abdasya bahava apaabd . tat yath gau iti asya abdasya gv go got gopotalik iti evamdaya apabhra . atha ya avgyogavit . ajnam tasya araam . na atyantya ajnam araam bhavitum arhati . ya hi ajnan vai brhmaam hanyt surm v pibet sa api manye patita syt. evam tarhi sa anantam pnoti jayam paratra vgyogavit duyati ca apaabdai . ka. avgyogavit eva . atha ya vgyogavit . vijnam tasya araam . kva puna idam pahitam . bhrj nma lok . kim ca bho lok api pramam . kim ca ata . yadi pramam ayam api loka pramam bhavitum arhati . yat udumbaravarnm ghanm maalam mahat ptam na svargam gamayet kim tat kratugatam nayet iti . pramattagta ea tatrabhavata . ya tu apramattagta tat pramnam . yas tu prayukte .
file:///C|/Users/student/Desktop/siddhanta%20...jali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (4 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(Pas_4.5) KA_I,3.6-9 Ro_I,15 avidvsa . avidvsa pratyabhivde nmna ye plutim na vidu kmam teu tu viproya stru iva ayam aham vadet . abhivde strvat m bhma iti adhyeyam vykaraam . avidvsa (Pas_4.6) KA_I,3.10-11 Ro_I,16 vibhaktim kurvanti . yjik pahanti : prayj savibhaktik kry iti . na ca antarea vykaraam prayj savibhaktik aky kartum. vibhaktim kurvanti (Pas_4.7) KA_I,3.12-13 Ro_I,16 ya vai imm . ya vai imm padaa svaraa akaraa vcam vidadhti sa rtvijna . rtvijn syma iti adhyeyam vykaraam . ya vai imm . (Pas_4.8) KA_I,3.14-29 Ro_I,16-18 catvri . catvari rg traya asya pad dve re sapta hastsa asya tridh baddha vrabha roravti maha deva martyn a vivea . catvri rgni catvri padajtni nmkhytopasarganipt ca . traya asya pd traya kl bhtabhaviyadvartamn . dve re dvau abdtmnau nitya krya ca . sapta hastsa asya sapta vibhaktaya . tridh baddha triu sthneu baddha urasi kahe irasi iti . vrabha varat . roravti abdam karoti . kuta etat . rauti abdakarm . maha deva martyn vivea iti . mahn deva abda . marty maraadharma manuy . tn vivea . mahat devena na smyam yath syt iti adhyeyam vykaraam . apara ha : catvari vak parimit padani tani vidu brhmaa ye mania guh tri nihit na igayanti turyam vca manuy vadanti . catvri vk parimit padni . catvri padajtni nmkhytopasarganipt ca . tni vidu brhma ye mania . manasa ia mania . guh tri nihit na igayanti . guhym tri nihitni na igayanti . na ceante . na nimianti iti artha . turyam vca manuy vadanti . turyam ha vai etat vca yat manuyeu vartate . caturtham iti artha . catvri . (Pas_4.9) KA_I,4.5-8 Ro_I,18-19 uta tva . uta tva payan na dadara vacam uta tva rvan na roti enm uto tvasmai tanvam visasre jya iva patye uat suvas . api khalu eka payan api na payati vcam . api khalu eka rvan api na roti enm . avidvsam ha ardham . uto tvasmai tanvam visasre . tanum vivrute . jy iva patye uat suvs . tad yath jy patye kmayamn suvs svam tmnam vivrute evam vk vgvide svtmnam vivrute . vk na vivruyt tmnam iti adhyeyam vykaraam . uta tva . (Pas_4.10) KA_I,4.9-18 Ro_I,19-20 saktum iva . saktum iva titaun punanta yatra dhr manas vacam akrata atr sakhya sakhyani jnate bhadra em lakm nihit adhi vci . saktu sacate durdhva bhavati . kasate v vipartt vikasito bhavati . titau paripavanam bhavati tatavat v tunnavat v . dhr dhynavanta manas prajnena vcam akrata vcam akrata . atr sakhya sakhyni jnate . syujyni jnate . kva . ya ea durgha mrga ekagamya vgviaya . ke puna te . vaiykara . kuta etat . bhadr em lakm nihit adhi vci . em vci bhadr lakm nihit bhavati . lakm lakat bhsant parivrh bhavati . saktum iva . (Pas_4.11) KA_I,4.19-21 Ro_I,21 srasvatm. yjik pahanti : hitgni apaabdam

file:///C|/Users/student/Desktop/siddhanta%20...jali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (5 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prayujya pryacittym srasvatm iim nirvapet iti . pryacitty m bhma iti adhyeyam vykaraam . srasvatm . (Pas_4.12) KA_I,4.22-25 Ro_I,21 daamym putrasya . yjik pahanti : daamyuttaraklam putrasya jtasya nma vidadhyt ghoavaddi antarantastham avrddham tripurunkam anaripratihitam . tat hi pratihitatamam bhavati . dvyakaram caturakaram v nma krtam kuryt na taddhitam iti . na ca antarea vykaraam krta taddhit v aky vijtum . daamym putrasya . (Pas_4.13) KA_I,4.26-5.4 Ro_I,21-22 sudeva asi . sudeva asi varua yasya te sapta sindhava anukaranti kkudam srmyam suiram iva . sudeva asi varua satyadeva asi yasya te sapta sindhava sapta vibhaktaya . anukaranti kkudam . kkudam tlu . kku jihv s asmin udyate iti kkudam . srmyam suirm iva . tad yath obhanm rmm suirm agni anta praviya dahati evam tava sapta sindhava sapta vibhaktaya tlu anukaranti . tena asi satyadeva . satyadev syma iti adhyeyam vykaraam . sudeva asi . (Pas_5) KA_I,5.5-11 Ro_I,22-23 kim puna idam vykaranam eva adhijigsamnebhya prayojanam anvkhyyate na puna anyat api kim cit . om iti uktv vrttntaa am iti evamdn abdn pahanti . purkalpe etat st : saskrottaraklam brhma vykaraam sma adhyate . tebhya tatra sthnakaranupradnajebhya vaidik abd upadiyante . tat adyatve na tath . vedam adhtya tvarit vaktra bhavanti : vedt na vaidik abd siddh lokt ca laukik . anarthakam vykaraam iti . tebhya vipratipannabuddhibhya adhyetrbhya crya idam stram anvcae : imni prayojanni adhyeyam vykaraam iti . (Pas_6) KA_I,5.11-22 Ro_I,23-24 ukta abda . svarpam api uktam . prayojanni api uktni . abdnusanam idnm kartavyam . tat katham kartavyam . kim abdopadea kartavya hosvit apaabdopadea hosvit ubhayopadea iti . anyataropadeena krtam syt . tat yath bhakyaniyamena abhakyapratiedho gamyate . paca pacanakh bhaky iti ukte gamyate etat : ata anye abhaky iti . abhakyapratiedhena v bhakyaniyama . tat yath abhakya grmyakukkua abhakya grmyakara iti ukte gamyate etat : raya bhakya iti . evam iha api : yadi tvat abdopadea kriyate gau iti etasmin upadie gamyate etat : gvydaya apaabd iti . atha apaabdopadea kriyate gvydiu upadieu gamyate etat : gau iti ea abda iti . kim puna atra jyya . laghutvt abdopadea . laghyn abdopadea garyn apaabdopadea . ekaikasya abdasya bahava apabhra . tat yath . gau iti asya abdasya gvgogotgopotalikdaya apabhra . invkhynam khalu api bhavati . (Pas_7) KA_I,5.23-6.7 Ro_I,24-25 atha etasmin abdopadee sati kim abdnm pratipattau pratipadapha kartavya : gau ava purua hast akuni mrga brhmaa iti evamdaya abd pahitavy . na iti ha . anabhyupya ea abdnm pratipattau pratipadapha . evam hi ryate : brhaspati indrya divyam varasahasram pratipadoktnm abdnm abdapryaam provca na antam jagma . brhaspati ca pravakt indra ca adhyet divyam varasahasram adhyayanakla na ca antam jagma . kim puna adyatve . ya sarvath ciram jvati sa varaatam jvati . caturbhi ca prakrai vidy
file:///C|/Users/student/Desktop/siddhanta%20...jali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (6 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

upayukt bhavati gamaklena svdhyyaklena pravacanaklena vyavahraklena iti . tatra ca gamaklena eva yu paryupayuktam syt . tasmt anabhyupya abdnm pratipattau pratipadapha . katham tarhi ime abd pratipattavy . kim cit smanyavieavat lakaam pravartyam yena alpena yatnena mahata mahata abdaughn pratipadyeran . kim puna tat . utsargpavdau . ka cit utsarga kartavya ka cit apavda . kathajtyaka puna utsarga kartavya kathajtyaka apavda . smanyena utsarga kartavya . tat yath karmai a . tasya vieea apavda . tat yath . ta anupasarge ka . (Pas_8) KA_I,6.8-11 Ro_I,25-26 kim puna krti padrtha hosvit dravyam . ubhayam iti ha . katham jyate . ubhayath hi cryea stri pahitni . krtim padrtham matv jtykhyym ekasmin bahuvacanam anyatarasym iti ucyate . dravyam padrtham matv sarpm ekaea ekavibhaktau iti ekaea rabhyate . (Pas_9) KA_I,6.12-14 Ro_I,26-27 kim puna nitya abda hosvit krya . sagrahe etat prdhnyena parkitam nitya v syt krya v iti . tatra ukt do prayojanni api uktni . tatra tu ea niraya yadi eva nitya atha api krya ubhayath api lakaam pravartyam iti . (Pas_10.1) KA_I,6.14-7.7 Ro_I,27-30 katham puna idam bhagavata pine cryasya lakaam pravrttam . siddhe abdrthasambandhe . siddhe abde arthe sambandhe ca iti . atha siddhaabdasya ka padrtha . nityaparyyavc siddhaabda . katham jyate . yat kastheu avicliu bhveu vartate . tat yath siddh dyau , siddh prthiv siddham kam iti . nanu ca bho kryeu api vartate . tat yath siddha odana , siddha spa siddh yavg iti . yvat kryeu api vartate tatra kuta etat nityaparyyavcina grahaam na puna krye ya siddhaabda iti . sagrahe tvat kryapratidvandvibhvt manymahe nityaparyyavcina grahaam iti . iha api tat eva . atha v santi ekapadni api avadhrani . tat yath : abbhaka vyubhaka iti . apa eva bhakayati vyum eva bhakayati iti gamyate . evam iha api siddha eva na sdhya iti . atha v prvapadalopa atra draavya : atyantasiddha siddha iti . tat yath devadatta datta , satyabhm bhm iti . atha v vykhynata vieapratipatti na hi sandeht alakaam iti nityaparyyavcina grahaam iti vykhysyma . kim puna anena varyena . kim na mahat kahena nityaabda eva uptta yasmin updyamne asandeha syt . magalrtham . mgalika crya mahata straughasya magalrtham siddhaabdam dita prayukte . magaldni hi stri prathante vrapuruaki ca bhavanti yumatpuruaki ca . adhyetra ca siddhrth yath syu iti . ayam khalu api nityaabda na avayam kastheu avicliu bhveu vartate . kim tarhi . bhkye api vartate . tat yath nityaprahasita nityaprajalpita iti . yvat bhkye api vartate tatra api anyena eva artha syt vykhynata vieapratipatti na hi sandeht alakaam iti . payati tu crya magalrtha ca eva siddhaabda dita prayukta bhaviyati akymi ca enam nityaparyyavcinam varayitum iti . ata siddhaabda eva uptta na nityaabda . (Pas_10.2) KA_I,7.8-8.1 Ro_I,30-32 atha kam puna padrtham matv ea vigraha kriyate siddhe abde arthe sambandhe ca iti . krtim iti ha . kuta etat . krti hi nity . dravyam anityam . atha dravye padrthe katham vigraha kartavya . siddhe abde arthasambandhe ca iti . nitya hi arthavatm arthai abhisambandha . atha v dravye eva
file:///C|/Users/student/Desktop/siddhanta%20...jali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (7 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

padrthe ea vigraha nyyya siddhe abde arthe sambandhe ca iti. dravyam hi nityam krti anity . katham jyate . evam hi dryate loke . mrt kay cit krty yukt pia bhavati . pikrtim upamrdya ghaik kiryante . ghaikkrtim upamrdya kuik kriyante . tath suvaram kay cit krty yuktam pia bhavati . pikrtim upamrdya rucak kriyante . rucakkrtim upamrdya kaak kriyante . kaakkrtim upmrdya svastik kriyante . puna vrtta suvarapia puna aparay krty yukta khadirgrasavare kuale bhavata . krti any ca any ca bhavati dravyam puna tad eva . krtyupamardena dravyam eva avaiyate . krtau api padrthe ea vigraha nyyya siddhe abde arthe sambandhe ca iti . nanu ca uktam krti anity iti . na etat asti . nity krti . katham . na kva cit uparat iti krtv sarvatra uparat bhavati . dravyntarasth tu upalabhyate . atha v na idam eva nityalakaam dhruvam kastham avicli anapyopajanavikri anutpatti avrddhi avyayayogi iti tan nityam iti . tat api nityam yasmin tattvam na vihanyate . kim puna tattvam . tadbhva tattvam . krtau api tattvam na vihanyate . atha v kim na etena idam nityam idam anityam iti . yat nityam tam padrtham matv ea vigraha kriyate siddhe abde arthe sambandhe ca iti . katham puna jyate siddha abda artha sambandha ca iti . lokata . yat loke artham updya abdn prayujate . na em nirvrttau yatnam kurvanti . ye puna kry bhv nirvrttau tvat tem yatna kriyate . tat yath . ghaena kryam kariyan kumbhakrakulam gatv ha kuru ghaam . kryam anena kariymi iti . na tadvat abdn prayokyama vaiykaraakulam gatv ha . kuru abdn . prayokye iti . tvati eva artham updya abdn prayujate . (Pas_11) KA_I,8.1-22 Ro_I,32-35 yadi tarhi loka eu pramam kim strea kriyate . lokata arthaprayukte abdaprayoge strea dharmaniyama . lokata arthaprayukte abdaprayoge strea dharmaniyama kriyate . kim idam dharmaniyama iti . dharmya niyama dharmaniyama dharmrtha v niyama dharmaniyama dharmaprayojana v niyama dharmaniyama . yath laukikavaidikeu . priyataddhit dkity . yath loke vede ca iti prayoktavye yath laukikavaidikeu iti prayujate . atha v yukta eva taddhitrtha . yath laukikeu vaidikeu ca krtnteu . loke tvat abhakya grmyakukkua abhakya grmyakara iti ucyate . bhakyam ca nma kutpratghtrtham updyate . akyam ca anena vamsdibhi api kut pratihantum . tatra niyama kriyate . idam bhakyam . idam abhakyam iti . tath khedt stru pravrtti bhavati . samna ca khedavigama gamyym ca agamyym ca . tatra niyama kriyate : iyam gamy iyam agamy iti . vede khalu api payovrata brhmaa yavgvrata rjanya mikvrata vaiya iti ucyate . vratam ca nma abhyavahrrtham updyate . akyam ca anena limsdni api vratayitum . tatra niyama kriyate . tath bailva khdira v ypa syt iti ucyate . ypa ca nma pavanubandhrtham updyate . akyam ca anena kim cit eva kham ucchritya anucchritya v pau anubanddhum . tatra niyama kriyate . tath agnau kaplni adhiritya abhimantrayate . bhrgm agirasm gharmasya tapas tapyadhvam iti . antarea api mantram agni dahanakarm kaplni santpayati . tatra niyama kriyate . evam kriyamam abhyudayakri bhavati iti . evam iha api samnym arthagatau abdena ca apaabdena ca dharmaniyama kriyate . abdena eva artha abhidheya na apaabdena iti . evam kriyamam abhyudayakri bhavati iti .

file:///C|/Users/student/Desktop/siddhanta%20...jali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (8 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(Pas_12) KA_I,8.23-10.3 Ro_I,35-39 asti aprayukta . santi vai abd aprayukt . tat yath a tera cakra peca iti . kim ata yat santi aprayukt . prayogt hi bhavn abdnm sdhutvam adhyavasyati . ye idnm aprayukt na am sdhava syu . idam vipratiiddham yat ucyate santi vai abd aprayukt iti . yadi santi na aprayukt . atha aprayukt na santi . santi ca aprayukt ca iti vipratiiddham . prayujna eva khalu bhavn ha santi abd aprayukt iti . ka ca idnm anya bhavajjtyaka purua abdnm prayoge sdhu syt . na etat vipratiiddham . santi iti tvat brma yat etn stravida strea anuvidadhate . aprayukt iti brma yat loke aprayukt iti . yat api ucyate ka ca idnm anya bhavajjtyaka purua abdnm prayoge sdhu syt iti . na brma asmbhi aprayukt iti . kim tarhi . loke aprayukt iti . nanu ca bhavn api abhyantara loke . abhyantara aham loke na tu aham loka . asti aprayukta iti cet na arthe abdaprayogt . asti aprayukta iti cet tat na . kim kraam . arthe abdaprayogt . arthe abd prayujyante . santi ca em abdnm arth yeu artheu prayujyante . aprayoga prayognyatvt . aprayoga khalu e abdnm nyyya . kuta . prayognyatvt . yat etem abdnm arthe anyn abdn prayujate . tat yath . a iti etasya abdasya arthe kva yyam uit . tera iti asya arthe kim yyam tr . cakra iti asya arthe kim yyam krtavanta . peca iti asya arthe kim yyam pakvavanta iti . aprayukte drghasattravat . yadi api aprayukt avayam drghasattravat lakaena anuvidhey . tat yath . drghasattri vraatikni vrasahasriki ca . na ca adyatve ka cit api vyavaharati . kevalam risampradya dharma iti krtv yjik strea anuvidadhate . sarve dentare . sarve khalu api ete abd dentare prayujyante . na ca ete upalabhyante . upalabdhau yatna kriyatm . mahn hi abdasya prayogaviaya . saptadvp vasumat traya lok catvra ved sg sarahasy bahudh vibhinn ekaatam adhvaryukh sahasravartm smaveda ekavisatidh bhvrcyam navadh tharvaa veda vkovkyam itihsa puram vaidyakam iti etvn abdasya prayogaviaya . etvantam abdasya prayogaviayam ananuniamya santi aprayukt iti vacanam kevalam shasamtram . etasmin atimahati abdasya prayogaviaye te te abd tatra tatra niyataviay dryante . tat yath . avati gatikarm kambojeu eva bhita bhavati . vikre enam ry bhante ava iti . hammati surreu rahati prcyamadhyeu gamim eva tu ry prayujate . dti lavanrthe prcyeu dtram udcyeu . ye ca api ete bhavata aprayukt abhimat abd etem api prayoga dryate . kva . vede . yat va revat revatyam tat a . yat me nara rutyam brahma cakra . yatra na cakra jarasam tanunm iti . (Pas_13) KA_I,10.4-11.14 Ro_I,39-42 kim puna abdasya jne dharma hosvit prayoge . ka ca atra viea . jne dharma iti cet tath adharma . jne dharma iti cet tath adharma prpnoti . ya hi abdn jnti apaabdn api asau jnti . yath eva abdajne dharma evam apaabdajne api adharma . atha v bhyn adharma prpnoti .bhysa apaabd alpysa abd . ekaikasya abdasya bahava apabhra . tat yath . gau iti asya gv go got gopotalik iti evamdaya apabhra . cre niyama . cre puna ri niyamam vedayate . te asur helaya helaya iti kurvanta parbabhvu iti . astu tarhi prayoge . prayoge sarvalokasya . yadi prayoge dharma sarva loka abhyudayena yujyeta . ka ca idnm bhavata matsara yadi sarva loka abhyudayena yujyeta . na khalu ka cit matsara . prayatnnarthakyam tu
file:///C|/Users/student/Desktop/siddhanta%20...jali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (9 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

bhavati . phalavat ca nma prayatnena bhavitavyam na ca prayatna phalt vyatirecya . nanu ca ye krtaprayatn te sdhya abdn prayokyante . te eva sdhya abhyudayena yokyante . vyatireka api vai lakyate . dryante hi krtaprayatn ca aprav akrtaprayatn ca prav . tatra phalavyatireka api syt . evam tarhi na api jne eva dharma na api prayoge eva . kim tarhi straprvake prayoge abhyudaya tat tulyam vedaabdena . straprvakam ya abdn prayukte sa abhyudayena yujyate . tat tulyam vedaabdena . vedaabd api evam abhivadanti . ya agniomena yajate ya u ca enam evam veda . ya agnim nciketam cinute ya u ca enam evam veda . apara ha : tat tulyam vedaabdena iti . yath vedaabd niyamaprvam adht phalavanta bhavanti evam ya straprvakam abdn prayukte sa abhyudayena yujyate iti . atha v puna astu jne eva dharma iti . nanu ca uktam jne dharma iti cet tath adharma iti . na ea doa . abdapramak vayam . yat abda ha tat asmkam pramam . abda ca abdajne dharmam ha na apaabdajne adharmam . yat ca puna aipratiiddham na eva tat doya bhavati na abhyudayya . tat yath . hikkitahasitakayitni na eva doya bhavanti na api abhyudayya . atha v abhyupya eva apaabdajnam abdajne . ya apaabdn jnti abdn api asau jnti . tat evam jne dharma iti bruvata artht pannam bhavati apaabdajnaprvake abdajne dharma iti . atha v kpakhnakavat etat bhavati . tat yath kpakhnaka khanan yadi api mrd psubhi ca avakra bhavati sa apsu sajtsu tata eva tam guam sdayati yena sa ca doa nirhayate bhyas ca abhyudayena yoga bhavati evam iha api yadi api apaabdajne adharma tath api ya tu asau abdajne dharma tena sa ca doa nirghniyate bhyas ca abhyudayena yoga bhaviyati . yat api ucyate cre niyama iti yje karmai sa niyama . evam hi ryate . yarva tarva nma raya babhvu pratyakadharma parparaj viditaveditavy adhigataythtathy . te tatrabhavanta yat v na tat v na iti proyoktavye yar v a tar v a iti prayujate yje puna karmai na apabhante . tai puna asurai yje karmai apabhitam . tata te parbabht . (Pas_14) KA_I,11.14-12.27 Ro_I,42-47 atha vykaraam iti asya abdasya ka padrtha . stram . stre vykarae ahyartha anupapanna . stre vykarae ahyartha na upapadyate vykaraasya stram iti . kim hi tat anyat strt vykaraam yasya ada stram syt . abdpratipatti . abdnm ca apratipatti prpnoti vykarat abdn pratipadymahe iti . na hi strata eva abdn pratipadyante . kim tarhi . vykhynata ca . nanu ca tat eva stram vigrhtam vykhynam bhavati . na kevalni carcpadni vykhyanam vrddhi t aic iti . kim tarhi . udharaam pratyudharaam vkydhyhra iti etat samuditam vykhynam bhavati . evam tarhi abda . abde lyuartha . yadi abda vykaraam lyuartha na upapadyate vykriyate anena iti vykaraam . na hi abdena kim cit vykriyate . kena tarhi . strea . bhave . bhave ca taddhita na upapadyate vykarae bhava yoga vaiykaraa iti . na hi abde bhava yoga . kva tarhi . stre . proktdaya ca taddhit . proktdaya ca taddhit na upapadyante pinin proktam pinyam , pialam , kakrtsnam iti . na hi pinin abd prokt . kim tarhi . stram . kimartham idam ubhayam ucyate bhave proktdaya ca taddhit iti na proktdaya ca taddhit iti eva bhave api taddhita codita syt . purastt idam cryea dram bhave taddhita iti tat pahitam . tata uttaraklam idam dram proktdaya ca taddhit iti tat api pahitam . na ca idnm cry stri krtv
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (10 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

nivartayanti . ayam tvat adoa yat ucyate abde lyuartha iti . na avayam karadhikaraayo eva lyu vidhyate kim tarhi anyeu api krakeu krtyalyua bahulam iti . tat yath praskandanam prapatanam iti . atha v abdai api abd vykriyante . tat yath gau iti ukte sarve sandeh nivartante na ava na gardabha iti . ayam tarhi doa bhave proktdaya ca taddhit iti . evam tarhi lakyalakae vykaraam . lakyam ca lakaam ca etat samuditam vykaraam bhavati . kim puna lakyam lakaam ca . abda lakyam stram lakaam . evam api ayam doa samudye vykaraaabda pravrtta avayave na upapadyate . stri ca adhyna iyate vaiykaraa iti . na ea doa . samudyeu hi abd pravrtt avayaveu api vartante . tat yath prve pacl , uttare pacl , tailam bhuktam , ghrtam bhuktam , ukla , nla , kra iti . evam ayam samudye vykaraaabda pravrtta avayave api vartate . atha v puna astu stram . nanu ca uktam stre vykarae ahyartha anupapanna iti . na ea doa . vyapadeivadbhvena bhaviyati . yat api ucyate abdpratipatti iti na hi strata eva abdn pratipadyante kim tarhi vykhynata ca iti parihrtam etat tat eva stram vigrhtam vykhynam bhavati iti . nanu ca uktam na kevalni carcpadni vykhynam vrddhi t aic iti kim tarhi udharaam pratyudharaam vkydhyhra iti etat samuditam vykhynam bhavati iti . avijnata etat evam bhavati . strata eva hi abdn pratipadyante . ta ca strata eva ya hi utstram kathayet na ada grhyeta . (Pas_15) KA_I,13.1-14.22 Ro_I,47-53 atha kimartha varnm upadea . vrttisamavyrtha upadea . vrttisamavyrtha varnm upadea kartavya . kim idam vrttisamavayrtha iti . vrttaye samavya vrttisamavya , vrttyartha v samavya vrttisamavya , vrttiprayojana v vrttisamavaya . k puna vrtti . strapravrtti . atha ka samavaya . varnm nuprvyea sannivea . atha ka upadea . uccraam . kuta etat . dii uccraakriya . uccrya hi varn ha : upadi ime var iti . anubandhakarartha ca . anubandhakarartha ca varnm upadea kartavya . anubandhn sakymi iti . na hi anupadiya varn anubandh aky saktum . sa ea varnm upadea vrttisamavyrtha ca anubandhakarartha ca . vrttisamavya ca anubandhakarartha ca pratyhrrtham . pratyhra vrttyartha . iabuddhyartha ca . iabuddhyartha ca varnm upadea . in varn bhotsye iti . iabuddhyartha ca iti cet udttnudttasvaritnunsikdrghaplutnm api upadea . iabuddhyartha ca iti cet udttnudttasvaritnunsikdrghaplutnm api upadea kartavya . evagu api hi var iyante . krtyupadet siddham . krtyupadet siddham etat . avarkrti upadi sarvam avarakulam grahyati . tath ivarakulkrti . tath uvarakulkrti . krtyupadet siddham iti cet savrtdnm pratiedha . krtyupadet siddham iti cet savrtdnm pratiedha vaktavya . ke puna savrtdaya . savrta kala dhmta ekrta ambkrta ardhaka grasta nirasta pragta upagta kvia romaa iti . apara ha : grastam nirastam avilambitam nirhatam ambkrtam dhmtam atho vikampitam sandaam ekrtam ardhakam drutam vikram et svaradoabhvan iti . ata anye vyajanado . na ea doa . gargdibiddipht savrtdnm nivrtti bhaviyati . asti anyat gargdibiddiphe prayojanam . kim . samudynm sdhutvam yath syt iti . evam tarhi adaadh bhinnm nivrttakaldikm avarasya pratypattim vakymi . s tarhi vaktavy . ligrth tu pratypatti . ligrtha s tarhi bhaviyati . tat tarhi vaktavyam . yadi api etat
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (11 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

ucyate atha v etarhi anubandhaatam na uccryam itsaj ca na vaktavy lopa ca na vaktavya . yat anubandhai kriyate tat kaldibhi kariyati . sidhyati evam apinyam tu bhavati . yathnysam eva astu . nanu ca uktam krtyupadet siddham iti cet savrtdnm pratiedha iti .parihrtam etat gargdibiddipht savrtdnm nivrtti bhaviyati . nanu ca anyat gargdibiddiphe prayojanam uktam . kim . samudynm sdhutvam yath syt iti . evam tarhi ubhayam anena kriyate . pha ca eva vieyate kaldaya ca nivartyante . katham puna ekena yatnena ubhayam labhyam . labhyam iti ha . katham . dvigat api hetava bhavanti . tat yath : mr ca sikt pitara ca prit iti . tath vkyni api vihni bhavanti . veta dhvati , alambusnm yt iti . atha v idam tvat ayam praavya . kve ime savrtdaya ryeran iti . gameu . gam uddh pahyante . vikreu tarhi . vikr uddh pahyante . pratyayeu tarhi . pratyay uddh pahyante . dhtuu tarhi . dhtava api uddh pahyante . prtipadikeu tarhi . prtipadikni api uddhni pahyante . yni tarhi agrahani prtipadikni . etem api svaravarnuprvjnrtha upadea kartavya . aa aa iti m bht . pala pala iti m bht . macaka majaka iti m bht . gam ca vikr ca pratyay saha dhtubhi uccryante tata teu na ime prpt kaldaya . (s_1.1) KA_I,15.2-16.18 Ro_I,54-60 akrasya vivrtopadea kragrahartha . akrasya vivrtopadea kartavya . kim prayojanam . kragrahartha . akra savaragragaena kram api yath grhyt . kim ca kraam na grhyt . vivrabhedt . kim ucyate vivrabhedt iti na puna klabhedd api . yath eva hi vivrabhinna evam klabhinna api . satyam etat . vakyati tulysyaprayatnam savaram iti atra syagrahaasya prayojanam sye yem tulya dea prayatna ca te savarasajak bhavanti iti . bhya ca puna syt kla . tena syt eva klabhinnasya grahaam na puna vivrabhinnasya . kim puna idam vivrtasya upadiyamnasya prayojanam anvkhyyate hosvit savrtasya upadiyamnasya vivrtopadea codyate . vivrtasya upadiyamnasya prayojanam anvkhyyate . katham jyate . yat ayam a* a iti akrasya vivrtasya savrtatpratypattim sti . na etat asti jpakam . asti hi anyat etasya vacane prayojanam . kim . atikhava , atimla iti atra ntaryata vivrtasya vivrta prpnoti . savrta syt iti evamarth pratypatti . na etat asti . na eva loke na ca vede akro vivrta asti . ka tarhi . savrta . ya asti sa bhaviyati . tat etat pratypattivacanam jpakam eva bhaviyati vivrtasya upadiyamnasya prayojanam anvkhyyate iti . ka puna atra viea vivrtasya upadiyamnasya prayojanam anvkhyyeta savrtasya upadiyamnasya v vivrtopadea codyeta iti . na khalu ka cid viea . hopuruikmtram tu bhavn ha savrtasya upadiyamnasya vivrtopadea codyate iti . vayam tu brma vivrtasya upadiyamnasya prayojanam anvkhyyate iti. tasya vivrtopadet anyatra api vivrtopadea savaragrahartha . tasya etasya karasammnyikasya vivrtopadet anyatra api vivrtopadea kartavya . kva anyatra . dhtuprtipadikapratyayaniptasthasya . kim prayojanam . savaragrahartha . karasammnyikena asya grahaam yath syt . kim ca kraam na syt . vivrabhedt eva . cryapravrtti jpayati bhavati karasammnyikena dhtvdisthasya grahaam iti yat ayam aka savare drgha iti pratyhre aka grahaam karoti . katham krtv jpakam . na hi dvayo karasammnyikayo yugapat samavasthnam asti . na etat asti jpakam . asti hi anyat etasya vacane prayojanam . kim. yasya karasammnyikena grahaam asti
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (12 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

tadartham etat syt . khavhakam mlhakam iti . sati prayojane na jpakam bhavati . tasmt vivrtopadea kartavya . ka ea yatna codyate vivrtopadea nma . vivrta v upadiyeta savrta v ka nu atra viea . sa ea sarva evamartha yatna yni etni prtipadikni agrahani tem etena abhyupyena upadea codyate . tat guru bhavati . tasmt vaktavyam dhtvdistha ca vivrta iti . drghaplutavacane ca savrtanivrttyartha . drghaplutavacane ca savrtanivrttyartha vivrtopadea kartavya . drghaplutau savrtau m bhtm iti . vrkbhym devadatt iti . na eva loke na ca vede drghaplutau savrtau sta . kau tarhi . vivrtau . yau sta tau bhaviyata . sthn prakalpayet etau anusvra yath yaam . savrta sthn savrtau drghaplutau prakalpayet anusvra yath yaam . tat yath saymyant savmvatsara yalm lokam talm lokam iti . ansvra sthn yaam anunsikam prakalpayati . viama upanysa . yuktam yat sata tatra praklpti bhavati . santi hi yaa snunsik niranunsik ca . drghaplutau puna na eva loke na ca veda savrtau sta . kau tarhi . vivrtau . yau sta tau bhaviyata . evam api kuta etat tulyasthnau prayatnabhinnau bhaviyata na puna tulyaprayatnau sthnabhinnau sytm kra kra v iti . vakyati sthne antaratama iti atra sthne iti vartamne puna sthnegrahaasya prayojanam . yatra anekavidham ntaryam tatra sthnata eva ntaryam balya yath syt . (s_1.2) KA_I,16.19-19.8 Ro_I,60-69 tatra anuvrttinirdee savargrahaam anatvt . tatra anuvrttinirdee savarnm grahaam na prpnoti . asya cvau yasya ti ca . kim kraam . anatvt . na hi ete aa ye anuvrttau . ke tarhi . ye akarasammnaye upadiyante . ekatvt akrasya siddham . eka ayam akra ya ca akarasammnaye ya ca anuvrttau ya ca dhtvdistha . anubandhasakara tu . anubandhasakara tu prpnoti . karmai a , ta anupasarge ka iti ke api itkrtam prpnoti . ekjanekjgrahaeu ca anupapatti . ekjanekjgrahaeu ca anupapatti bhaviyati . tatra ka doa . kiri giri iti atra ekjlakaam antodttatvam prpnoti . iha ca ghaena tarati ghaika iti dvyajlakaa han na prpnoti . dravyavat ca upacr . dravyavat ca upacr prpnuvanti . tat yath . dravyeu na ekena ghaena aneka yugapat kryam karoti . evam imam akram na aneka yugapat uccrayet . viayea tu nnligakrat siddham . yat ayam viaye viaye nnligam akram karoti karmai a ta anupasarge ka iti tena jyate nnubandhasakara asti iti . yadi hi syt nnligakaraam anarthakam syt . ekam eva ayam sarvaguam uccrayet . na etat asti japakam . itsajpraklptyartham etat syt . na hi ayam anubandhai alyakavat akya upacetum . itsajaym hi doa syt . yamya hi dvayo itsaj syt . kayo . dyantayo . evam tarhi viayea tu puna ligakarat siddham . yat ayam viaye viaye puna ligam akram karoti prk dvyata a , ivdibhya a iti tena jyate na anubandhasakara asti iti . yadi hi syt puna ligakaraam anarthakam syt . atha v puna astu viayea tu nnligakrat siddham iti eva . nanu ca uktam itsajpraklptyartham etat syt iti . na ea doa . lokata etat siddham . tat yath : loke ka cit devadattam ha : iha muo bhava , iha ja bhava , iha ikh bhava iti . yalliga yatra ucyate talliga tatra upatihate . evam akra yalliga yatra ucyate talliga tatra upasthsyate . yat api ucyate ekjanekjgrahaeu ca anupapatti iti . ekjanekjgrahaeu ca vrttisakhynt . ekjanekjgrahaeu ca vrtte sakhynt anekctvam bhaviyati . tat yath saptadaa smidhenya bhavanti iti tri prathamam anvha tri uttamam iti vrttita saptadaatvam bhavati . evam iha api vrttita anekctvam bhaviyati . bhaved vrttita kryam parihrtam .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (13 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

iha tu khalu kiri giri iti ekjlakaam antodttatvam prpnoti eva . etat api siddham . katham . lokata . tat yath loke risahasram ekm kapilm ekaikaa sahasrakrtva dattv tay sarve te sahasradakia sapann evam iha api anekctvam bhaviyati . yat api ucyate dravyavat ca upacr prpnuvanti iti . bhavet yat asambhavi kryam tat na aneka yugapat kuryt . yat tu khalu sambhavi kryam aneka api tat yugapat karoti . tat yath ghaasya daranam sparanam v . sambhavi ca idam kryam akrasya uccraam nma aneka api tat yugapat kariyati . nyabhvyam tu klaabdavyavyt . nyabhvyam tu akrasya . kuta . klaabdavyavyt . klavyavyt abdavyavyt ca . klavyvyt : daa , agram . abdavyavyt : daa . na ca ekasya tmana vyavyena bhavitavyam . bhavati cet bhavati nyabhvyam akrasya . yugapat ca deaprthaktvadarant . yugapat ca deaprthaktvadarant manymahe nyabhvyam akrasya iti . yat ayam yugapat deaprthaktveu upalabhyate . ava , arka , artha iti . na hi eka devadatta yugapat srughne ca bhavati mathurym ca . yadi puna ime var akunivat syu . tat yath akunaya ugamitvt purastt utpatit pact dryante evam ayam akra da iti atra dra a iti atra dryate . na evam akyam . anityatvam evam syt . nity ca abd . nityeu ca abdeu kasthai aviclibhi varai bhavitavyam anapyopajanavikribhi . yadi ca ayam da iti atra dra a iti atra dryeta na ayam kastha syt . yadi puna ime var dityavat syu . tat yath eka ditya anekdhikarastha yugapat deaprthaktveu upalabhyate . viama upanysa . na eka dra dityam anekdhikaraastham yugapat deaprthaktveu upalabhate . akram puna upalabhate . akram api na upalabhate . kim kraam . rotropalabdhi buddhinirgrhya prayogea abhijvalita kadea abda ekam ca kam . kade api bahava . yvat bahava tasmt nyabhvyam akrasya . krtigrahat siddham . avarkrti upadi sarvam avarakulam grahyati . tath ivarkrti . tath uvarkrti . tadvat ca taparakaraam . evam ca krtv tapar kriyante . krtigrahaena atiprasaktam iti . nanu ca savaragrahaena atiprasaktam iti krtv tapar kriyeran . pratykhyyate tat : savare agrahaam aparibhyam krtigrahat ananyatvt ca iti . halgrahaeu ca . kim . krtigrahat siddham iti eva . jhalo jhali : avttm avttam avtta yatra etat na asti : a savarn grhti iti . rpasmanyt v . rpasmnyt v siddham . tat yath : tn eva akn cchdayma ye mathurym , tn eva ln bhujmahe ye magadheu , tat eva idam bhavata krpaam yat mathurym grhtam . anyasmin ca anyasmin ca rpasmnyt tat eva idam iti bhavati . evam iha api rpasmnyt siddham . (s_2) KA_I,19.10-21.28 Ro_I,70-79 lkropadea kimartha . kim vieea lkropadea codyate na puna anyem api varnm upadea codyate . yadi kim cit anyem api varnm upadee prayojanam asti lkropadeasya api tat bhavitum arhati . ka v viea . ayam asti viea . asya hi lkrasya alpyn ca eva prayogaviaya ya ca api prayogaviaya sa api klpisthasya . klpe ca latvam asiddham . tasya asiddhatvt rkrasya eva ackryi bhaviyanti . na artha lkropadeena . ata uttaram pahati : lkropadea yadrcchaktijnukaraaplutydyartha . lkropadea kriyate yadrcchabdrtha aaktijnukarartha plutydyartha ca . yadrcchabdrtha tvat . yadrcchay ka cit ltaka nma tasmin ackryi yath syu . dadhi ltaka dehi . madhu ltaka dehi . uda ltaka agamat . pratya ltaka agamat . catuay abdnm pravrtti : jtiabd guaabd
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (14 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

kriyabd yadrcchabd caturth . aaktijnukarartha . aakty kay cit brhmay rtaka iti prayoktavye ltaka iti prayuktam . tasya anukaraam : brhma ltaka iti ha . kumr ltaka iti ha iti . plutdyartha ca lkropadea kartavya . ke puna plutdaya . plutidvirvacanasvarit : klptaikha klppta , praklpta . plutydiu kryeu klpe latvam siddham . tasya siddhatvt ackryi na sidhyanti . tasmt lkropadea kartavya . na etni santi prayojanni . nyyyabhvt kalpanam sajdiu . nyyyasya rtakaabdasya bhvt kalpanam sajdiu sdhu manyante . rtaka eva asau na ltaka iti . apara ha : nyyya rtakaabda strnvita asti . sa kalpayitavya sdhu sajdiu . rtaka eva asau na ltaka . ayam tarhi yadrcchabda aparihrya . lphia lphia . ea api rphia rphia ca . katham . artipravrtti ca eva loke lakyate phiiphiau audikau pratyayau . tray ca abdnm pravrtti . jtiabd guaabd kriyabd iti . na santi yadrcchabd . anyath krtv prayojanam uktam anyath krtv parihra . santi yadrcchabd iti krtv prayojanam uktam . na santi iti parihra . samne ca arthe strnvita astrnvitasya nivartaka bhavati . tat yath . devadattaabda devadiaabda nivartayati na gvydn . na ea doa . pakntarai api parihr bhavanti . anukaraam iipratiiddheu yath laukikavaidikeu . anukaraam hi iasya sdhu bhavati . aipratiiddhasya v na eva tat doya bhavati na abhyudayya . yath laukikavaidikeu . yath laukikeu vaidikeu ca krtnteu . loke tvat : ya evam asau dadti ya evam asau yajate ya evam asau adhte iti tasya anukurvan dadyt ca yajeta ca adhyta ca sa abhyudayena yujyate . vede api : ye evam vivasrja sattri adhysate iti tem anukurvan tadvat sattri adhysta sa api abhyudayena yujyate . aipratiiddham . ya evam asau hikkati ya evam asau hasati ya evam asau kayati iti tasya anukurvan hikket ca haset ca kayet ca na eva tat doya syt na abhyudayya . ya tu khalu evam asau brhmaam hanti evam asau surm pibati iti tasya anukurvan brhmaam hanyt surm v pibet sa api manye patita syt . viama upanysa . ya ca evam hanti ya ca anuhanti ubhau tau hata . ya ca pibati ya ca anupibati ubhau tau pibata . ya tu khalu evam asau brhmaam hanti evam asau surm pibati iti tasya anukurvan sntnulipta mlyaguakaha kadalstambham chindyt paya v pibet na sa manye patita . evam iha api ya evam asau apaabdam prayukte iti tasya anukurvan apaabdam prayujta sa api apaabdabhk syt . ayam tu anya apaabdapadrthaka abda yadartha upadea kartavya . na ca apaabdapadrthaka abda apaabda bhavati . avayam ca etat evam vijeyam . ya hi manyeta apaabdapadrthaka abda apaabda bhavati iti apaabda iti eva tasya apaabda syt . na ca ea apaabda . ayam khalu api bhya anukaraaabda aparihrya yadartha upadea kartavya . sdhu lkram adhte . madhu lkram adhte iti . kvasthasya puna etat anukaraam . klpisthasya . yadi klpisthasya klpe ca latvam asiddham tasya asiddhatvt rkre eva ackryi bhaviyanti . bhavet tadarthena na artha syt . ayam tu anya klpisthapadrthaka abda yadartha upadea kartavya . na kartavya . idam avayam vaktavyam . prakrtivat anukaraam bhavati iti . kim prayojanam . dvi pacantu iti ha . ti atia iti nighta yath syt . agn iti ha . ddet dvivacanam pragrhyam iti pragrhyasaj yath syt . yadi prakrtivat anukaraam bhavati iti ucyate apaabda eva asau bhavati kumrltaka iti ha . brahma ltaka iti ha . apaabda hi asya prakrti . na cpaabda prakrti . na hi apaabd upadiyante . na ca anupadi prakrti asti. ekadeavikrtasya ananyatvt plutydaya . ekadeavikrtam ananyavat bhavati iti plutydaya bhaviyanti . yadi
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (15 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

ekadeavikrtam ananyavat bhavati iti ucyate rja ka ca rjakyam allopa ana iti lopa prpnoti . ekadeavikrtam ananyavat ahnirdiasya iti vakymi . yadi ahnirdiasya iti ucyate klptaikha iti pluta na prpnoti . na hi atra rkra ahnirdia . ka tarhi . repha . rkra api atra ahnirdia . katham . avibhaktika nirdea . krpa u ra la krpo ro la iti . atha v puna astu avieea . nanu ca uktam . rja ka ca rjakyam allopa ana iti lopa prpnoti iti . vakyati etat . vdnm prasrae nakrntagrahaam anakrntapratiedhrtham iti . tat prakrtam uttaratra anuvartiyate . allopa ana nakrntasya iti . iha tarhi klptaikha iti anrta iti pratiedha prpnoti . ravatpratiedht ca . ravatpratiedht ca etat sidhyati . guro aravata iti vakymi . yadi aravata iti ucyate hotrrkra , hotrrkra , atra na prpnoti . guro aravata hrasvasya iti vakymi . sa ea strabhedena lkra plutydyartha san pratykhyyate . s e mahata vaastambt lav anukryate . (s_3-4.1) KA_I,22.2-23.23 Ro_I,79-84 idam vicryate . imni sandhyakari tapari v upadiyeran . et , ot , . ait , aut , c iti . atapari v yathnysam iti . ka ca atra viea . sandhyakareu taparopadea cet taparoccraam . sandhyakareu taparopadea cet taparoccraam kartavyam . plutydiu ajvidhi . plutydiu ajraya vidhi na sidhyati . gotrta nautrta iti atra anaci ca iti aca uttarasya yara dve bhavata iti dvirvacanam na prpnoti . iha ca pratya aitikayana uda aupagava iti aci iti amu na prpnoti . plutasaj ca . plutasaj ca na sidhyati . aitikayana aupagava . kala ac hrasvadrghapluta iti plutasaj na prpnoti . santu tarhi atapari . atapare eca ik hrasvdee . yadi atapari eca ik hrasvdee iti vaktavyam . kim prayojanam . eca hrasvdeasaneu ardha ekra ardha okra v m bht iti . nanu ca yasya api tapari tena api etat vaktavyam . imau aicau samhravarau mtr avarasya mtr ivarovarayo . tayo hrasvdeasaneu kad cit avara syt kad cit ivarovarau . m kad cit avaram bht iti . pratykhyyate etat : aico ca uttarabhyastvt iti . yadi pratykhynapaka idam api pratykhyyate : siddham ea sasthnatvt iti . nanu ca ea sasthnatarau ardha ekra ardha okra ca . na tau sta . yadi hi tau sytm tau eva ayam upadiet . nanu ca bho chandognm styamugriryany ardham ekram ardham okram ca adhyate : sujte evasnrte , adhvaryo odribhi sutam , ukram te enyat yajatam te enyat iti . pradakrti e tatrabhavatm . na eva hi loke na anyasmin vede ardha ekra ardha okra v asti . ekdee drghagrahaam . ekdee drghagrahaam kartavyam . t gua drgha . vrddhi eci drgha iti . kim prayojanam . ntaryata trimtracaturntrm sthninm trimtracaturmtr de m bhvan iti. khav , indra khavendra , khav , udakam khavodakam , khav , khave , khav , h khavoh , khav , elak khavailak , khav , odana khavaudana , khav , aitikyana khavaitikyana , khav , aupagava khavaupagava . tat tarhi drghagrahaam kartavyam . na kartavyam . uparit yogavibhga kariyate . aka savare eka bhavati . tata drgha . drgha ca sa bhavati ya sa eka prvaparayo iti evam nirdia iti . iha api tarhi prpnoti . paum , viddham , pacanti iti . na ea doa . iha tvat paum iti ami eka iti iyat siddham . sa ayam evam siddhe sati yat prvagrahaam karoti tasya etat prayojanam yathjtyaka prva tathjtyaka ubhayo yath syt iti . viddham iti prva iti eva anuvartate . atha v cryapravrtti jpayati na anena samprasraasya drgha bhavati iti yat ayam hala uttarasya samprasraasya
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (16 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

drghatvam sti . pacanti iti ata gue para iti iyat siddham . sa ayam evam siddhe sati yat rpagrahaam karoti tasya etat prayojanam yathjtyakam parasya rpam tathjtyakam ubhayo yath syt iti . iha tarhi khavarya mlarya iti drghavacant akra na nantaryt ekkaukrau na . tatra ka doa . vigrhtasya ravaam prasajyeta . na brma yatra kriyame doa tatra kartavyam . kim tarhi . yatra kriyame na doa tatra kartavyam iti . kva ca kriyame na doa . sajvidhau . vrddh t aic drgha . at e gua drgha iti . tat tarhi drghagrahaam kartavyam . na kartavyam . kasmt eva ntaryata trimtracaturntrm sthninam trimtracaturmtr de na bhavanti . tapare guavrddh . nanu ca bho ta para yasmt sa ayam tapara . na iti ha . tt api para tapara iti . yadi tt api para tapara rdo ap iti iha eva syt : yava stava . lava pava iti atra na syt . na ea takra . ka tarhi . dakra . kim dakre prayojanam . atha kim takre prayojanam . yadi asandehrtha takra dakra api . atha mukhasukhrtha takra dakra api . (s_3-4.2) KA_I,23.24-26.27 Ro_I,84-93 idam vicryate . ye ete vareu varaikade varntarasamnkrtaya etem avayavagrahaena grahaam syt v na v iti . kuta puna iyam vicra . iha samudy api upadiyante avayav api . abhyantara ca samudye avayava . tat yath : vrka pracalan saha avayavai pracalati . tatra samudyasthasya avayavasya avayavagrahaena grahaam syt v na v iti jyate vicra . ka ca atra viea . varaikade varagrahaena cet sandhyakre samnkaravidhipratiedha . varaikade varagrahaena iti cet sandhyakare samnkarraya vidhi prpnoti . sa pratiedhya : agne , indram . vyo , udakam . aka savare drgha iti drghatvam prpnoti . drghe hrasvavidhipratiedha . drghe hrasvkarraya vidhi prpnoti . sa pratiedhya . grma , lya , pralya . hrasvasya piti krti tuk bhavati iti tuk prpnoti . na ea doa . cryapravrtti jpayati na drghe hrasvraya vidhi bhavati iti yat ayam drght che tukam sti . na etat asti jpakam . asti hi anyat etasya vacane prayojanam . kim . padntt v iti vibhm vakymi iti . yat tarhi yogavibhgam karoti . itarath hi drght padntt v iti eva bryt . iha tarhi khavbhi , mlbhi , ata bihsa ais , iti aisbhva prpnoti . taparakaraasmarthyt na bhaviyati . iha tarhi yt vt , ata lopa rdhadhtuke iti akralopa prpnoti . nanu ca atra api taparakaraasmarthyt eva na bhaviyati . asti hi anyat taparakarae prayojanam . kim . sarvasya lopa m bht iti . atha kriyame api tapare parasya lope krte prvasya kasmt na bhavati . paralopasya sthnivadbhvt asiddhatvt ca . evam tarhi cryapravrtti jpayati nkrasthasya akrasya lopa bhavati iti yat ayam ta anupasarge ka iti kakram anubandham karoti . katham krtv jpakam . kitkarae etat prayojanam kiti iti krlopa yath syt iti . yadi ca krasthasya api akrlopa syt kitkaraam anarthakam syt . parasya akrasya lope krte dvayo akrayo pararpe hi siddham rpam syt: goda , kambalada iti . payati tu crya nkrasthasya akrasya lopa bhavati iti . ata kakram anubandham karoti . na etat asti jpakam . uttarrtham etat syt . tundaokayo parimrjpanudo iti . yat tarhi gpo hak iti ananyrtham kakram anubandham karoti . ekavaravat ca . ekavaravat ca drgha bhavati iti vaktavyam . kim prayojanam . vc tarati iti dvyajlakaa han m bht iti . iha ca vca nimittam , tasya nimittam sayogotpttau iti dvyajlakaa yat m bht iti . atra api gonaugrahaam jpakam drght dvyajlakaa vidhi na bhavati iti . ayam tu
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (17 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

sarvem parihra : na avyapavrktasya avayave tadvidhi yath dravyeu . na avyapavrktasya avayavsya avayavraya vidhi bhavati yath dravyeu . tat yath dravyeu : saptadaa smidhenya bhavanti iti na saptadaratnimtram kham agnau abhydhyate . viama upanysa . pratyrcam ca eva hi tat karma codyate asambhava ca agnau vedym ca . yath tarhi saptadaa prdeamtr avatth samidha abhydadhta iti na saptadaaprdeamtram kham abhydhyate . atra api pratipravaam ca etat karma codyate tulya ca asambhava agnau vedym ca . yath tarhi tailam na vikretavyam , msam na vikretavyam iti . vyapavrtkam ca na vikryate , avyapavrktam ca gva ca sarap ca vikriyante . tath lomanakham sprv aucam kartavyam iti , vyapavrktam sprv niyogata kartavyam avyapavrkte kmacra . yatra tarhi vyapavarga asti . kva ca vyapavarga asti . sandhyakareu . sandhyakareu vivrtatvt . yat atra avaram vivrtataram tat anyasmt avart . ye*api ivarovare vivrtatare te*anybhym ivarovarbhym . athav puna na grhyante . agrahaam cet nuvidhildeavinmeu rkragrahaam . agrahaam cet nuvidhildeavinmeu rkrasya grahaam kartavyam . tasmt nu dvihala , rkre ca iti vaktavyam iha api yath syt : nrdhatu , nrdhu iti . yasya puna grhyante dvihala iti eva tasya siddham . yasya api na grhyante tasya api ea na doa . dvihalgrahaam na kariyate . tasmt nu bhavati iti eva . yadi na kriyate atu , u iti atra api prpnoti . anotigrahaam niyamrtham bhaviyati . anote eva avaropadhasya na anyasya avaropadhasya iti . ldee ca rkragrahaam kartavyam . krpa ra la , rkrasya ca iti vaktavyam iha api yath syt : klpta , klptavn iti . yasya puna grhyante ra iti eva tasya siddham . yasya api na grhyante tasya api ea na doa . rkra api atra nirdiyate . katham . avibhaktika nirdea . krpa , u , ra , la krpo ro la iti . atha v ubhayata sphoamtram nirdiyate . rarute laruti bhavati iti . vinme rkragrahaam kartavyam . rabhym na a samnapade , rkrt ca iti vaktayvam iha api yath syt : mtrm , pitrm iti . yasya puna grhyante rabhym iti eva tasya siddham . na sidhyati . yat tat repht param bhakte tena vyavahitatvt na prpnoti . m bht evam . avyavye iti eva siddham . na sidhyati . varaikade ke varagrahaena grhyante . ye vyapavrkt api var bhavanti . yat ca api repht param bhakte na tat kva cit api vyapavrktam dryate . evam tarhi yogavibhga kariyate . rabhym na a samnapade . tata vyavye . vyavye ca rabhym na a bhavati iti . tata akupvnumbhi iti . idam idnm kimartham . niyamrtham . etai eva karasamamnyikai vyavye na anyai iti . yasya api na grhyante tasya api ea na doa . cryapravrtti jpayati bhavati rkrt na atvam iti yat ayam kubhdiu nrnamanaabdam pahati . na etat asti jpakam . vrddhyartham etat syt : nrnamani . yat tarhi trpnotiabdam pahati . yat ca api nrnamanaabdam pahati . nanu ca uktam vrddhyartham etat syt iti . bahirag vrddhi . antaragam atvam . asiddham bahiragam antarage . atha v uparit yogavibhga kariyate . rto na a bhavati . tata chandasi avagraht . rta iti eva . plutau aica idutau . etat ca vaktavyam . yasya puna grhyante guro e iti eva pluty tasya siddham . yasya api na grhyante tasya api ea na doa . kriyate etat nyse eva . tulyarpe sayoge dvivyajanavidhi . tulyarpe sayoge dvivyajanraya vidhi na sidhyati : kukkua , pippala , pittam iti . yasya puna grhyante tasya dvau kakrau dvau pakrau dvau takrau . yasya api na grhyante tasya api dvau kakrau dvau pakrau dvau takrau . katham . mtrkla atra gamyate . na ca mtrikam vyajanam asti . anupadiam sat katham akyam vijtum . yadi api tvat atra etat akyate
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (18 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

vaktum yatra etat na asti a savarn grhti iti iha tu katham saymyant savmvatsara yalm lokam talm lokam iti yatra etat asti a savarn grhti iti . atra api mtrkala grhyate na ca mtrikam vyajanam asti . anupadiam sat katham akyam pratipattum . (s_5.1) KA_I,27.2-20 Ro_I,93-94 sarve var sakrt upadi . ayam hakra dvi upadiyate prva ca para ca . yadi puna prva eva upadiyeta para eva v . ka ca atra viea . hakrasya paropadee agrahaeu hagrahaam . hakrasya paropadee agrahaeu hagrahaam kartavyam . ta ai nityam , a cha ai , drght ai samnapade . hakre ca iti vaktavyam iha api yath syt : mahm hi sa . uttve ca . uttve ca hakragrahaam kartavyam . ata ro aplutt aplute , hai ca . hakre ca iti vaktavyam iha api yath syt : purua hasati , brhmaa hasati iti . astu tarhi prvopadea . prvopadee kittvaksevidhaya jhalgrahani ca . yadi prvopadea kittvam vidheyam . snihitv snehitv sisnihiati sisnehiati . rala vyupadht halde iti kittvam na prpnoti . ksavidhi . ksa ca vidheya . adhukat alikat . ala igupadht ania ksa iti ksa na prpnoti . ividhi . i ca vidheya . rudihi svapihi . valdilakaa i na prpnoti. jhalgrahani ca . kim . ahakri syu . tatra ka doa . jhala jhali iti iha na syt : adgdhm adgdham . tasmt prva ca upadeavya para ca . yadi ca kim cit anyatra api upadee prayojanam asti tatra api upadea kartavya . (s_5.2) KA_I,27.21-28.15 Ro_I,95-97 idam vicryate : ayam repha yakravakrbhym prva eva upadiyeta ha ra ya va iti para eva v yathnysam iti . ka ca atra viea . rephasya paropadee anunsikadvirvacanaparasavarapratiedha . rephasya paropadee anunsikadvirvacanaparasavarnm pratiedha vaktavya . anunsikasya : sva nayati , prta nayati iti yara anunsike anunsika v iti anunsika prpnoti . dvirvacanasya : bhadrahrada , madrahrada iti yara iti dvirvacanam prpnoti . parasavarasya : kuam rathena , vanam rathena . anusvrasya yayi iti parasavara prpnoti . astu tarhi prvopadea . prvopadee kittvapratiedha vyalopavacanam ca . yadi prvopadea kittvam pratiedhyam . devitv dideviati . rala vyupadht iti kittvam prpnoti . na ea doa . na evam vijyate rala vyupadht iti . kim tarhi . rala avvyupadht iti . kim idam avvyupadht iti . avakrntt vyuvpadht avvyupadht iti . vyalopavacanam ca . vyo ca lopa vaktavya : gaudhera , paceran yajeran . jve radnuk : jradnu . vali iti lopa na prpnoti . na ea doa . repha api atra nirdiyate . lopa vyo vali iti rephe ca vali ca iti . atha v puna astu paropadea . nanu ca uktam rephasya paropadee anunsikadvirvacanaparasavarapratiedha iti . anunsikaparasavarayo tvat pratiedha na vaktavya . rephomam savar na santi . dvirvacane api na imau rahau kryiau dvirvacanasya . kim tarhi . nimittam imau rahau dvirvacanasya . tat yath . brhma bhojyantm . mharakauinyau parivevim iti. na idnm tau bhujte . (s_5.3) KA_I,28.16-29.28 Ro_I,97-101 idam vicryate . ime ayogavh na kva cit upadiyante ryante ca . tem kryrtha upadea kartavya . ke puna ayogavh . visarjanyajihvmlyopadhmnynusvrnunsikyayam . katham puna ayogavh . yat ayukt vahanti anupadi ca ryante . kva puna em upadea kartavya . ayogavhnm asu atvam . ayogavhnm asu upadea kartavya . kim prayojanam . atvam . urakea , urapea : avyavye iti atvam siddham bhavati . aru jabhvaatve .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (19 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

aru upadea kartavya . kim prayojanam . jabhvaatve . ayam ubji upadhmnyopadha pahyate . tasya jatve krte ubjit ubjitum iti etat rpam yath syt . yadi ubji upadhmnyopadha pahyate ubjijiati iti upadhmnyde eva dvirvacanam prpnoti. dakropadhe puna nandr sayogdaya iti pratiedhas siddha bhavati . yadi dakropadha pahyate k rpasiddhi : ubjit ubjitum iti . asiddhe bha udje . idam asti sto cun cu iti . tata vakymi bha udje . udje cun sannipte bha bhavati iti . tat tarhi vaktavyam . na vaktavyam . niptant eva siddham . kim niptanam . bhujanyubjau payupatapayo iti . iha api tarhi prpnoti abhyudga , samudga iti . akutvaviaye tat niptanam . atha v na etat ubje rpam . game dvyuparsargt a vidhyate . abhyudgata abhyudga . samudgata samudga iti . atvam ca prayojanam . sarpiu dhanuu . arvyavye iti atvam siddham bhavati . numvisarjanyaarvyavye api iti visarjanyagrahaam na kartavyam bhavati . numa ca api tarhi grahaam akyam akartum . katham sarpi dhani . anusvre krte arvyavye iti eva siddham . avayam numa grahaam kartavyam anusvravieaam numgrahaam numa ya anusvra tatra yath syt iha m bht : pusu iti . atha v avieea upadea kartavya . kim prayojanam . avieea sayogopadhsajlontyadvirvacanasthnivadbhvapratiedh . avieea sayogasaj prayojanam . bjaka . hala anantar sayoga iti sayogasaj sayoge guru iti gurusaj guro iti pluta bhavati . upadhsaj ca prayojanam . dukrtam , nikrtam , niptam , duptam . idudupadhasya ca apratyayasya iti atvam siddham bhavati . na etat asti prayojanam . na idudupadhagrahaanena visarjanya vieyate . kim tarhi . sakra vieyate . idudupadhasya sakrasya ya visarjanya iti . atha v upadhgrahaam na kariyate . idudbhym tu visarjanyam vieayiyma . idudbhym uttarasya visarjanyasya iti . ala antyavidhi prayojanam . vrka tarati . plaka tarati . ala antyasya vidhaya bhavanti iti ala antyasya satvam siddham bhavati . etat api na asti prayojanam . nirdiyamnasya de bhavanti iti visarjanyasya eva bhaviyati . dvirvacanam prayojanam . uraka , urapa . anaci ca . aca uttarasya yara dve bhavata iti dvirvacanam siddham bhavati . sthnivadbhvapratiedha ca prayojanam . yath iha bhavati urakea , urapea iti avyavye api iti atvam evam iha api sthnivadbhvt prpnoti vyhoraskena mahoraskena iti . tatra analvidhau iti pratiedha siddha bhavati . (s_5.4) KA_I,30.1-32.11 Ro_I,101-106 kim puna ime var arthavanta hosvit anarthak . arthavanta var dhtuprtipadikapratyayaniptnm ekavarnm arthadarant . dhtava ekavar arthavanta dryante : eti , adhyeti , adhte iti . prtipadikani ekavarni arthavanti : bhym , ebhi , eu . pratyay ekavar arthavanta : aupagava , kpaava . nipt ekavar arthavanta : a*apehi . i*indram paya . u*uttiha . dhtuprtipadikapratyayaniptnm ekavarnm arthadarant manymahe arthavanta var iti . varavyatyaye ca arthntaragamant . varavyatyaye ca arthntaragamant manymahe arthavanta var iti . kpa , spa , ypa iti . kpa iti sakakrea ka cit artha gamyate . spa iti kakrpye sakropajane ca arthntaram gamyate . ypa iti kakrasakrpye yakropajane ca arthntatam gamyate . te manymahe : ya kpe kprtha sa kakrasya . ya spe sprtha sa sakrasya . ya ype yprtha sa yakrasya iti . varnupalabdhau ca anarthagate . varnupalabdhau ca anarthagate manymahe arthavanta var iti . vrka , rka , kra , ra . vrka
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (20 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

iti sakakrea ka cit artha gamyate . rka iti vakrpye sa artha na gamyate . kra iti sakakrea ka cit artha gamyate . ra iti kakrpye sa artha na gamyate . kim tarhi ucyate anarthagate iti . na sdhya hi atra arthasya gati bhavati . evam tarhi idam pahitavyam syt . varnupalabdhau ca atadarthagate . kim idam atadarthagate iti . tasya artha tadartha . tadarthasya gati tadarthagati . na tadarthagati atadarthagati . atadarthagate iti . atha v sa artha tadartha . tadarthasya gati tadarthagati . na tadarthagati atadarthagati . atadarthagate iti . sa tarhi tath nirdea kartavya . na kartavya . uttarapadalopa atra draavya . tat yath: uramukham iva mukham asya uramukha , kharamukham iva mukham asya kharamukha . evam atadarthagate anarthagate . saghtrthavattvt ca . saghtrthavattvt ca manymahe arthavanta var iti . yem saght arthavanta avayav api tem arthavanta . yem puna avayav anarthak samudy api tem anarthak . tat yath: eka cakumn darane samartha tatsamudya ca atam api samartham . eka ca tila tailadne samartha tatsamudya ca khr api samarth . yem puna avayav anarthak samudy api tem anarthak . tat yath: eka andha darane asamartha tatsamudya ca atam api asamartham . ek ca sikat tailadne asamarth tatsamudya ca khratam api asamartham . yadi tarhi ime var arthavanta arthavatkrtni prpnuvanti . kni . arthavat prtipadikam iti prtipadikasaj prtipadikt iti svdyutpatti subantam padam iti padasaj . tatra ka doa . padasya iti nalopdni prpnuvanti . dhanam , vanam iti . saghtasya aikrthyt subabhva vart . saghtasya ekatvam artha . tena vart subutpatti na bhaviyati . anarthak tu prativaram arthnupalabdhe . anarthak tu var . kuta . prativaram arthnupalabdhe . na hi prativaram arth upalabhyante . kim idam prativaram iti . varam varam prati prativaram . varavyatyaypyopajanavikreu arthadarant . varavyatyaypyopajanavikreu arthadarant manymahe anarthak var iti . varavyatyaye: krte tarku , kase sikat , hise siha . varavyatyaya na arthavyatyaya . apya lopa . ghnanti , ghantu , aghnan . varpya nrthpya . upajana gama . lavit , lavitum . varopajana na arthopajana . vikra dea . ghtayati , ghtaka . varavikra na arthavikra . yath eva varavyatyaypyopajanavikr bhavanti tadvat arthavyatyaypyopajanavikrai bhavitavyam . na ca iha tadvat . ata manymahe anarthak var iti . ubhayam idam vareu uktam arthavanta anarthak iti ca . kim atra nyyyam . ubhayam iti ha . kuta . svabhvata . tat yath: samnam hamnnm adhynnm ca ke cit arthai yujyante apare na . na ca idnm ka cit arthavn iti krtv sarvai arthavadbhi akyam bhavitum , ka cit anarthaka iti krtv sarvai anarthakai . tatra kim asmbhi akyam kartum . yat dhtupratyayaprtipadikanipt ekavar arthavanta ata anye anarthak iti svbhvikam etat . katham ya ea bhavat varnm arthavattym hetu upadia arthavanta var dhtuprtipadikapratyayaniptnm ekavarnm arthadarant varavyatyaye ca arthntaragamant varnupalabdhau ca anarthagate saghtrthavattvt ca iti . saghtntari eva etni evajtyakni arthntareu vartante: kpa , spa , ypa iti . yadi hi varavyatyayakrtam arthntaragamanam syt bhyiha kprtha spe syt sprtha ca kpe kprtha ca ype yprtha ca kpe sprtha ca ype yprtha ca spe . yata tu khalu na ka cit kpasya v spe spasya v kpe kpasya v ype ypasya v kpe spasya v ype ypasya v spe ata manymahe saghtntari eva etni
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (21 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

evajtyakni arthntareu vartante iti . idam khalu api bhavat varnm arthavattm bruvat sdhya anarthakatvam dyotitam . ya manyate ya kpe kprtha sa kakrasya spe sprtha sa sakrasya ype yprtha sa yakrasya iti paabda tasya anarthaka syt . tatra idam aparihrtam saghtrthavattvt ca . etasya api prtipadikasjym vakyati . (s_5.5) KA_I,32.12-33.4 Ro_I,107-108 a , i , u r , lk e , o ai , auc . pratyhre anubandhnm katham ajgrahaeu na . ye ete aku pratyhrrth anubandh kriyante etem ajgrahaeu grahaam kasmt na bhavati . kim ca syt . dadhi akryati madhu akryati iti . ika ya aci iti yadea prasajyeta . crt . kim idam crt iti . crym upacrt . na eteu cry ackryi krtavanta . apradhnatvt . apradhnatvt ca . na khalu api etem aku prdhnyena upadea kriyate . kva tarhi . halu . kuta etat . e hi cryasya ail lakyate yat tulyajtyn tulyajtyeu upadiati . aca aku hala halu . lopa ca balavattara . lopa khalu api tvat bhavati . kla ac iti v yoga tatklnm yath bhavet acm grahaam ackryam tena etem na bhaviyati . atha v yogavibhga kariyate . kla ac . u u3 iti evakla ac bhavati . tata hrasvadrghapluta . hrasvadrghaplutasaja ca bhavati kla ac . evam api kukkua iti atra api prpnoti . tasmt prvokta eva parihra . ea eva artha. apara ha : hrasvdnm vacant prk yvat tvat eva yoga astu ackryi yath syu tatkleu aku kryi . (s_5.6) KA_I,33.5-34.2 Ro_I,108-110 atha kimartham antasthnm asu upadea kriyate . iha saymymyant savmvmvatsara yalm lmlokam talm lmlokam iti parasavarasya asiddhatvt anusvrasya eva dvirvacanam . tatra parasya parasavare krte tasya yaygrahaena grahat prvasya api parasavara yath syt . na etat asti prayojanam . vakyati etat . dvirvacane parasavaratvam siddham vaktavyam iti . yvat siddhatvam ucyate parasavara eva tvad bhavati . parasavare tarhi krte tasya yargrahaea grahat dvirvacanam yath syt . m bht dvirvacanam . nanu ca bheda bhavati. sati dvirvacane triyakram asati dvirvacane dviyakram . na asti bheda . sati api dvirvacane dviyakram eva . katham . hala yamm yami lopa iti evam ekasya lopena bhavitavyam . evam api bheda . sati dvirvacane kad cit dviyakram kad cit triyakram . sa ea katham bheda na syt . yadi nitya lopa syt . vibh ca sa lopa . yath abheda tath astu . anuvartate vibh ara aci yat vrayati ayam dvitvam . yat ayam ara aci iti dvirvacanapratiedham sti tat jpayati crya anuvartate vibh iti . katham krtv jpakam . nitye hi tasya lope pratiedhrtha na ka cit syt . yadi nitya lopa syt pratiedhavacanam anarthakam syt . astu atra dvirvacanam . jhara jhari savare iti lopa bhaviyati . payati tu crya vibh sa lopa iti . tata dvirvacanapratiedham sti . na etat asti jpakam . nitye api tasya lope sa pratiedha avayam vaktavya . yat etat aca rahbhym iti dvirvacanam loppavda sa vijyate . katham . yara iti ucyate . etvanta ca yara yat uta jhara v yama v . yadi ca atra nitya lopa syt dvirvacanam anarthakam syt . kim tarhi tayo yogayo udharaam . yat akrte dvirvacane trivyajana sayoga . pratttam , avatttam , dityya . iha idnm kartt , hartt iti dvirvacanasmarthyt lopa na bhavati . evam iha api lopa na syt:: karati varati iti . tasmt nitye api lope avayam sa pratiedha vaktavya . tat etat atyantam sandigdham vartate crym vibh anuvartate na v iti . (s_6) KA_I,34.4-35.18 Ro_I,111-115 ayam akra dvi anubadhyate prva ca para ca .

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (22 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

tatra agrahaeu igrahaeu ca sandeha bhavati prvea v syu parea v iti . katarasmin tvat agrahae sandeha . hralope prvasya drgha aa iti . asandigdham prvea na parea . kuta etat . parbhvt . na hi hralope pare aa santi . nanu ca ayam asti : trham vrham iti . evam tarhi smarthyt prvea na parea . yadi hi parea syt agrahaam anarthakam syt . hralope prvasya drgha aca iti eva bryt . atha v etat api na bryt . aca hi etat bhavati hrasva drgha pluta iti . asmin tarhi agrahae sandeha ke aa iti . asandigdham prvea na parea . kuta etat . parbhvt . na hi ke pare aa santi . nanu ca ayam asti . gok nauk iti . evam tarhi smarthyt prvea na parea . yadi hi parea syt agrahaam anarthakam syt . ke aca iti eva bryt . atha v etat api na bryt . aca hi etat bhavati hrasva drgha pluta iti . asmin tarhi agrahae sandeha aa apragrhyasya anunsika iti . asandigdham prvea na parea . kuta etat . parbhvt . na hi padnt pare aa santi . nanu ca ayam asti kartr hartr iti . evam tarhi smarthyt prvea na parea . yadi hi parea syt agrahaam anarthakam syt .aca apragrhyasya anunsika iti eva bryt . atha v etat api na bryt . aca eva hi pragrhy bhavanti . asmin tarhi agrahae sandeha u a rapara iti . asandigdham prvea na parea . kuta etat . parbhvt . na hi u sthne pare aa santi . nanu ca ayam asti kartrartham hartrartham iti . kim ca syt . yadi atra raparatvam syt dvayo rephayo ravaam prasajyeta . hala yamm yami lopa iti evam ekasya atra lopa bhavati. vibh sa lopa . vibh ravaam prasajyeta . ayam tarhi nitya lopa ra ri iti . padntasya iti evam sa . na akya padntasya vijtum . iha hi lopa na syt jargrdhe la ajargh pspardhe apsp iti . iha tarhi mtrm pitrm iti raparatvam prasajyeta . cryapravrtti jpayati na atra raparatvam bhavati iti yat ayam rta it dhto iti dhtugrahaam karoti . katham krtv jpakam . dhtugrahaasya etat prayojanam . iha m bht : mtrm , pitrm iti . yadi ca atra raparatvam syt dhtugrahaam anarthakam syt . raparatve krte anantyatvt ittvam na bhaviyati . payati tu crya na atra raparatvam bhavati iti tata dhtugrahaam karoti . iha api tarhi ittvam na prpnoti cikrati jihrati iti . m bht evam . upadhy ca iti evam bhaviyati . iha api tarhi prpnoti mtrm , pitrm iti . tasmt tatra dhtugrahaam kartavyam . evam tarhi agrahaasmarthyt prvea na parea . yadi parea syt agrahaam anarthakam syt . u ac rapara iti eva bryt . asmin tarhi agrahae sandeha : auditsavarasya ca apratyaya iti . asandigdham parea na prvea iti. kuta etat . savare a taparam hi u rt . yat ayam u rt iti rkram taparam karoti tat jpayati crya parea na prvea . igrahaeu tarhi sandeha . asandigdham parea na prvea iti. kuta etat . yvo anyatra parea i syt . yatra icchati prvea sammrdya grahaam tatra karoti yvo iti . tat ca guru bhavati . katham krtv jpakam . tatra vibhaktinirdee sammrdya grahae ardhacatasra mtr . pratyhragrahae puna tisra mtr . sa ayam evam laghyas nysena siddhe sati yat garysam yatnam rabhate tat jpayati crya parea na prvea iti . kim puna varotsattau iva akra dvi anubadhyate . etat jpayati crya bhavati e paribh vykhynata vieapratipatti na hi sandeht alakaam iti. auditsavaram parihya prvea agrahaam parea igrahaam iti vykhysyma . (s_7-8.1) KA_I,35.20-36.4 Ro_I,115-116 kimartham imau mukhansikvacanau varau ubhau api anubadhyete na akra eva anubadhyeta . katham yni makrea grahani hala yamm yami lopa iti . santu akrea hala yam yai lopa iti . na evam akyam.
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (23 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

jhakrabhakraparayo api hi jhakrabhakryo lopa prasajyeta . na jhakrabhakrau jhakrabhakrayo sta . katham puma khayyi ampare iti . etat api astu akrea puma khayyi apare iti . na evam akyam . jhakrabhakrapare hi khayyi ru prasajyeta . na jhakrabhakrapara khay asti .katham ama hrasvt aci amu nityam iti . etat api astu akrea aa hrasvt aci au nityam iti . na evam akyam . jhakrabhakraparayo api hi padntayo jhakrabhakrau gamau sytm . na jhakrabhakrau padntau sta . evam api paca gam traya gaminau vaiamyt sakhytnudea na prpnoti . santu tvat yem gamnm gamina santi . jhakrabhakrau padntau na sta iti krtv gamau api na bhaviyata . (s_7-8.2) KA_I,36.5-11 Ro_I,117 atha kim idam akaram iti . akaram na karam vidyt . na kyate na karati iti v akaram . anote v sara akaram . anote v puna ayam audika saranpratyaya . varam v hu prvastre . atha v prvastre varasya akaram iti saj kriyate . (s_7-8.3) KA_I,36.12-18 Ro_I,118-120 kimartham idam upadiyate . atha kimartham idam upadiyate . varajnam vgviaya yatra brahma vartate . tadartham iadbuddhyartham laghvartham ca upadiyate . sa ayam akarasammnya vksammnya pupita phalita candratrakavat pratimaita veditavya brahmari . sarvavedapuyaphalvpti ca asya jne bhavati . mtpitarau ca asya svarge loke mahyete . (P_1,1.1.1) KA_I,37.2-7 Ro_I,121-123 kutvam kasmt na bhavati co ku padasya iti . bhatvt . katham bhasaj . ayasmaydni chandasi iti . chandasi iti ucyate . na ca idam chanda . chandovat stri bhavanti . yadi bhasaj vrddhi d aic at e gua iti jatvam api na prpnoti . ubhayasajni api chandsi dryante . tat yath . sa suubh sa rkvat gaena . padatvt kutvam bhatvt javtam na bhavati . evam iha api bhatvt kutvam na bhaviyati (P_1,1.1.2) KA_I,37.8-24 Ro_I,123-124 kim puna idam tadbhvitagrahaam : vrddhi iti evam ye kraikraukr bhvyante tem grahaam hosvit daijmtrasya . kim ca ata . yadi tadbhvitagrahaam lya mlya iti vrddhalakaa cha na prpnoti . mramayam lamayam vrddhalakaa maya na prpnoti . mraguptyani laguptayani vrddhalakaa phi na prpnoti . atha aijmtrasya grahaam sarva bhsa sarvabhsa iti uttarapadapadavrddhau sarvam ca iti ea vidhi prpnoti . iha ca tvat bhry asya tvadbhrya yvadbhrya vrddhinimittasya iti puvadbhvapratiedha prpnoti . astu tarhi aijmtrasya . nanu ca uktam sarva bhsa sarvabhsa iti uttarapadapadavrddhau sarvam ca iti ea vidhi prpnoti . na ea doa . na evam vijyate uttarapadasya vrddhi uttarapadavrddhi uttarapadavrddhau iti . katham tarhi . uttarapadasya iti evam prakrtya y vrddhi tadvati uttarapade iti evam etat vijyate . avayam ca etat evam vijeyam . tadbhvitagrahae sati api iha prasajyeta : sarva kraka sarvakraka iti . yad api ucyate iha tvat bhry asya tvadbhrya yvadbhrya vrddhinimittasya iti puvadbhvapratiedha prpnoti iti na ea doa . na evam vijyate vrddhe nimittam vrddhinimittam vrddhinimittasya iti . katham tarhi . vrddhe nimittam yasmin sa ayam vrddhinimitta vrddhinimittasya iti . kim ca vrddhe nimittam. ya asau kakra akra
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (24 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

akra v . atha v ya krtsny vrddhe nimittam . ka ca krtsny vrddhe nimittam . ya traym kraikraukrm . (P_1,1.1.3) KA_I,37.25-40.17 Ro_I,125-133 sajdhikra sajsampratyayrtha . atha saj iti prakrtya vrddhydaya abd pahitavy . kim prayojanam . sajsampratyayrtha . vrddhydnm abdnm saj iti ea sampratyaya yath syt . itarath hi asampratyaya yath loke . akriyame hi sajdhikre vrddhydnm saj iti ea sampratyaya na syt . idam idnm bahustram anarthakam syt . anarthakam iti ha . katham . yath loke . loke hi arthavanti ca anarthakni ca vkyni dryante . arthavanti tvat : devadatta gm abhyja uklm daena . devadatta gm abhyja krm iti . anarthakni ca . daa dimni a app kuam ajjinam palalapia adhorukam etat kumry sphaiyakrtasya pit pratina iti . sajsajyasandeha ca . kriyame api sajdhikre sajsajino asandeha vaktavya . kuta hi etat vrddhiabda saj daica sajina iti . na puna daica saj vrddhiabda saj iti . yat tvat ucyate sajdhikra kartavya sajsampratyayrtha iti na kartavya . crycrt sajsiddhi . crycrt sajsiddhi bhaviyati . kim idam crycrt . crym upacrt . yath laukikavaidikeu . tat yath laukikeu vaidikeu ca krtnteu . loke tvat : mtpitarau putrasya jtasya savrte avake nma kurvte devadatta yajadatta iti . tayo upacrt anye api jnanti iyam asya saj iti . vede : yjik sajm kurvanti sphya ypa cala iti . tatrabhavatm upacrt anye api jnanti iyam asya saj iti . apare puna sici vrddhi iti uktv kraikraukrn udharanti . te manymahe : yay pratyyyante s saj ye pratyante te sajina iti . yat api ucyate kriyame api sajdhikre sajsajino asandeha vaktavya iti . sajsajyasandeha . sajsajino asandeha siddha . kuta . crycrt eva . ukta crycra . ankrti . atha v ankrti saj . krtimanta sajina . loke api hi krtimata msapiasya devadatta iti saj kriyate . ligena v . atha v kim cit ligam sajya vakymi itthalig saj iti . vrddhiabde ca tat ligam kariyate na daicchabde . idam tvat ayuktam yat ucyate crycrt iti . kim atra ayuktam . tam eva uplabhya agamakam te stram iti tasya eva puna pramkaraam iti etat ayuktam . aparituyan khalu api bhavn anena parihrea krti ligena v iti ha . tat ca api vaktavyam . yadi api etat ucyate atha v etarhi itsaj na vaktavy lopa ca na vaktavya . sajligam anubandheu kariyate . na ca sajy nivrtti ucyate . svabhvata saj sajina pratyyya nivartante . tena anubandhnm api nivrtti bhaviyati . sidhyati evam . apinyam tu bhavati . yathnysam eva astu . nanu ca uktam sajdhikra sajsampratyayrtha itarath hi asampratyaya yath loke iti . na yath loke tath vykarae . pramabhta crya darbhapavitrapi ucau avake prmukha upaviya mahat yatnena stram praayati sma . tatra aakyam varena api anarthakena bhavitum kim puna iyat strea . kim ata yat aakyam . ata sajsajinau eva . kuta nu khalu etat sajsajinau eva iti na puna sdhvanusane asmin stre sdhutvam anena kiryate . krtam anayo sdhutvam . katham . vrdhi asmai avieea upadia prakrtiphe . tasmt ktinpratyaya . daica api akarasammnye upadi . prayoganiyamrtham tarhi idam syt . vrddhiabdt para daica prayoktavy iti . na iha prayoganiyama rabhyate . kim tarhi . saskrtya saskrtya padni utsrjyante . tem yatheham abhisambandha bhavati . tat yath : hara ptram , ptram hara iti . de
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (25 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

tarhi ime syu . vrddhiabdasya daica . ahnirdiasya de ucyante na ca atra ahm payma . gam tarhi ime syu . vrddhiabdasya daica gam . gam api ahnirdiasya eva ucyante ligena ca . na ca atra ahm na khalu api gamaligam payma . idam khalu api bhya smandhikarayam ekavibhaktikatvam ca . dvayo ca etat bhavati . kayo . vieaavieyayo v sajsajino v . tatra etat syt vieaavieye iti . tat ca na . dvayo hi prattpadrthakayo loke vieaavieyabhva bhavati . na ca daicchabda prattapadrthaka . tasmt sajsajinau eva . tatra tu etvn sandedha ka saj k saj iti . sa ca api kva sandeha . yatra ubhe samnkare . yatra tu anyatarat laghu yat laghu s saj . kuta etat . laghvartham hi sajkaraam . tatra api ayam na avayam gurulaghutm eva upalakayitum arhati . kim tarhi . ankrtitm api . ankrti saj . krtimanta sajina . loke hi krtimata msapiasya devadatta iti saj kriyate . atha v vartinya saj bhavanti . vrddhiabda ca vartate na daicchabda . tat yath . itaratra api devadattaabda vartate na msapia . atha v prvoccrita saj paroccrit saj . kuta etat . sata hi kryia kryea bhavitavyam . tat yath . itaratra api sata msapiasya devadatta iti saj kriyate . katham vrddhi t aic iti . etat ekam cryasya magalrtham mryatm . mgalika crya mahata straughasya magalrtham vrddhiabam dita prayukte . magaldni hi stri prathante vrapuruaki ca bhavanti yumatpuruaki ca . adhyetra ca siddhrth yath syu iti . sarvatra eva hi vykarae prvoccrita saj paroccrit saj . at e gua iti yath . doavn khalu api sajdhikra . aame api hi saj kriyate tasya param mreitam iti . tatra api idam anuvartyam syt . atha v asthne ayam yatna kriyate . na hi idam lokt bhidyate . yadi idam lokt bhidyeta tata yatnrham syt . tat yath agojya ka cit gm sakthani kare v grhtv upadiati ayam gau iti . na ca asmai cae iyam asya saj iti . bhavati ca asya sampratyaya . tatra etat syt krta prvai abhisambandha iti . iha api krta prvai abhisambandha . kai . cryai . tatra etat syt . yasmai samprati upadiati tasya akrta iti . loke api yasmai samprati upadiati tasya akrta . atha tatra krta iha api krta draavya . (P_1,1.1.4) KA_I,40.18-41.4 Ro_I,133-134 sata vrddhydiu sajbhvt tadraye itaretarrayatvt asiddhi . sata sajina sajbhvt sajraye sajini vrddhydiu itaretarrayatvt aprasiddhi . k iteretarrayat . satm daicm sajay bhavitavyam sajay ca daica bhvyante . tat itaretarrayam bhavati , itaretarrayi ca kryi na prakalpante . tat yath . nau nvi baddh na itaratrya bhavati. nanu ca bho itaretarrayi api kryi dryante . tat yath . nau akaam vahati akaam ca nvam vahati . anyat api tatra kim cit bhavati jalam sthalam v . sthale akaam nvam vahati . jale nau akaam vahati . yath tari triviabdhakam . tatra api antata strakam bhavati . idam puna itaretarrayam eva . siddham tu nityaabdatvt . siddham etat . katham . nityaabdatvt . nity abd . nityeu abdeu satm daicm saj kriyate . na sajay daica bhvyante . yadi tarhi nity abd kimartham stram . kimartham stram iti cet nivartakatvt siddham . nivartakam stram . katham . mrji asmai avieea upadia . tasya sarvatra mrjibuddhi prasakt . tatra anena nivrtti kriyate . mrje akitsu pratyayeu mrjiprasage mrji sdhu bhavati iti .

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (26 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(P_1,1.1.5) KA_I,41.5-16 Ro_I,134-136 pratyekam vrddhiguasaje bhavata iti vaktavyam . kim prayojanam . samudye m bhtm iti . anyatra sahavacant samudye sajprasaga . anyatra sahavacant samudye vrddhiguasajayo aprasaga . yatra icchati sahabhtnm kryam karoti tatra sahagrahaam . tat yath . saha sup . ubhe abhyastam saha iti . pratyavayavam ca vkyaparisampte . pratyavayavam ca vkyaparisampti dryate . tat yath . devadattayajadattaviumitr bhojyantm iti . na ca ucyate pratyekam iti . pratyekam ca bhuji parisampyate . nanu ca ayam api asti drnta samudye vkyaparisampti iti . tat yath . garg atam dayantm iti . arthina ca rjna hirayena bhavanti na ca pratyekam daayanti . sati etasmin drnte yadi tatra sahagrahaam kriyate iha api pratyekam iti vaktavyam . atha tatra antarea sahagrahaam sahabhtnm kryam bhavati iha api na artha pratyekam iti vacanena . (P_1,1.1.6) KA_I,41.17-42.24 Ro_I,136-140 atha kimartham kra tapara kriyate . krasya taparakaraam savarrtham . krasya taparakaraam kriyate . kim prayojanam . savarrtham . tapara tatklasya iti tatklnm grahaam yath syt . kem . udttnundttasvaritnm . kim ca kraam na syt . bhedakatvt svarasya . bhedak udttdaya . katham puna jyate bhedak udttdaya iti . evam hi dryate loke . ya udtte kartavye anudttam karoti khaikopdhyya tasmai capem dadti anyat tvam karoi iti . asti prayojanam etat . kim tarhi iti . bhedakatvt guasya iti vaktavyam . kim prayojanam . nunsikyam nma gua . tadbhinnasya api yath syt . kim ca kraam na syt . bhedakatvt guasya . bhedak gu . katham puna jyate bhedak gu iti . evam hi dryate loke . eka ayam tm udakam nma . tasya guabhedt anyatvam bhavati : anyat idam tam anyat idam am iti . nanu ca bho abhedak api gu dryante . tat yath . devadatta mu api ja api ikh api svm khym na jahti . tath bla yuv vrddha vatsa damya balvarda iti . ubhayam idam gueu uktam bhedak abhedak iti . kim puna atra nyyyam . abhedak gu iti eva nyyyam . kuta etat . yat ayam asthidadhisakthyakm ana udtta iti udttagrahaam karoti . yadi bhedak gu syu udttam eva uccrayet . yadi tarhi abhedak gu anudttde antodttt ca yat ucyate tat svaritde svaritntt ca prpnoti . na ea doa . ryama gua bhedaka bhavati . tat yath . uklam labheta . kram labheta . tatra ya ukle labdhavye kram labheta na hi tena yathoktam krtam bhavati . asandehrtha tarhi takra . aic iti ucyamane sandeha syt . kim imau aicau eva hosvit kra api atra nirdiyate iti . sandehamtram etat bhavati . sarvasandeheu ca idam upatihate vykhynata vieapratipatti na hi sandeht alakaam iti . traym grahaam iti vykhysyma . anyatra api hi ayam evajtyakeu sandeheu na kam cid yatnam karoti . tat yath . auta amaso iti .idam tarhi prayojanam : ntaryata trimtracaturntrm sthninm trimtracaturmtr de m bhvan iti : khav* indra khavendra , khav* udakam khavodakam , khav* khave khav* h khavoh khav* elak khavailak khav* odana , khavaudana , khav* aitikyana , khavaitikyana , khav* aupagava , khavaupagava iti . atha kriyame api takre kasmt eva trimtracaturntrm sthninam trimtracaturmtr de na bhavanti . tapara tatklasya iti niyamt . nanu ta para yasmt sa ayam tapara . na iti ha . tt api para tapara iti . yadi tt api para tapara rdo ap iti iha eva syt . yava stava . lava pava iti atra na syt . na ea takra . ka tarhi . dakra . kim dakre prayojanam . atha
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (27 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

kim takre prayojanam . yadi asandehrtha takra dakra api . atha mukhasukhrtha takra dakra api . (P_1,1.3.1) KA_I,42.26-44.14 Ro_140-146 iggrahaam kimartham . iggrahaam tsandhyakaravyajananivrttyartham . iggrahaam kriyate kranivrttyartham sandhyakaranivrttyartham vyajananivrttyartham ca. kranivrttyartham tvat . yt vt . krasya gua prpnoti . iggrahat na bhavati . sandhyakaranivrttyartham . glyati mlyati . sandhyakarasya gua prpnoti . iggrahat na bhavati . vyajananivrttyartham . umbhit , umbhitum umbhitavyam . vyajanasya gua prpnoti . iggrahat na bhavati . kranivrttyarthena tvat nrtha . cryapravrtti jpayati na krasya gua bhavati iti yat ayam ta anupasarge ka iti kakram anubandham karoti . katham krtv jpakam . kitkarae etat prayojanam kiti iti kralopa yath syt . yadi ca krasya gua syt kitkaraam anarthakam syt . gue krte dvayo akrayo pararpea siddham rpam syt goda , kambalada iti . payati tu crya na krasya gua bhavati iti . tata kakram anubandham karoti . sandhyakarrthena api na artha . upadeasmarthyt sandhyakarasya gua na bhaviyati . vyajananivrttyarthena api na artha . cryapravrtti jpayati na vyajanasya gua bhavati iti yat ayam jane am sti . katham krtv jpakam . itkarae etat prayojanam iti iti ilopa yath syt . yadi vyajansya gua syt itkaraam anarthakam syt . gue krte traym akrm pararpea siddham rpam syt : upasaraja , manduraja iti . payati tu crya na vyajanasya gua bhavati iti . tata jane am sti. na etni santi prayojanni . yat tvat ucyate kitkaraam jpakam krasya gua na bhavati iti . uttarrtham etat syt . tundaokayo parimrjpanudo iti . yat tarhi gpo hak iti ananyrtham kakram anubandham karoti . yat api ucyate upadeasmarthyt sandhyakarasya gua na bhavati iti . yadi yat yat sandhyakarasya prpnoti tat tat upadeasmarthyt bdhyate ydaya api tarhi na prpnuvanti . na ea doa . yam vidhim prati upadea anarthaka sa vidhi bdhyate . yasya tu vidhe nimittam eva na asau bdhyate . guam ca prati upadea anarthaka ydnm puna nimittam eva . yat api ucyate jane avacanam jpakam na vyajanasya gua bhavati iti . siddhe vidhi rabhyama jpakrtha bhavati . na ca jane guena sidhyati . kuta hi etat jane gua ucyamna akra bhavati na puna ekra v syt okra v iti . ntaryata ardhamtrikasya vyajanasya mtrika akra bhaviyati . evam api anunsika prpnoti . pararpea uddha bhaviyati . evam tarhi game api ayam a vaktavya . game ca gua ucyamna ntaryata okra prpnoti . tasmt iggrahaam kartavyam . yadi iggrahaam kriyate dyau , panth , sa , imam ite ete api ika prpnuvanti . sajay vidhne niyama . sajay ye vidhyante teu niyama . kim vaktavyam etat . na hi . katham anucyamnam gasyate . guavrddhigrahaasmarthyt . katham puna antarea guavrddhigrahaam ika guavrddh sytm . prakrtam guavrddhigrahaam anuvartate . kva prakrtam . vrddhi t aic at e gua iti . yadi tat anuvartate at e gua vrddhi ca iti adem api vrddhisaj prpnoti . sambandham anuvartiyate . vrddhi t aic . at e gua vrddhi t aic . tata ika guavrddh iti . guavrddhigrahaam anuvartate daijgrahaam nivrttam . atha v makagataya adhikr . yath mak utplutya utplutya gacchanti tadvat adhikr . atha v ekayoga kariyate vrddhi t aic at e gua iti . tata iko guavrddh iti . na ca ekayoge anuvrtti bhavati . atha v anyavacant cakrkarat
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (28 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prakrtpavda vijyate yath utsargea prasaktasya apavda bdhaka bhavati . anyasy sajy vacant cakrasya anukararthasya akarat prakrty vrddhisajy guasaja bdhik bhaviyati yath utsargea prasaktasya apavda bdhaka bhavati . atha v vakyati etat . anuvartante ca nma vidhaya na ca anuvartant eva bhavanti . kim tarhi yatnt bhavanti . atha v ubhayam nivrttam . tat apekiymahe . (P_1,1.3.2) KA_I,44.15-47.13 Ro_I,146-155 kim puna ayam alontyaea hosvit alontypavda . katham ca ayam tacchea syt katham v tadapavda . yadi ekam vkyam tat ca idam ca ala : antyasya vidhaya bhavanti ika guavrddh* ala antyasya iti tata ayam tacchea . atha nn vkyam : ala antyasya vidhaya bhavanti , ika guavrddh* antyasya ca anantyasya ca iti tata ayam tadapavda . ka ca atra viea . vrddhiguau ala antyasya iti cet midipugantalaghpadharcchidrikiprakudreu iggrahaam . vrddhiguau ala antyasya iti cet midipugantalaghpadharcchidrikiprakudreu iggrahaam kartavyam . mide gua ika iti vaktavyam . anantyatvt hi na prpnoti . pugantalaghpadhasya gua ika iti vaktavyam . anantyatvt hi na prpnoti . rcche lii gua ika iti vaktavyam . anantyatvt hi na prpnoti . rdrsa ai gua ika iti vaktavyam . anantyatvt hi na prpnoti . kiprakudrayo gua ika iti vaktavyam . anantyatvt hi na prpnoti . sarvdeaprasaga ca anigantasya . sarvdea ca gua ca anigantasya prpnoti : yt vt . kim kraam . ala antyasya iti ah ca eva hi antyam ikam upasakrnt , agasya iti ca sthnaah . tat yat idnm anigantam agam tasya gua sarvdea prpnoti . na ea doa . yath eva hi ala antyasya iti ah antyam ikam upasakrnt evam agasya iti api sthnaah . tat yad idnm anigantam agam , tatra ah eva na asti kuta gua kuta sarvdea . evam tarhi na ayam doasamuccaya . kim tarhi . prvpeka ayam doa , hyarthe ca ayam ca pahita . midipugantalaghpadharcchidrikiprakudreu iggrahaam sarvdeaprasaga hi anigantasya iti . mide gua ika iti vacant antyasya na . antyasya iti vacant ika na . ucyate tu gua . sa sarvdea prpnoti . evam sarvatra . astu tarhi tadapavda . igmtrasya iti cet jusisrvadhtukrdhadhtukahrasvdyo gueu anantyapratiedha . igmtrasya iti cet jusisrvadhtukrdhadhtukahrasvdyo gueu anantyapratiedha vaktavya . jusi gua . sa yath iha bhavati : ajuhavu , abibhayu , evam aneniju , paryaviviu , atra api prpnoti . srvadhtukrdhadhtukayo gua . sa yath iha bhavati : kart hart nayati tarati bhavati , evam hit , hitum iti atra api prpnoti . hrasvasya gua . sa yath iha bhavati : he agne he vyo , evam he agnicit , he somasut iti atra api prpnoti . jasi gua . sa yath iha bhavati agnaya , vyava iti evam agnicita , somasuta iti atra api prpnoti . rto isarvanmasthnayo gua . sa yath iha bhavati kartari kartrau kartra iti evam sukrti sukrtau sukrta iti atra api prpnoti .ghe iti gua . sa yath iha bhavati agnaye vyave evam agnicite somasute iti atra api prpnoti . o gua . sa yath iha bhavati bbhravya , mavya iti evam surut , sauruta iti atra api prpnoti . na ea doa . pugantalaghpadhagrahaam anantyaniyamrtham . pugantalaghpadhagrahaam anantyaniyamrtham bhaviyati . pugantalaghpadhasya eva anantyasya na anyasya anantyasya iti . prakrtasya ea niyama syt . kim ca prakrtam . srvadhtukrdhadhtukayo iti . tena bhavet iha niyamt na syt hit , hitum , hitavyam iti . hrasvdyo gua tu aniyata . sa anantyasya api prpnoti . atha api evam niyama syt .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (29 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

pugantalaghpadhasya srvadhtukrdhadhtukayo eva iti . evam api srvadhtukrdhadhtukayo gua aniyata . sa anantyasya api prpnoti : hit , hitum hitavyam iti . atha api ubhayata niyama syt : pugantalaghpadhasya eva srvadhtukrdhadhtukayo , srvadhtukrdhadhtukayo eva pugantalaghpadhasya iti , evam api ayam jusi gua aniyata . sa anantyasya api prpnoti : aneniju , paryaviviu iti . evam tarhi na ayam tacchea na api tadapavda . anyat eva idam paribhntaram asambaddham anay paribhay . paribhntaram iti ca matv krory pahanti : niyamt ika guavrddh bhavata vipratiedhena iti . yadi ca ayam tacchea syt tena eva tasya ayukta vipratiedha . atha api tadapavda utsargpavdayo api ayukta vipratiedha . tatra niyamasya avaka : rja ka ca , rjakyam . ika guavrddh* iti asya avaka : cayanam , cyaka , lavanam , lvaka iti . iha ubhayam prpnoti : medyati mri iti . ika guavrddh* iti etat bhavati vipratiedhena . na ea yukta vipratiedha . vipratiedhe hi param iti ucyate , prva ca ayam yoga para niyama . iavc paraabda . vipratiedhe param yat iam tat bhavati . evam api ayukta vipratiedha . dvikryayoga hi vipratiedha . na ca atra eka dvikryayukta . na avayam dvikryayoga eva vipratiedha . kim tarhi. asambhava api . sa ca asti atra asambhava . ka asau asmbhava . iha tvat : vrkebhya , plakebhya iti eka sthn dvau deau . na ca asti sambhava yat ekasya sthnina dvau deau sytm . iha idnm medyati medyata medyanti iti dvau sthninau eka dea . na ca asti sambhava yat dvayo sthnino eka dea syt iti ea asambhava . satyam etasmin asambhave yukta vipratiedha . evam api ayukta vipratiedha . dvayo hi svakayo samavasthitayo vipratiedha bhavati . anavaka ca ayam yoga . nanu ca idnm eva asya avaka praklpta : cayanam , cyaka , lavanam , lvaka iti . atra api niyama prpnoti . yvat na aprpte niyame ayam yoga rabhyate ata tadapavda ayam yoga bhavati . utsargpavdayo ca ayukta vipratiedha . atha api katham cit ika guavrddh* iti asya avaka syt , evam api yath iha vipratiedht ika gua bhavati : medyati medyata medyanti , evam iha api syt : aneniju , paryaveviu iti . evam tarhi vrddhi bhavati gua bhavati iti yatra bryt ika iti etat tatra upasthitam draavyam . kim krtam bhavati . dvity ah prdu bhvyate . tatra kmacra : grhyamena v ikam vieayitum ik v grhyamam . yvat kmacra iha tvat : midipugantalaghpadharcchidrikiprakudreu grhyamena ikam vieayiyma : etem ya ik iti . iha idnm : jusisrvadhtukrdhadhtukahrasvdyo gueu ik grhyamam vieayiyma : etem gua bhavati ika . igantnm iti . atha v sarvatra eva sthn nirdiyate . iha tvat : mide iti , avibhaktika nirdea : mida , e , mide , mide iti . atha v ahsamsa bhaviyati mida i , midi , mide iti . pugantalaghpadhasya iti na evam vijyate : pugantasya agasya laghpadhasya ca iti . katham tarhi . puki anta puganta , laghv upadh laghpadh , puganta ca laghpadh ca pugantalaghpadham pugantalaghpadhasya iti . avayam ca etat evam vijeyam . agavieae hi sati iha prasajyeta : bhinatti chinatti iti . rcche api pralianirdea ayam . rcchati , r , r , rtm rcchatyrtm iti . dre api yogavibhga kariyate . u ai gua . u ai gua bhavati . tata dre . dre ca ai gua bhavati . u iti eva. kiprakudrayo api yadiparam gua iti iyat siddham . sa ayam evam siddhe sati yat prvagrahaam karoti tasya etat prayojanam ika yath syt anika m bht iti .

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (30 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(P_1,1.3.3) KA_I,47.14-49.21 Ro_I,155-161 atha vrddhigrahaam kimartham . kim vieea vrddhigrahaam codyate na puna guagrahaam api . yadi kim cit guagrahaasya prayojanam asti vrddhigrahaasya api tat bhavitum arhati . ka v viea . ayam asti viea . guavidhau na kva cit sthn nirdiyate . tatra avayam sthninirdertham guagrahaam kartavyam . vrddhividhau puna sarvatra eva sthn nirdiyate . aca iti ata upadhy taddhiteu acm de iti . ata uttaram pahati . vrddhigrahaam uttarrtham . vrddhigrahaam kriyate uttarrtham . kiti iti pratiedham vakyati . sa vrddhe api yath syt . ka ca idnm kitpratyayeu vrddhe prasaga yvat iti iti ucyate . tat ca mrjyartham . mrje vrddhi avieea ucyate . s kiti m bht : mra , mravn iti . ihrtham ca api mrjyartham vrddhigrahaam kartavyam . mrje vrddhi avieea ucyate . s ika yath syt . anik m bht iti . mrjyartham iti cet yogavibhgt siddham . mrjyartham iti cet yogavibhga kariyate . mrje vrddhi . tata iti . iti iti ca vrddhi bhavati . aca iti eva . yadi aca vrddhi ucyate nyamr : aa api vrddhi prpnoti . ai ca uktam . kim uktam. anantyavikre antyasadeasya kryam bhavati iti . vrddhipratiedhnupapatti tu ikprakarat . vrddhe tu pratiedha na upapadyate . kim kraam . ikprakarat . iglakaayo guavrddhyo pratiedha na ca evam sati mrje iglaka vrddhi bhavati . tasmt mrje iglaka vrddhi eitavy . evam tarhi iha anye vaiykara mrje ajdau sakrame vibh vrddhim rabhante : parimrjanti parimrjanti parimrjantu parimrjantu parimamrjatu , parimamrjatu itydyartham . tat iha api sdhyam . tasmin sdhye yogavibhga kariyate . mrje vrddhi aca bhavati . tata aci kiti . ajdau ca kiti mrje vrddhi bhavati : parimrjanti parimrjantu . kimartham idam . niyamrtham : ajdau eva kiti na anyatra . kva anyatra m bht . mra , mravn iti . tata v . v aci kiti mrje vrddhi bhavati . parimrjanti , parimrjanti , parimamrjatu , parimamrjatu iti . ihrtham eva sijartham vrddhigrahaam kartavyam . sici vrddhi avieea ucyate . s ika yath syt , anika m bht iti . kasya puna anika prpnoti . akrasya : acikrt , ajihrt . na etat asti . lopa atra bdhaka bhaviyati . krasya tarhi prpnoti : ayst , avst . na asti atra viea satym vrddhau asatym v . sandhyakarasya tarhi prpnoti . na eva sandhyakaram antyam asti . nanu ca idam asti halope krte udavohm udavoham udavoha iti . na etat asti . asiddha halopa . tasya asiddhatvt na etat antyam bhavati . vyajanasya tarhi prpnoti : abhaitst , acchaitst . halantalaka vrddhi bdhik bhaviyati . yatra tarhi s pratiidhyate : akot , amot . sici vrddhe api ea pratiedha . katham . lakaam hi nma dhvanati bhramati muhrtam api na avatihate . atha v sici vrddhi parasmaipadeu iti sici vrddhi prpnoti . tasy halantalaka vrddhi bdhik . tasy api na ii iti pratiedha . asti puna kva cid anyatra api apavde pratiiddhe utsarga api na bhavati . asti iti ha . sujte* avasnrte , adhvaryo* adribhi sutam , ukram te* anyat iti . prvarpatve pratiiddhe aydaya api na bhavanti . uttarrtham eva tarhi sijartham vrddhigrahaam kartavyam . sici vrddhi avieea ucyate . s kiti m bht nyanuvt , nyadhuvt . na etat asti prayojanam . antaragatvt atra uvadee krte anantyatvt vrddhi na bhaviyati . yadi tarhi sici antaragam bhavati , akrt , ahrt : gue krte raparatve ca anantyatvt vrddhi na prpnoti . m bht evam . halantasya iti evam bhaviyati . iha tarhi : nyastrt , vyadrt : gue raparatve ca anantyatvt vrddhi na prpnoti . halantalakay ca na ii iti pratiedha . m bht evam . rlntasya iti evam bhaviyati . iha tarhi : alvt apvt : gue krte avdee ca anantyatvt vrddhi na prpnoti . halantalakay ca na ii iti pratiedha . m bht evam . rlntasya iti evam
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (31 of 190) [3/8/2008 12:51:09 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

bhaviyati . rlntasya iti ucyate na ca idam rlntam . rlntasya iti atra vakra api nirdiyate . kim vakra na ryate . luptanirdita vakra . yadi evam m bhavn mavt : atra api prpnoti . avimavyo iti vakymi . tat vaktavyam . ivibhym tau nimtavyau . yadi api etat ucyate atha v etarhi ivyo pratiedha na vaktavya bhavati . gue krte aydee ca yntnam na iti pratiedha bhaviyati . evam tarhi cryapravrtti jpayati na sici antaragam bhavati iti yat ayam ata halde lagho iti akragrahaam karoti . katham krtv jpakam . akragrahaasya etat prayojanam iha m bht : akot , amot . yadi sici antaragam syt akragrahaam anarthakam syt . gue krte alaghutvt vrddhi na bhaviyati . payati tu crya na sici antaragam bhavati iti . tata akragrahaam karoti . na etat asti jpakam . asti anyat etasya vacane prayojanam . kim . yatra gua pratiidhyate tadartham etat syt : nyakut , nyaput iti . yat tarhi ivyo pratiedham sti tena na iha antaragam asti iti darayati . yat ca karoti akragrahaam lagho iti krte api . tasmt iglaka vrddhi . tasmt iglaka vrddhi sthey . (P_1,1.3.4) KA_I,49.24-50.16 Ro_I,161-163 ahy sthneyogatvt ignivrtti . ahy sthneyogatvt sarvem ikm nivrtti prpnoti . asya api prpnoti : dadhi madhu . punarvacanam idnm kimartham syt . anyatarrtham punarvacanam . anyatarrtham etat syt . srvadhdukrdhadhtukayo gua eva iti . prasrae ca . prasrae ca sarveam yam nivrtti prpnoti . asya api prpnoti : yt vt . punarvacanam idnm kimartham syt . viayrtham punarvacanam . viayrtham etat syt . vacisvapiyajdnm kiti eva iti . u a rapare ca . u a rapare ca sarvarkrm nivrtti prpnoti . asya api prpnoti kartr hartr . siddham tu ahyadhikre vacant . siddham etat . katham . ahyadhikre ime yog kartavy . eka tvat kriyate tatra eva . imau api yogau ahadhikram anuvartiyete . atha v ahadhikre imau yogau apekiymahe . atha v idam tvad ayam praavya . srvadhtukrdhadhtukayo gua bhavati iti iha kasmt na bhavati : yt vt . idam tatra apekiyate ika guavrddh* iti . yath eva tarhi idam tatra apekiyate evam iha api tad apekiymahe srvadhtukrdhadhtukayo ika guavrddh* iti. (P_1,1.4.1) KA_I,51.2-13 Ro_I,164-166 dhtugrahaam kimartham . iha m bht: l lavit lavitum p pavit pavitum . rdhadhtuke iti kimartham . tridh baddha vrabha roravti . kim puna idam rdhadhtukagrahaam lopavieaam : rdhadhtukanimitte lope sati ye guavrddh prpnuta te na bhavata iti , hosvit guavrddhivieaam rdhadhtukagrahaam : dhtulope sati rdhadhtukanimitte ye guavrddh prpnuta te na bhavata iti . kim ca ata . yadi lopavieaam upeddha preddha atra api prpnoti . atha guavrddhivieaam knopayati iti atra api prpnoti . yath icchasi tath astu . astu lopavieaam . katham upeddha preddha iti . bahiraga gua antaraga pratiedha . asiddham bahiragam antarage . yadi evam na artha dhtugrahaena . iha kasmt na bhavati: l lavit lavitum . rdhadhtukanimitte lope pratiedha na ca ea rdhadhtukanimitta lopa . atha v puna astu guavrddhivieaam . nanu ca uktam knopayati iti atra api prpnoti iti . na ea doa . niptant siddham . kim niptanam . cele knope iti (P_1,1.4.2) KA_I,51.14-52.20 Ro_I,166-169 parigaanam kartavyam . yayakkyavalope pratiedha . yayakkyavalope pratiedha vaktavya . ya: bebhidit marmrja . yak:
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (32 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

kuubhit magadhaka . kya: samidhit dradaka . valope : jradnu . kim prayojanam . numlopasrivyanubandhalope apratiedhrtham . numlope srivyanubandhalope ca pratiedha m bht iti . numlope: abhji rga upabarhaam . srive : sremam . anubandhalope : l lavit lavitum . yadi parigaanam kriyate syada, praratha, himaratha iti atra api prpnoti . vakyati etat niptant syaddiu iti . tat tarhi parigaanam kartavyam . na kartavyam . numlope kasmt na bhavati . ikprakarat numlope vrddhi . iglakaayo guavrddhyo pratiedha na ca e iglaka vrddhi . yadi iglakaayo guavrddhyo pratiedha syada, praratha, himaratha iti atra na prpnoti . iha ca prpnoti: avoda, edha, odma iti . niptant syaddiu . niptant syaddiu pratiedha bhaviyati na ca bhaviyati . yadi iglakaayo guavrddhyo pratiedha srivyanubandhalope katham srive sremam l lavit . pratyayrayatvt anyatra siddham . rdhadhtukanimitte lope pratiedha na ca ea rdhadhtukanimitta lopa . yadi rdhadhtukanimitte lope pratiedha jradnu atra na prpnoti . raki jya prasraam . na etat jve rpam . raki etat jya prasraam . yvat ca idnm raki jve api siddham bhavati . katham upabarhaam . brhi prakrtyantaram . katham jyate brhi prakrtyantaram iti . aci iti hi lopa ucyate anajdau api dryate: nibrhyate . anii iti ca ucyate . idau api dryate: nibarhit nibarhitum iti . ajdau api na dryate: brhayati brhaka . tasmt na artha parigaanena . yadi parigaanam na kriyate bhedyate chedyate atra api prpnoti . na ea doa . dhtulope iti na evam vijyate: dhto lopa dhtulopa, dhtulope iti . katham tarhi . dhto lopa asmin tat idam dhtulopam, dhtulope iti . tasmt iglakaayo guavrddhyo pratiedha . yadi tarhi iglakaayo guavrddhyo pratiedha ppacaka, ppahaka, magadhaka, dradaka atra na prpnoti . allopasya sthnivatvt . akralope krte tasya sthnivatvt guavrddh na bhaviyata . (P_1,1.4.3) KA_I,52.21-53.15 Ro_I,169-171 anrambha v . anrambha v puna asya yogasya nyyya . katham bebhidit, marmrjaka, kuubhit samidhit iti . atra api akralope krte tasya sthnivatvt guavrddh na bhaviyata . yatra tarhi sthnivadbhva na asti tadartham ayam yoga vaktavya . kva ca sthnivadbhva na asti . yatra halaco dea: loluva popuva marmrja sarsrpa iti . atra api akralope krte tasya sthnivatvt guavrddh na bhaviyata . luki krte na prpnoti . idam iha sampradhryam: luk kriyatm allopa iti kim atra kartavyam . paratvt allopa . nitya luk . krte api allope prpnoti akrte api prpnoti . luk api anitya . katham . anyasya krte allope prpnoti anyasya akrte . abdntarasya ca prpnuvan vidhi anitya bhavati . anavaka tarhi luk. svaka luk . ka avaka . avaia . atham katham cit anavaka luk syt evam api na doa . allope yogavibhga kariyate : ata lopa . tata yasya : yasya ca lopa bhavati . ata iti eva . kimartham idam . lukam vakyati tadbdhanrtham . tato hala . hala uttarasya ca yasya lopa bhavati iti . iha api paratvt yogavibhgt va lopa lukam bdheta: kra nonva vrabha yadi idam . nonyate nonva . samnraya luk lopena bdhyate . ka ca samnraya . ya pratyayraya . atra ca prk eva pratyayotpatte luk bhavati . katham syada, praratha, himaratha, jradnu, nikucita iti . uktam ee . kim uktam . niptant syaddiu . pratyayratvt anyatra siddham . raki jya prasraam iti . nikucite api uktam sanniptalakaa vidhi animittam tadvightasya iti . (P_1,1.5.1) KA_I,53.17-54.13 Ro_I,171-174 kiti pratiedhe tannimittagrahaam . kiti

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (33 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

pratiedhe tannimittagrahaam kartavyam . kinnimitte ye guavrddh prpnuta te na bhavata iti vaktavyam . kim prayojanam . upadhroravtyartham . upadhrtham roravtyartham ca . upadhrtham tvat : bhinna , bhinnavn iti . kim puna kraam na sidhyati . kiti iti ucyate . tena yatra kiti anantara guabhv asti tatra eva syt: citam stutam . iha tu na syt: bhinna , bhinnavn iti . nanu ca yasya gua ucyate tat kitparatvena vieayiyma . pugantalaghpadhasya ca gua ucyate tat ca atra kitparam . pugantalaghpadhasya iti na evam vijyate : pugantasya agasya laghpadhasya ca iti . katham tarhi . puki anta puganta , laghv upadh laghpadh , puganta ca laghpadh ca pugantalaghpadham , pugantalaghpadhasya iti . avayam ca etat evam vijeyam . agavieae hi sati iha prasajyeta : bhinatti chinatti iti . roravtyartham ca . tridh baddha vrabha roravti iti . yadi tannimittagrahaam kriyate acaante doa . riyati piyati dhiyati . prdudruvat prsusruvat . atra prpnoti . acaantasya antaragalakaatvt . antaragalakaatvt atra iyauvao krtayo anupadhtvt gua na bhaviyati . evam kriyate ca idam tannimittagrahaam na ca ka cit doa bhavati . imni ca bhya tannimittagrahaasya prayojanni : hata , hatha , upoyate , auyata , lauyamni , pauyamni , nenikte iti . na etni santi prayojanni . iha tvat hata , hatha iti . prasaktasya anabhinirvrttasya pratiedhena nivrtti aky kartum atra ca dhtpadevasthym eva akra . iha ca upoyate , auyata , lauyamni , pauyamni iti . bahirage guavrddh antaraga pratiedha . asiddham bahiragam antarage . nenikte iti parea rpea vyavahitatvt na bhaviyati . (P_1,1.5.2) KA_I,54.13-55.5 Ro_I,175-177 upadhrthena tvat na artha . dhto iti vartate . dhtum kitparatvena vieayiyma . yadi dhtu vieyate vikaraasya na prpnoti : cinuta , sunuta , lunta , punta iti . na ea doa . vihitavieaam dhtugrahaam . dhto ya vihita iti . dhto eva tarhi na prpnoti . na evam vijyate dhto vihitasya kiti iti . katham tarhi . dhto vihite kiti iti . atha v kryaklam hi sajparibham . yatra kryam tatra draavyam . pugantalaghpadhasya gua bhavati iti upasthitam idam bhavati kiti na iti . atha v yat etasmin yoge kidgrahaam tad anavakam . tasya anavakatvt guavrddh na bhaviyata . atha v cryapravrtti jpayati bhavati upadhlakaasya guasya pratiedha iti yat ayam trasigrdhidhrikipe knu ika jhal halantt ca iti knusanau kitau karoti . katham krtv jpakam . kitkarae etat prayojanam gua katham na syt iti . yadi ca atra guapratiedha na syt kitkaraam anarthakam syt . payati tu crya bhavati upadhlakaasya guasya pratiedha iti . tata knusanau kitau karoti . roravtyarthena api na artha . kiti iti ucyate . na ca atra kitam payma . pratyayalakaena prpnoti . na lumat tasmin iti pratyayalakaapratiedha . atha api na lumat agasya iti ucyate evam api na doa . katham . na lumat lupte agdhikra pratinirdiyate . kim tarhi . ya asau lumat lupyate tasmin yat agam tasya yat kryam tat na bhavati iti . atha api gdhikra pratinirdiyate evam api na doa . katham . kryaklam hi sajparibham yatra kryam tatra draavyam . srvadhtukrdhadhtukayo gua bhavati iti upasthitam idam bhavati kiti na iti . atha v chndasam etat . drnuvidhi ca chandasi bhavati . atha v bahiraga gua antaraga pratiedha . asiddham bahiragam antarage . atha v prvasmin yoge yad rdhadhtukagrahaam tat anavakam . tasya anavakatvt gua bhaviyati .

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (34 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(P_1,1.5.3) KA_I,55.6-18 Ro_I,177-180 iha kasmt na bhavati : laigavyana , kmayate . taddhitakmyo ikprakarat . iglakaayo guavrddhyo pratiedha na ca ete iglakae . lakrasya ittvt deeu sthnivadbhvaprasaga . lakrasya ittvt deeu sthnivadbhva prpnoti : acinavam asunavam akaravam . lakrasya ittvt deeu sthnivadbhvaprasaga iti cet ysua idvacant siddham . yat ayam ysua idvacanam sti tat jpayati crya na idde ita bhavanti iti . yadi etat jpyate katham nityam ita ita ca iti . ita yat kryam tat bhavati iti yat kryam tat na bhavati iti . kim vaktavyam etat . na hi . katham anucyamnam gasyate . ysua eva idvacant . aparypta ca eva hi ysu samudyasya ittve itam ca enam karoti . tasya etat prayojanam ita yat kryam tat yath syt iti yat kryam tat m bht iti . (P_1,1.6) KA_I,55.20-56.16 Ro_I,180-182 kimartham idam udyate . guavrddh m bhtm iti : ddhyanam ddhyaka , vevyanam vevyaka iti . ayam yoga akya akartum . katham . ddhvevyo chandoviayatvt drnuvidhitvt ca chandasa addhet addhayu iti ca guadarant apratiedha . ddhvevyo chandoviayatvt . ddhvevyau chandoviayau . drnuvidhitvt ca chandasa . drnuvidhi ca chandasi bhavati . addhet , addhayu iti ca guadarant apratiedha . anarthaka pratiedha apratiedha . prajapati vai yat kim cana manas addhet . hotraya vrta krpayan addhet . addhayu darje vrtasa . bhavet idam yuktam udharaam : addhet iti . idam tu ayuktam : addhayu iti . ayam jusi gua pratiedhaviaye [pratiedhaviaya] rabhyate . sa yath eva kiti na iti etam pratiedham bdhate evam imam api bdhate . na ea doa . jusi gua pratiedhaviaye rabhyama tulyajtyam pratiedham bdhate . ka ca tulyajtya pratiedha . ya pratyayraya . prakrtyraya ca ayam . atha v yena na aprpte tasya bdhanam bhavati . na ca aprpte kiti na iti etasmin pratiedhe jusi gua rabhyate . asmin puna prpte ca aprpte ca . yadi tarhi ayam yoga na rabhyate katham ddhyat iti . ddhyat iti yanvyatyayena . ddhyat iti yan ea vyatyayena bhaviyati . ia ca api grahaam akyam akartum . katham akaiam araiam , kait va , rait va iti . rdhadhtukasya i valde iti atra i iti vartamne puna igrahaasya prayojanam i eva yath syt yat anyat prpnoti tat m bht iti . kim ca anyat prpnoti . gua . yadi niyama kriyate pipahiate apratyaya pipa : drghatvam na prpnoti . na ea doa . gam yat kryam tat niyamyate . na ca etat gam . atha v asiddham drghatvam . tasya asiddhatvt niyama na bhaviyati . (P_1,1.7.1) KA_I,56.18-23 Ro_I,182-183 anantar iti katham idam vijyate : avidyamnam antaram em iti hosvit avidyamn antar em iti . kim ca ata . yadi vijyate avidyamnam antaram em iti avagrahe sayogasaj na prpnoti apsu iti ap-su iti . vidyate hi atra antaram . atha vijyate avidyamn antar em iti na doa bhavati . yath na doa tath astu . atha v puna astu avidyamnam antaram em iti . nanu ca uktam avagrahe sayogasaj na prpnoti ap-su iti apsu iti . vidyate hi atra antaram iti . na eva doa na prayojanam . (P_1,1.7.2) KA_I,56.24-57.26 Ro_I,183-186 sayogasajym sahavacanam yath anyatra . sayogasajym sahavacanam kartavyam . hala anantar sayoga saha iti vaktavyam . kim prayojanam . sahabhtnm sayogasaj yath syt ekaikasya m bht
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (35 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

iti . yath anyatra . tat yath anyatra api yatra icchati sahabtnm kryam karoti tatra sahagrahaam . tat yath . saha sup . ubhe abhyastam saha iti . kim ca syt yadi ekaikasya hala sayogasaj syt . iha niryyt , nirvyt , v anyasya sayogde iti ettvam prasajyeta . iha ca sahra iti rta ca sayogde iti i prasajyeta . iha ca sahriyate iti gua artisayogdyo iti gua prasajyeta . iha ca drat karoti samit karoti iti sayogntasya lopa prasajyeta . iha ca akt vast iti sko sayogdyo iti lopa prasajyeta . iha ca niryta , nirvta sayogde ta dhto yavata iti nihnatvam prasajyeta . na ea doa . yat tvat ucyate iha tvat niryyt , nirvyt v anyasya sayogde iti ettvam prasajyeta iti . na evam vijyate sayoga di yasya sa ayam sayogdi , sayogde iti . katham tarhi . sayogau d yasya sa ayam sayogdi , sayogde iti . evam tvat sarvam gam parihrtam . yat api ucyate iha ca drat karoti samit karoti iti sayogntasya lopa prasajyeta iti . na evam vijyate sayoga anta yasya tat idam sayogntam , sayogntasya iti . katham tarhi . sayogau antau asya tad idam sayogntam , sayogntasya iti . yat api ucyate iha ca akt vast iti sko sayogdyo iti lopa prasajyeta iti . na evam vijyate sayogau d sayodd sayogdyo iti . katham tarhi . sayogayo d sayogd sayogdyo iti . yat api ucyate iha ca niryta , nirvta sayogde ta dhto yavata iti nihnatvam prasajyeta iti . na evam vijyate sayoga di yasya sa ayam sayogdi , sayogde iti . katham tarhi . sayogau d yasya sa ayam sayogdi , sayogde iti . katham krtv ekaikasya sayogasaj prpnoti . pratyekam vkyaparisampti dr . tat yath . vrddhiguasaje pratyekam bhavata . nanu ca ayam api asti drnta : samudye vkyaparisampti iti . tat yath . garg atam dayantm iti . arthina ca rjna hirayena bhavanti na ca pratyekam daayanti . sati etasmin drnte yadi tatra pratyekam iti ucyate iha api sahagrahaam kartavyam . atha tatra antarea pratyekam iti vacanam pratyekam vrddhiguasaje bhavata iha api na artha sahagrahaena . (P_1,1.7.3) KA_I,57.27-59.2 Ro_I,186-190 atha yatra bahnm nantaryam kim tatra dvayo dvayo sayogasj bhavati hosvit avieea . ka ca atra viea . samudye sayogdilopa masje . samudye sayogdilopa masje na sidhyati . makt maktum . iha ca nirgleyt , nirglyt , nirmleyt , nirmlyt : v anyasya sayogde iti ettvam na prpnoti . iha ca sasvaria iti rta ca sayogde iti i na prpnoti . iha ca sasvaryate iti gua artisayogdyo iti gua na prpnoti . iha ca gomn karoti yavamn karoti iti sayogntasya lopa iti lopa na prpnoti . iha ca nirglna , nirmlna iti sayogde ta dhto yavata iti nihnatvam na prpnoti . astu tarhi dvayo dvayo . dvayo halo sayoga iti cet dvirvacanam . dvayo halo sayoga iti cet dvirvacanam na sidhyati . indram icchati indryati . indryate san : indidryiati . na ndr sayogdaya iti dakrasya dvirvacanam na prpnoti . na v ajvidhe . na v ea doa . kim kraam . ajvidhe . ndr sayogdaya na dvi ucyante . ajde iti vartate . atha yadi eva bahnm sayogasj atha api dvayo dvayo kim gatam etat iyat strea hosvit anyatarasmin pake bhya stram kartavyam . gatam iti ha . katham . yada tvat bahnm sayogasj tad evam vigraha kariyate : avidyamnam antaram em iti . yad dvayo dvayo tad evam vigraha kariyate : avidyamn antar em iti . dvayo ca eva antar ka cit vidyate na v . evam api bahnm eva prpnoti . yn hi bhavn ahy pratinirdiati etem anyena vyavye na
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (36 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

bhavitavyam . astu tarhi samudye saj . nanu ca uktam samudye sayogdilopa masje iti . na ea doa . vakyati etat . antyt prva masje mit anuagasayogdiloprtham iti . atha v avieea sayogasaj vijsyate dvayo api bahnm api . tatra dvayo y sayogasj tadraya lopa bhaviyati . yat api ucyate iha ca nirgleyt , nirglyt , nirmleyt , nirmlyt : v anyasya sayogde iti ettvam na prpnoti iti agena sayogdim vieayiyma . agasya sayogde iti . evam tvat sarvam gam parihrtam . yat api ucyate iha ca gomn karoti yavamn karoti iti sayogntasya lopa iti lopa na prpnoti iti padena sayogntam vieayiyma . padasya sayogntasya . yat api ucyate iha ca nirglna , nirmlna iti sayogde ta dhto yavata iti nihnatvam na prpnoti iti dhtuna sayogdim vieayiyma . dhto sayogde iti . (P_1,1.7.4) KA_I,59.3-24 Ro_I,190-192 svarnantarhitavacanam . svarai anantarhit hala sayogasaj bhavanti iti vaktavyam . kim prayojanam . vyavahitnm m bht . pacati panasam . nanu ca anantar iti ucyate . tena vyavahitnm na bhaviyati . dram nantaryam vyavahite . vyavahite api anantaraabda dryate . tat yath : anantarau imau grmau iti ucyate . tayo ca eva antar nadya ca parvat ca bhavanti . yadi tarhi vyavahite api anantaraabda bhavati nantaryavacanam idnm kimartham syt . nantaryavacanam kimartham iti cet ekapratiedhrtham . ekasya hala sayogasaj m bht iti . kim ca syt yadi ekasya hala sayogasaj syt . iyea , uvoa . ijde ca gurumata anrccha iti m prasajyeta . na v atajjtyavyavyt . na v ea doa . kim kraam . atajjtyasya vyavyt . atajjtyakam hi loke vyavadhyakam bhavati . katham puna jyate atajjtyakam loke vyavadhyakam bhavati iti . evam hi kam cit ka cit prcchati . anantare* ete brhmaakule* iti . sa ha . na anantare . vralakulam anayo antar iti . kim puna kraam kva cit atajjtyakam vyavadhyakam bhavati kva cit na . sarvatra eva hi atajjtyakam vyavadhyakam bhavati . katham anantarau imau grmau iti . grmaabda ayam bahvartha . asti eva lsamudye vartate . tat yath grma dagdha iti . asti vaparikepe vartate . tat yath grmam pravia . asti manuyeu vartate . tat yath grma gata , grma gata iti . asti srayake sasmake sasthailake vartate . tat yath grma labdha iti . tat ya srayake sasmake sasthailake vartate tam abhisamkya etat prayujyate : anantarau imau grmau iti . sarvatra eva hi atajjtyakam vyavadhyakam bhavati . (P_1,1.8.1) KA_I,59.26-60.5 Ro_I,192-193 kim idam mukhansikvacana iti . mukham ca nsik ca mukhansikam . mukhansikam vacanam asya sa ayam mukhansikvacana . yadi evam mukhansikavacana iti prpnoti . niptant drghatvam bhaviyati . atha v mukhansikam vacanam asya sa ayam mukhansikvacana . kim idam vacanam iti . advacanam vacanam . kim cit mukhavacanam kim cit nsikvacanam . mukhadvity v nsik vacanam asya sa ayam mukhansikvacana . mukhopasahit v nsik vacanam asya sa ayam mukhansikvacana . (P_1,1.8.2) KA_I,60.5-16 Ro_I,193-194 atha mukhagrahaam kimartham . nsikvacana anunsika iti iyati ucyamne yamnusvrm eva prasajyeta . mukhagrahae puna kriyame na doa bhavati . atha nsikgrahaam kimartham . mukhavacana anunsika iti iyati ucyamne kacaatapnm eva prasajyeta . nsikgrahae puna kriyame na doa bhavati . mukhagrahaam akyam akartum . kena idnm ubhayavacannm bhaviyati .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (37 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prsdavsinyyena . tat yath . ke cit prsdavsina ke cit bhmivsina ke cit ubhayavsina . ye prsdavsina grhyante te prsdavsigrahaena . ye bhmivsina grhyante te bhmivsinyyena . ye ubhayavsina grhyante te prsdavsigrahaena bhmivsinyyena ca . evam iha api ke cit mukhavacan ke cit nsikvacan ke cit ubhayavacan . tatra ye mukhavacan grhyante te mukhagrahaena . ye nsikvacan grhyante te nsikgrahaena . ye ubhayavacan grhyante eva te mukhagrahaena nsikgrahaena ca. bhavet ubhayavacannm siddham . yamnusvrm api prpnoti . na eva doa na prayojanam . (P_1,1.8.3) KA_I,60.17-26 Ro_I,194-195 itaretarrayam tu bhavati . k itaretarrayat . sata anunsikasya sajay bhavitavyam sajay ca nma anunsika bhvyate . tat itaretarrayam bhavati . itaretarrayi ca kryi na prakalpante . anunsikasajym itaretarraye uktam . siddham tu nityaabdatvt iti . nity abd . nityeu abdeu sata anunsikasya saj kriyate . na sajay anunsika bhvyate . yadi tarhi nity abd kimartham stram . kimartham stram iti cet nivartakatvt siddham . nivartakam stram . katham . asmai avieea upadia ananunsika . tasya sarvatra ananunsikabuddhi prasakt . tatra anena nivrtti kriyate . chandasi aci parata a ananunsikasya prasage anunsika sdhu bhavati iti . (P_1,1.9.1) KA_I,61.2-7 Ro_I,195-197 tulay sammitam tulyam . syam ca prayatna ca syaprayatnam . tulysyam tulyaprayatnam ca savarasajam bhavati . kim puna syam . laukikam syam oht prabhrti prk kkalakt . katham puna syam . asyanti anena varn iti syam . annam etat syandate iti v syam . atha ka prayatna . prayatanam prayatna . praprvt yatate bhvasdhana napratyaya . yadi laukikam syam kim syopdne prayojanam . sarvem hi tat tulyam bhavati . vakyati etat : prayatnavieaam syopdnam iti . (P_1,1.9.2) KA_I,61.8-62.14 Ro_I,197-202 savarasajym bhinnadeeu atiprasaga prayatnasmnyt . savarasajym bhinnadeeu atiprasaga bhavati jabagaadam . kim kraam . prayatnasmnyt . etem hi samna prayatna . siddham tu sye tulyadeaprayatnam savaram . siddham etat. katham . sye yem tulya dea yatna ca te savarasaj bhavanti iti vaktavyam . evam api kim syopdne prayojanam . sarvem hi tat tulyam . prayatnavieaam syopdnam . santi hi syt bhy prayatn . te hpit bhavanti . teu satsu asatsu api savarasaj sidhyati . ke puna te . vivrasavrau vsandau ghoavadaghoat alpaprat mahprat iti . tatra vargm prathamadvity vivrtakah vsnupradn agho . eke alpapr apare mahpr . trtyacaturth savrtakah ndnupradn ghoavanta . eke alpapr apare mahpr . yath trty tath pacam nunsikyavarjam . nunsikyam tem adhika gua . evam api avarasya savarasaj na prpnoti . kim kraam . bhyam hi syt sthnam avarasya . sarvamukhasthnam avaram eke icchanti . evam api vyapadea na prakalpate : sye yem tulya dea iti . vyapadeivadbhvena vyapadea bhaviyati . sidhyati . stram tarhi bhidyate . yathnysam eva astu . nanu ca uktam savarasajaym bhinnadeeu atiprasaga prayatnasmnyt iti . na ea doa . na hi laukikam syam . kim tarhi . taddhitntam syam : sye bhavam syam . arrvayavt yat . kim puna sye
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (38 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

bhavam . sthnam karaam ca . evam api prayatna avieita bhavati . prayatna ca vieita . katham . na hi prayatanam prayatna . kim tarhi . prrambha yatnasya prayatna . yadi prrambha yatnasya prayatna evam api avarasya eo ca savarasaj prpnoti . praliavarau etau . avarasya tarhi aico ca savarasaj prpnoti . vivrtatarvarau etau . etayo eva tarhi mitha savarasaj prpnoti . na etau tulyasthnau . udttdnm tarhi savarasaj na prpnoti . abhedak udttdaya . atha v kim na etena prrambha yatnasya prayatna iti .prayatanam eva prayatna . tat eva ca taddhitntam syam . yat samnam tat rayiyma . kim sati bhede . sati iti ha . sati eva hi bhede savarasajay bhavitavyam . kuta etat . bheddhihn hi savarasaj . yadi hi yatra sarvam samnam tatra syt savarasajvacanam anarthakam syt . yadi tarhi sati bhede kim cit samnam iti krtva savarasaj bhaviyati akrachakrayo akrahakraho sakrathakrayo savarasaj prpnoti . etem hi sarvam anyat samnam karaavarjam . evam tarhi prayatanam eva prayatna tat eva taddhitntam syam na tu ayam dvandva : syam ca prayatna ca syaprayatnam iti . kim tarhi . tripada bahuvrhi : tulya sye prayatna em iti . atha v prva tatpurua tata bahuvrhi : tulya sye tulysya , tulysya prayatna em iti . atha v para tatpurua tata bahuvrhi : sye yatna syayatna , tulya syayatna em iti . (P_1,1.9.3) KA_I,62.15-26 Ro_I,202-203 tasya . tasya iti tu vaktavyam . kim prayojanam . ya yasya tulysyaprayatna sa tasya savarasaja yath syt . anyasya tulysyaprayatna anyasya savarasaja m bht . tasya avacanam vacanaprmyt . tasya iti na vaktavyam . anyasya tulysyaprayatna anyasya savarasaja kasmt na bhavati . vacanaprmyt : savarasajvacanasmarthyt . yadi hi anyasya tulysyaprayatna sa anyasya savarasaja syt savarasajvacanam anarthakam syt . sambandhiabdai v tulyam . sambandhiabdai v puna tulyam etat . tat yath sambandhiabd : mtari vartitavyam , pitari uritavyam iti . na ca ucyate svasym mtari svasmin v pitari iti sambandht ca etat gamyate y yasya mt ya ca yasya pit iti . evam iha api tulysyaprayatnam savaram iti atra sambandiabdau etau . tatra sambandht etat gantavyam : yat prati yat tulysyaprayatnam tat prati tat savarasajam bhavati iti . (P_1,1.9.4) KA_I,62.27-63.23 Ro_I,203-207 rkralkrayo savaravidhi . rkralkrayo savarasaj vidhey . hotr , lkra , hotrlkra . kim prayojanam . aka savare drgha iti drghatvam yath syt . na etat asti prayojanam . vakyati etat . savaradrghatve rti , rrvvacanam lti , llvvacanam iti . tat savare yath syt . iha m bht : dadhi , lkra , madhu , lkra iti . yat etat savaradrghatve rti iti etat rta iti vakymi . tata lti . lti ca v ll bhavati . rta iti eva . tat na vaktavyam bhavati . avayam tat vaktavyam . kla ac hrasvardrghaplutasaja bhavati iti ucyate . na ca rrkra llkra v ac asti . rrkrasya , llkrasya ca actvam vakymi . tat ca avayam vaktavyam pluta yath syt : hotr , rkra hotrkra , hotr3kra , hotr , lkra , hotlkra , hotl3kra . kim puna atra jyya . savarasajvacanam eva jyya . drghatvam ca eva hi siddham bhavati. api ca rkragrahae lkragrahaam sannihitam bhavati . yath iha bhavati : rti aka: khava rya , mla rya idam api sagrhtam bahavati : khava , lkra, mla , lkra iti . v supi piale : uparkryati , uprkryati , idam api siddham bhavati : upalkryati, uplkryati iti . yadi tarhi
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (39 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

rkragrahae lkragrahaam sannihitam bhavati u a rapara , lkrasya api raparatvam prpnoti . lkrasya laparatvam vakymi . tat ca avayam vaktavyam asatym savarasajym vidhyartham . tat eva satym rephabdhanrtham bhaviyati . iha tarhi rabhym na a samnapade iti rkragrahaam coditam mtrm , pitrm iti evamartham . tat iha api prpnoti : klpyamnam paya iti . atha asatym api savarasajym iha kasmt na bhavati : praklpyamnam paya iti . cuutulaarvyavye na iti vakymi . apara ha : tribhi ca madhyamai vargai laasai ca vyavye na iti vakymi iti . varaikade ca varagrahaena grhyante iti ya asau lkre lakra tadraya pratiedha bhaviyati . yadi evam na artha rabhym atve rkragrahaena . varaikade ca varagrahaena grhyante iti ya asau rkre repha tadrayam atvam bhaviyati . (P_1,1.10) KA_I,63.25-65.6 Ro_I,207-211 ajjhalo pratiedhe akrapratiedha ajjhaltvt . ajjhalo pratiedhe akrasya akrea savarasajy pratiedha prpnoti . kim kraam . ajjhaltvt . ac ca eva hi akra hal ca . katham tvat actvam . ikra savaragrahaena akram api grhti iti actvam . halu upadet haltvam . tatra ka doa . tatra savaralope doa . tatra savaralope doa bhavati . paraatni kryi . jhara jhari savare iti lopa na prpnoti . siddham anactvt . siddham etat . katham . anactvt . katham anactvam . spram sparnm karaam . atspram antasthnm . vivrtam mam . at iti anuvartate . svarm vivrtam . at iti nivrttam . vkyparisampte v . vkyparisampte v siddham etat . kim idam vkyparisampte iti . varnm upadea tvat . upadeottarakl itsaj . itsajottarakla di antyena saha it iti pratyhra . pratyhrottarakl savarasaj . savarasajottaraklam a udit savarasya ca apratyaya iti savaragrahaam . etena sarvea samuditena vkyena anyatra savarnm grahaam bhavati . ca ca atra ikra akram grhti . yath eva tarhi ikra akram na grhti evam kram api na grhyt . tatra ka doa . kumr , hate kumrhate . aka savaradrghatvam na prpnoti . na ea doa . yat etat aka savare drgha iti pratyhragrahaam tata ikra kram grhti . akram na grhti . apara ha : ajjhalo pratiedhe akrapratiedha ajhaltvt . ajjhalo pratiedhe akrasya akrea savarasajy pratiedha prpnoti . kim kraam . ajjhaltvt . ac ca eva akra hal ca . katham tvat actvam . ikra savaragrahaena akram api grhti iti actvam . halu upadet haltvam . tatra ka doa . tatra savaralope doa . tatra savaralope doa bhavati . paraatni kryi . jhara jhari savare iti lopa na prpnoti . siddham anactvt . siddham etat . katham . anactvt . katham anactvam . vkyparisampte v . ukt vkyparisampti . asmin pake v iti etat asamarthitam bhavati . etat ca samarthitam . katham . astu v akrasya akrea savarasaj m v bht . nanu ca uktam : paraatni kryi . jhara jhari savare iti lopa na prpnoti iti . m bht lopa . nanu ca bheda bhavati . sati lope dviakram asati lope triakram . na asti bheda . asati api lope dviakram eva . katham . vibh dvirvacanam . evam api bheda . asati lope kad cit dviakram kad cit triakram sati lope dviakram eva . sa ea katham bheda na syt . yadi nitya lopa syt . vibh tu sa lopa . yath abheda tath astu . (P_1,1.11.1) KA_I,66.2-67.2 Ro_I,213-217 kimartham ddnm taparm pragrhyasaj

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (40 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

ucyate . tapara tatklasya iti tatklnm savarnm grahaam yath syt . kem . udttnudttasvaritnm . asti prayojanam etat . kim tarhi iti . plutnm tu pragrhyasaj na prpnoti . kim kraam . atatklatvt . na hi plut tatkl . asiddha pluta . tasysiddhatvt tatkl eva bhavanti . siddha pluta svarasandhiu . katham jyate siddha pluta svarasandhiu iti . yat ayam plutapragrhy aci iti plutasya prakrtibhvam sti . katham krtv jpakam . sata hi kryia kryea bhavitavyam . kim etasya jpane prayojanam . aplutt aplute iti etat na vaktavyam bhavati . kim ata yat siddha pluta svarasandhiu . sajvidhau asiddha . tasya asiddhatvt tatkl eva bhavanti . sajvidhau ca siddha . katham . kryaklam sajparibham . yatra kryam tatra upasthitam draavyam . pragrhya prakrty iti upasthitam idam bhavati ddet dvivacanam pragrhyam iti . kim puna plutasya pragrhyasajvacane prayojanam . pragrhyraya prakrtibhva yath syt . m bht evam . pluta prakrty iti evam bhaviyati . na evam akyam . upasthite hi doa syt . aplutavat upasthithe iti atra pahiyati hi crya : vadvacanam plutakryapratiedhrtham , plutapratiedhe hi pragrhyplutapratiedhaprasaga anyena vihitatvt iti . tasmt plutasya pragrhyasaj eitavy pragrhyraya prakrtibhva yath syt . yadi puna drghm ataparm pragrhyasaj ucyeta . evam api ekra eva eka savarn grhyt . krokrau na grhytm . kim kraam . anatvt . yadi puna hrasvnm ataparm pragrhyasaj ucyeta . na evam akyam . iha api prasajyeta : akurvahi , atra akurvahi atra iti . tasmt drghm eva taparm pragrhyasaj vaktavy . drghm ca ucyamn plutnm na prpnoti . evam tarhi kim na etena yatnena yat siddha pluta svarasandhiu iti . asiddha pluta . tasya asiddhatvt tatkl eva bhavanti iti . katham yat tat jpakam uktam plutapragrhy aci iti. plutabhv prakrty iti evam etat vijyate . katham yat tat prayojanam uktam . kriyate tat nyse eva aplutt aplute iti . evam api yat siddhe pragrhyakryam tat plutasya na prpnoti . aa apragrhyasya anunsika iti . evam tarhi kim na etena kryaklam sajparibham iti . yathoddeam eva sajparibham . tatra ca asau asiddha . tasysiddhatvt tatkl eva bhavanti . (P_1,1.11.2) KA_I,67.3-68.7 Ro_I,217-220 katham puna idam vijyate : ddaya yat dvivacanam iti hosvit ddyantam yat dvivacanam iti . ka ca atra viea . ddaya dvivacanam pragrhy iti cet antyasya vidhi . ddaya dvivacanam pragrhy iti cet antyasya pragrhyasaj vidhey . pacete* iti , pacethe* iti . vacant bhaviyati . asti vacane prayojanam . kim . khave* iti , mle* iti . astu tarhi ddyantam yat dvivacanam iti . ddyantam iti cet ekasya vidhi . ddyantam iti cet ekasya pragrhyasaj vidhey . khave* iti , mle* iti . na v dyantatvt . na v ea doa . kim kraam . dyantatvt . dyantavat ekasmin iti ekasya api bhaviyati . atha v evam vakymi : ddyantam yat dvivacanntam iti . ddyantam dvivacanntam iti cet luki pratiedha . ddyantam dvivacanntam iti cet luki pratiedha vaktavya . kumryo agram , kumryagram vadhvo agram , vadhvagram . etat hi ddyantam ca ryate dvivacanntam ca bhavati pratyayalakaena . saptamym arthagrahaam jpakam pratyayalakaapratiedhasya . yat ayam dtau ca saptamyarthe iti arthagrahaam karoti tat jpayati crya na pragrhyasajym pratyayalakaam bhavati iti . tat tarhi jpkrtham arthagrahaam kartavyam . na kartavyam . ddibhi dvivacanam vieayiyma ddiviiena ca dvivacanena tadantavidhi bhaviyati . ddyantam yat dvivacanam tadantam ddyantam iti . evam api aukle vastre ukle sampadyetm , ukl
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (41 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

stm vastre* iti atra prpnoti . atra hi ddi dvivacanam tadantam ca bhavati pratyayalakaena . atra api akrte bhve luk bhaviyati . idam iha sampradhryam . luk kriyatm bhva iti kim atra kartavyam . paratvt bhva . nitya luk . krte api bhve prpnoti akrte api prpnoti . anitya luk . anyasya krte bhve prpnoti anyasya akrte . abdntarasya ca prpnuvan vidhi anitya bhavati .bhva api anitya . na hi krte luki prpnoti . ubhayo anityayo paratvt bhva bhve krte luk . atha api katham cit nitya luk syt evam api doa . vakyati etat . padasajym antavacanam anyatra sajvidhau pratyayagrahae tadantavidhipratiedhrtham iti. idam ca api pratyayagrahaam ayam ca api sajvidhi . avayam khalu etasmin api pake dyantavadbhva eitavya . tasmt astu sa eva madhyama paka . (P_1,1.12) KA_I,68. 9-70.3 Ro_I,220-226 mt pragrhyasajym tasya asiddhatvt ayvekdeapratiedha . mt pragrhyasajym tasya ttvasya ttvasya ca asiddhatvt ayvekde prpnuvanti . tem pratiedha vaktavya . am* atra , am* sate , am* atra , am* ste . nanu ca pragrhyasajvacanasmarthyt aydaya na bhaviyanti . vacanrtha hi siddhe . na idam vacant labhyam . asti hi anyat etasya vacane prayojanam . kim . yat siddhe pragrhyasajkryam tadartham etat syt . aa apragrhyasya anunsika iti . na ekam prayojanam yogrambham prayojayati . yadi etvat prayojanam syt tatra eva ayam bryt aa apragrhyasya anunsika adasa na iti . vipratiedht v . atha v pragrhyasaj kriyatm aydaya v . pragrhyasaj bhaviyati vipratiedhena . na ea yukta vipratiedha . vipratiedhe param iti ucyate . prv ca pragrhyasaj pare aydaya . par pragrhyasaj kariyate . straviparysa krta bhavati . evam tarhi par eva pragrhyasaj . katham . kryaklam hi sajparibham . yatra kryam tatra upasthitam draavyam . pragrhya prakrty iti etat upasthitam bhavati adasa mt iti . evam api ayukta vipratiedha . katham . dvikryayoga hi vipratiedha . na ca atra eka dvikryayukta . ecm aydaya . dto pragrhyasj . na avayam dvikryayoga eva vipratiedha . kim tarhi . asambhava api . sa ca asti atra asambhava . ka asau asambhava . pragrhyasaj abhinirvartamn aydn bdhate , aydaya abhinirvartaman pragrhyasajnimittam vighnanti iti ea asambhava . sati asambhave yukta vipratiedha . evam api ayukta vipratiedha . sato hi vipratiedha bhavati . na ca atra ttvottve sta na api makra . ubhayam asiddham . rayt siddhatvam ca yath ro uttve . rayt siddhatvam bhaviyati . tat yath ru uttve rayt siddha bhavati . kim puna kraam ru uttve rayt siddha bhavati na puna yatra eva ru siddha tatra eva uttvam api ucyate . na evam akyam . asiddhe hi uttve dguprasiddhi . asiddhe hi uttve dguprasiddhi syt . vrka atra , plaka atra . tasmt tatra rayt siddhatvam eitavyam . tatra yath rayt siddham bhavati evam iha api bhaviyati . atha v pragrhyasajvacanasmarthyt aydaya de na bhaviyanti . atha v yogavibhga kariyate . adasa . adasa ddaya pragrhyasaj bhavanti . tata mt . mt ca pare ddaya pragrhyasaj bhavanti . adasa iti eva . kimartha yogavibhga . eka yat tat siddhe pragrhyakryam tadartha . apara yat asiddhe . iha api tarhi prpnoti : amuy , amuyo iti . kim ca syt yadi pragrhyasaj syt . pragrhyraya prakrtibhva prasajyeta . na ea doa . padntaprakarae prakrtibhva . na ca ea padnta . evam api amuke atra atra api prpnoti . dvivacanam iti vartate . yadi dvivacanam iti vartate am* atra iti na
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (42 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prpnoti . evam tarhi edantam iti nivrttam . atha v ha ayam adasa mt iti . na ca ttvottve sta na api makra . te evam vijsyma mrtht ddyarthnm iti . uktam v . kim uktam . adasa ttvottve svare bahipadalakae pragrhyasajym ca siddhe vaktavye iti . tatra saki doa . tatra sakakre doa bhavati . amuke atra . na v grahaavieaatvt . na v ea doa . kim kraam . grahaavieaatvt . na mdgrahaena ddyantam vieyate . kim tarhi . ddaya vieyante . mt pare ye ddaya iti . (P_1,1.13) KA_I,70.5-10 Ro_I,226-227 iha kasmt na bhavati : ke kue vae iti . e arthavadgrahat . arthavata eabdasya grahaam . na ca ayam arthavn . evam api harie babhrue iti atra prpnoti . evam tarhi lakaapratipadoktayo pratipadoktasya eva iti evam na bhaviyati . atha v puna astu arthavadgrahae na anarthakasya iti . katham harie babhrue iti . eka atra vibhaktyarthena arthavn apara taddhitrthena . samudya anarthaka . (P_1,1.14) KA_I,70.12-71.7 Ro_I,227-230 nipta iti kimartham . cakra atra , jahra atra . ekc iti kimartham . pra idam brahma , pra idam katram . ekc iti api ucyamne atra api prpnoti . ea api hi ekc . ekc iti na ayam bahuvrhi : eka ac asmin sa ayam ekc iti . kim tarhi . tatpurua ayam samndhikaraa : eka ac ekc . yadi tatpurua samndhikaraa na artha ekagrahaena . iha kasmt na bhavati : pra idam brahma , pra idam katram . ac eva ya nipta iti evam vijsyate . kim vaktavyam etat . na hi . katham anucyamnam gasyate . ajgrahaasmarthyt . yadi hi yat ca ac ca anyat ca tatra syt ajgrahaam anarthakam syt . asti anyat ajgrahaasya prayojanam . kim. ajantasya yath syt . halantasya m bht . na eva doa na prayojanam . evam api kuta etat dvayo paribhayo svakayo samavasthitayo dyantavat ekasmin iti ca yena vidhi tadantasya iti ca iyam iha paribh bhaviyati dyantavat ekasmin iti iyam na bhaviyati yena vidhi tadantasya iti . cryapravrtti jpayati iyam iha paribh bhavati dyantavat ekasmin iti iyam na bhavati yena vidhi tadantasya iti yat ayam an iti pratiedham sti . evam tarhi siddhe sati yat ajgrahae kriyame ekagrahaam karoti tat jpayati crya anyatra varagrahae jtigrahaam bhavati iti . kim etasya jpane prayojanam . dambhe halgrahaasya jtivcakatvt siddham iti yat uktam tat upapannam bhavati . an iti kimartham . , udakntt odakntt . iha kasmt na bhavati: * evam nu manyase , * evam kila tat iti . snubandhakasya grahaam ananubandhaka ca atra kra . kva puna ayam snubandhaka kva niranubandhaka . adarthe kriyyoge marydbhividhau ca ya etam tam itam vidyt vkyasmaraayo ait . (P_1,1.15.1) KA_I,71.9-13 Ro_I,230-231 kim udharaam . ho* iti , utho* iti . na etat asti prayojanam . niptasamhra ayam : ha , u : ho* iti, uta , ha , u : utho* iti . tatra nipta ekc an iti eva siddham . evam tarhi ekanipt ime . atha v pratiiddhrtha ayam rambha : o u ytam maruta , ou ytam brhat akvar ca , o cit sakhyam sakhya vavrtym . (P_1,1.15.2) KA_I,71.14-21 Ro_I,231-233 ota cvipratiedha . odanta nipta iti atra cvyantasya pratiedha vaktavya . anada , ada , abhavat : adobhavat , tirobhavat . na vaktavyam . lakaapratipadoktayo pratipadoktasya eva iti evam na bhaviyati . evam api agau gau sampadyate gobhavat : atra prpnoti . evam tarhi gauamukhyayo mukhye
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (43 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

kryasamprayaya iti . tat yath : gau anubandhya aja agnomya iti na bhka anubadhyate . katham tarhi bhke vrddhyttve bhavata : gau tithati . gm naya iti . arthraye etat evam bhavati . yat hi abdrayam abdamtre tat bhavati . abdraye ca vrddhyttve . (P_1,1.17-18.1) KA_I,71.23-72.6 Ro_I,233-234 iha kasmt na bhavati : ho* iti , utho* iti . ua iti ucyate . na ca atra uam payma . ua ayam anyena saha ekdea ugrahaena grhyate . cryapravrtti jpayati na uekdea ugrahaena grhyate iti yat ayam ot iti odantasya niptasya pragrhyasajm sti . na etat asti jpakam . uktam etat pratiiddhrtha ayam rambha . doa khalu api syt yadi uekdea ugrahaena na grhyeta : jnu , u . asya rujati jn* asya rujati jnvasya rujati . maya ua va v iti vatvam na syt . evam tarhi ekanipt ime . atha v dvau ukrau imau eka ananubandhaka apara snubandhaka . tat ya ananubandhaka tasya ea ekdea . (P_1,1.17-18.2) KA_I,72.7-13 Ro_I,234-235 ua iti yogavibhga . ua iti yogavibhga kartavya . ua kalyasya cryasya matena pragrhyasaj bhavati . u* iti v iti . tata um . ua m iti ayam dea bhavati kalyasya cryasya matena drgha anunsika pragrhyasajaka ca um iti . kimartha yogavibhga . um v kalyasya . kalyasya cryasya matena um vibh yath syt : m iti , u* iti . anyem crym matena v iti . (P_1,1.19) KA_I,72.15-73.18 Ro_I,235-238 dtau saptam iti eva . dtau saptam iti eva siddham . na artha arthagrahaena . lupte arthagrahat bhavet . luptyam saptamym pragrhyasaj na prpnoti . kva . somo gaur adhi rita . iyate ca atra api syt iti . tat ca antarea yatnam na sidhyati iti evamartham arthagrahaam . na atra saptam lupyate . kim tarhi . prvasavara atra bhavati . prvasya cet savara asau mbhva prasajyate . yadi prvasavara mbhva ca prpnoti . evam tarhi ha ayam dtau saptam iti na sa asti saptam dtau . tatra vacant bhaviyati . vacant yatra drghatvam . na idam vacant labhyam. asti hi anyat etasya vacane prayojanam . kim . yatra saptamy drghatvam ucyate : drtim na ukam saras aynam iti . sati prayojane iha na prpnoti somo gaur adhi rita iti . tatra api saras yadi . tatra api siddham . katham . yadi sarasabdasya pravrtti asti . asti ca loke sarasabdasya pravrtti . katham . dakipathe hi mahnti sarsi sarasya iti ucyante . jpakam syt tadantatve . evam tarhi jpayati crya na pragrhyasajym pratyayalakaam bhavati iti . kim etasya jpane prayojanam . kumryo agram kumryagram , vadhvo agram vadhvagram . pratyayalakaena pragrhyasaj na bhavati . m v prvapadasya bht . atha v prvapadasya m bht iti evamartham arthagrahaam : vpym ava vpyava , nadym ti nadyti . atha kriyame api arthagrahae kasmt eva atra na bhavati . jahatsvrth vrtti iti . atha ajahatsvrthym vrttau doa eva . ajahatsvrthym ca na doa . samudyrtha abhidhyate . dutau saptam iti eva lupte arthagrahat bhavet prvasya cet savara asau mbhva prasajyate vacant yatra drghatvam tatra api saras yadi jpakam syt tadantatve m v prvapadasya bht . (P_1,1.20.1) KA_I,73.20-74.22 Ro_I,239-241 ghusajym prakrtigrahaam idartham. ghusajym prakrtigrahaam kartavyam . ddhprakrtaya ghusaj bhavanti iti vaktavyam . kim prayojanam . ttvabhtnm iyam saj kriyate . s ttvabhtnm eva syt
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (44 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

anttvabhtnm na syt . nanu ca bhyithni ghusajkryi rdhadhtuke tatra ca ete ttvabht dryante . idartham . idartham prakrtigrahaam kartavyam . iti ttvam pratiidhyate tadartham : praidayate praidhayati iti . bhradvjy pahanti ghusajym prakrtigrahaam idvikrtrtham . ghusajym prakrtigrahaam kriyate . kim prayojanam . idartham vikrtrtham ca . iti udhrtam . vikrtrtham khalu api : praidt praidht . kim puna kraam na sidhyati . lakaapratipadoktayo pratipadoktasya eva iti pratipadam ye ttvabht tem eva syt . lakaena ye ttvabht tem na syt . atha kriyame api prakrtigrahae katham idam vijyate . ddh prakrtaya hosvit ddhm prakrtaya iti . kim ca ata . yadi vijyate ddh prakrtaya iti sa eva doa . ttvabhtnm eva syt anttvabhtnm na syt . atha vijyate ddhm prakrtaya iti anttvabhtnm eva syt ttvabhtnm na syt . evam tarhi na evam vijyate ddh prakrtaya iti na api ddhm prakrtaya iti . katham tarhi . ddh ghusaj bhavanti prakrtaya ca em iti . tat tarhi prakrtigrahaam kartavyam . na kartavyam . idam prakrtam arthagrahaam anuvartate . kva prakrtam . dtau ca saptamyarthe iti . tata vakymi ddh ghu adp . arthe iti . na evam akyam . dadtin samnrthn rtirsatidatimahatiprtiprabhrtn hu . etem api ghusaj prpnoti . tasmt na evam akyam . na cet evam prakrtigrahaam kartavyam . idarthena tvat na artha prakrtigrahaena . avayam tatra mrtham prakrtigrahaam kartavyam praimayate prayamayata iti evamartham . tat purastt apakrakyate : ghuprakrtau mprakrtau ca iti . yadi prakrtigrahaam kriyate praniminoti pranimnti atra api prpnoti . atha akriyame api prakrtigrahae iha kasmt na bhavati : pranimt pranimtum iti . krntasya ita grahaam vijsyate . yath eva tarhi akriyame prakrtigrahae krntasya ita grahaam vijyate evam kriyame api prakrtigrahae krntasya ita grahaam vijsyate . vikrtrthena ca api na artha . doa eva etasy paribhy lakaapratipadoktayo pratipadoktasya eva iti gmdgrahaeu aviea iti . (P_1,1.20.2) KA_I,74.23-75.14 Ro_I,242-244 samnaabdapratiedha . samnaabdnm pratiedha vaktavya : pranidrayati pranidhrayati . ddh ghusaj bhavanti iti ghusaj prpnoti . samnaabdpratiedha arthavadgrahat . samnaabdnm apratiedha . anarthaka pratiedha apratiedha . ghusaj kasmt na bhavati . arthavadgrahat . arthavato ddho grahaam . na ca etau arthavantau . anupasargt v . atha v yatkriyyukts prdaya tam prati gatyupasargasaje bhavata . na ca etau ddhau prati kriyyoga . yadi evam iha api tarhi na prpnoti praidpayati praidhpayati . atra api na etau ddhau arthavantau na api etau ddhau prati kriyyoga . na v arthavata hi gama tadgubhta tadgrahaena grhyate yath anyatra . na v ea doa . kim kraam . arthavata gama tadgubhta arthavadgrahaena grhyate yath anyatra . tat yath . anyatra api arthavata gama arthavadgrahaena grhyate . kva anyatra . lavit cikrit iti . yuktam puna yat nityeu nma abdeu gamasanam syt na nityeu abdeu kasthai aviclibhi varai bhavitavyam anapyopajanavikribhi . gama ca nma aprva abdopajana . atha yuktam yat nityeu abdeu de syu . bham yuktam . abdntarai iha bhavitavyam . tatra abdntart abdntarasya pratipatti yukt . de tarhi ime bhaviyanti angamaknm sgamak . tat katham . sarve sarvapadde dkputrasya pine ekadeavikre hi nityatvam na upapadyate .

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (45 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(P_1,1.20.3) KA_I,75.15-23 Ro_I,245-246 da pratiedha sthghvo ittve . da pratiedha sthghvo ittve vaktavya . updsta asya svara ikakasya iti . mntiminoti iti ttve krte sthghvo it ca iti ittvam prpnoti . kuta puna ayam doa jyate . kim prakrtigrahat hosvit rpagrahat . rpagrahat iti ha . iha khalu prakrtigrahat doa jyate : upadidate . sani mmghurabhalabha iti . na ea doa . dprakrti iti ucyate . na ca iyam dprakrti . krntnm ejant prakrtaya ejantnm api krnt . na ca prakrtiprakrti prakrtigrahaena grhyate . sa tarhi pratiedha vaktavya . na vaktavya . ghusaj kasmt na bhavati . sanniptalakaa vidhi animittam tadvightasya iti evam na bhaviyati . (P_1,1.20.4) KA_I,75.24-76.14 Ro_I,246-247 dppratiedhe na daipi anejantatvt . dppratiedhe daipi pratiedha na prpnoti : avadtam mukham . nanu ca ttve krte bhaviyati . tat hi ttvam na prpnoti . kim kraam . anejantatvt . siddham anubandhasya anekntatvt . siddham etat . katham . anubandhasya anekntatvt . aneknt anubandh . pitpratiedht v . atha v ddh ghu apit iti vakymi . tat ca avayam vaktavyam . adp iti hi ucyamne iha api prasajyeta : praidpayati iti . akyam tvat anena adp iti bruvat bntasya pratiedha vijtum . stram tarhi bhidyate . yathnysam eva astu . nanu ca uktam dappratiedhe na daipi iti . parihrtam etat siddham anubandhasya anekntatvt iti . atha eknteu doa eva . eknteu ca na doa . ttve krte bhaviyati . nanu ca uktam tat hi ttvam na prpnoti . kim kraam . anejantatvt iti . pakralope krte bhaviyati . na hi ayam tad dp bhavati . bhtaprvagaty bhaviyati . etat ca atra yuktam yat sarveu eva snubandhakagrahaeu bhtaprvagati vijyate . anaimittika hi anubandhalopa tvati eva bhavati . atha v cryapravrtti jpayati na anubandhakrtam anejantatvam iti yat ayam udcm ma vyathre iti mea snubandhakasya ttvabhtasya grahaam karoti . atha v dp eva ayam na daip asti . katham avadyayati iti . yan vikaraa bhaviyati . (P_1,1.21.1) KA_I,76.16-78.2 Ro_I,247-252 kimartham idam ucyate . sati anyasmin dyantavadbhvt ekasmin dyantavadvacanam . sati anyasmin yasmt prvam na asti param asti sa di iti ucyate . sati anyasmin yasmt param na asti prvam asti sa anta iti ucyate . sati anyasmin dyantavadbhvt etasmt krat ekasmin dyantpadini kryi na sidhyanti . iyante ca syu iti . tni antarea yatnam na sidhyanti iti ekasmin dyantavadvacanam . evamartham idam ucyate . asti prayojanam etat . kim tarhi iti . tatra vyapadeivadvacanam . tatra vyapadeivadbhva vaktavya . vyapadeivat ekasmin kryam bhavati iti vaktavyam . kim prayojanam . ekca dve prathamrtham . vakyati ekca dve prathamasya iti bahuvrhinirdea iti . tasmin kriyame iha eva : syt papca papha . iyya , ra iti atra na syt . vyapdeivat ekasmin kryam bhavati iti atra api siddham bhavati . atve ca deasampratyayrtham . vakyati deapratyayayo iti avayavaah eva iti . etasmin kriyame iha eva syt : kariyati hariyati . iha na syt : indra m vakat , sa devan yakat . vyapdeivat ekasmin kryam bhavati iti atra api siddham bhavati . sa tarhi vyapadeivadbhva vaktavya . na vaktavya . avacant lokavijnt siddham . antarea eva vacanam lokavijnt siddham etat . tat yath : loke lsamudya grma iti ucyate . bhavati ca etat ekasmin api ekala grma iti . viama upanysa . grmaabda ayam bahvartha . asti eva lsamudye vartate . tat yath grma dagdha iti . asti vaparikepe
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (46 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

vartate . tat yath grmam pravia . asti manuyeu vartate . tat yath . grma gata , grma gata iti . asti srayake sasmake sasthailake vartate . tat yath grma labdha iti . tat ya srayake sasmake sasthailake vartate tam abhisamkya etat prayujyate : ekala grma iti . yath tarhi varasamudya padam padasamudya rk rksamudya sktam iti ucyate . bhavati ca etat ekasmin api ekavaram padam ekapad rk ekarcam sktam iti . atra api arthena yukta vyapadea . padam nma artha sktam nama artha . yath tarhi bahuu putreu etat upapannam : bhavati ayam me jyeha ayam eva me madhyama ayam eva me kanyn iti . bhavati ca etat ekasmin api ayam eva me jyeha ayam me madhyama ayam me kanyn iti . tath astym asoyamym ca bhavati prathamagarbhea hat iti . tath anetya anjigamiu ha idam me prathamam gamanam iti . dyantavadbhva ca akya avaktum . katham . aprvnuttaralakaatvt dyantayo siddham ekasmin . aprvalakaa di anuttaralakaa anta . etat ca ekasmin api bhavati . aprvnuttaralakaatvt etasmt krat ekasmin api dyantpadiani kryi bhaviyanti . na artha dyantavadbhvena . gonardya tu ha satyam etat sati tu anyasmin iti . (P_1,1.21.2) KA_I,78.3-79.10 Ro_I,252-254 kni puna asya yogasya prayojanni . divattve prayojanam pratyayaniddyudttatve . pratyayasya di udtta bhavati iti iha eva syt : kartavyam , taittirya . aupagava , kpaava iti atra na syt . niti di nityam iti iha eva syt : ahicumbakyani , agniveya . gargya , krti iti atra na syt . valde rdhadhtukasya i . valde rdhadhtukasya i prayojanam . rdhadhtukasya i valde iha eva : syt kariyati hariyati . joiat , manidat iti atra na syt . yasmin vidhi tadditve . yasmin vidhi tadditve prayojanam . vakyati yasmin vidhi taddau algrahae iti . tasmin kriyame aci nudhtubhruvm yvo iyauvaau iha eva syt : riya , bhruva . riyau bhruvau iti atra na syt . ajdytve . ajdytve prayojanam . ajdnm iha eva syt : aihia , aikia . ait , adhyaia iti atra na syt . atha antavattve kni prayojanni . antavat dvivacanntapragrhyatve . antavat dvivacanntapragrhyatve prayojanam . ddet dvivacanam pragrhyam iha eva syt : pacete* iti pacethe* iti . khave* iti mle* iti iti atra na syt . mit aca antyt para . mit aca antyt para prayojanam . iha eva syt : kuni vanni . tni yni iti atra na syt . aca antydi i . aca antydi i prayojanam . ita tmanepadnm e e iti iha eva syt : kurvte kurvthe . kurute kurve iti atra na syt . ala antyasya . ala antyasya prayojanam . ata drgha yai supi ca iha eva syt : ghabhyam , pabhym . bhym iti atra na syt . yena vidi tadantatve . yena vidi tadantatve prayojanam . aca yat iha eva syt : ceyam , jeyam . eyam adhyeyam iti atra na syt . dyantavat ekasmin kryam bhavati iti atra api siddham bhavati . (P_1,1.22) KA_I,79.12-80.2 Ro_I,255-256 ghasajym nadtare pratiedha . ghasajym nadtare pratiedha vaktavya . nady tara nadtara iti . ghasajym nadtare apratiedha . anarthaka pratiedha apratiedha . ghasaj kasmt na bhavati . tarabgrahaam hi aupadeikam . aupadeikasya tarapa grahaam . na ca ea upadee tarapabda . kim vaktavyam etat . na hi . katham anucyamnam gasyate . iha hi vykarae sarveu eva snubandhakeu grahaeu rpam ryate : yatra etat rpam iti . rpanirgraha ca na antarea laukikam prayogam . tasmin ca laukike prayoge snubandhaknm prayoga
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (47 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

na asti iti krtv dvitya prayoga upsyate . ka asau . upadea nma . na ca ea upadee tarapabda . atha v astu asya ghasaj . ka doa . ghdiu nady hrasva bhavati iti hrasvatvam prasajyeta . samndhikaraeu ghdiu iti evam tat . yad tarhi s eva nad sa eva tara tad prpnoti . strligeu eva ghdiu iti evam tat . avayam ca etat evam vijeyam . samndhikaraeu ghdiu iti ucyamne iha prasajyeta mahi rpam iva brhma rpam iva . (P_1,1.23.1) KA_I,80.4-82.9 Ro_I,256-263 sakhysajym sakhygrahaam . sakhysajym sakhygrahaam kartavyam . bahugavatuataya sakhysaj bhavanti . sakhy ca sakhysaj bhavati iti vaktavvyam . kim prayojanam . sakhysampratyayrtham . ekdiky sakhyy sakhypradeeu sakhy iti ea sampratyaya yath syt . nanu ca ekdik sakhy loke sakhy iti pratt . tena asy sakhypradeeu sakhysampratyaya bhaviyati . evam api kartavyam . itarath hi asampratyaya akrtrimatvt yath loke . akriyame hi sakhygrahae ekdiky sakhyy sakhy iti sampratyaya na syt . kim kraam . akrtrimatvt . bahvdnm krtrim saj . krtrimkrtrimayo krtrime kryasampratyaya bhavati yath loke . tat yath loke goplakam naya kaajakam naya iti yasya e saj bhavati sa nyate na ya g playati ya v kae jta . yadi tarhi krtrimkrtrimayo krtrime sampratyaya bhavati nadpauramsygrahyabhya iti atra api prasajyeta . pauramsygrahyagrahaasmarthyt na bhaviyati . tadvieebhya tarhi prpnoti : gag yamun iti . evam tarhi cryapravrtti jpayati na tadvieebhya bhavati iti yat ayam vipabdam aratprabhrtiu pahati . iha tarhi prpnoti : nadbhi ca iti . bahuvacananirdet na bhaviyati . svarpavidhi tarhi prpnoti . bahuvacananirdet eva na bhaviyati . evam na ca idam akrtam bhavati krtrimkrtrimayo krtrime sampratyaya iti na ca ka cit doa . uttarrtham ca . uttarrtham ca sakhygrahaam kartavyam . nt a . akranakrnty sakhyy asaj yath syt . iha m bht : pmna , viprua iti . ihrthena tvat na artha sakhygrahaena . nanu ca uktam itarath hi asampratyaya akrtrimatvt yath loke iti . na ea doa . artht prakarat v loke krtrimkrtrimayo krtrime sampratyaya bhavati . artha v asya evasajakena bhavati prakrtam v tatra bhavati idam evasajakena kartavyam iti. ta ca artht prakarat v . aga hi bhavn grmyam psurapdam aprakaraajam gatam bravtu goplakam naya kaajakam naya iti . ubhayagati tasya bhavati sdhya v yaihastam gamiyati . yath eva tarhi artht prakarat v loke krtrimkrtrimayo krtrime sampratyaya bhavati evam iha api prpnoti . jnti hi asau bahvdnm iyam saj krt iti . na yath loke tath vykarae . ubhayagati puna iha bhavati . anyatra api na avayam iha eva . tat yath : kartu psitatamam karma iti krtrim saj . karmapradeeu ca ubhayagati bhavati . karmai dvity iti krtrimasya grahaam kartari karmavyatihre iti akrtrimasya . tath sdhakatamam karaam iti krtrim karaasaj . karaapradeeu ca ubhayagati bhavati . kartrkaraayo trty iti krtrimasya grahaam abdavairakalahbhrakavameghebhya karae iti akrtrimasya . tath dhra adhikaraam iti krtrim adhikaraasaj . adhikaraepradeeu ca ubhayagati bhavati . saptam adhikarae ca iti krtrimasya grahaam vipratiiddham ca anadhikaraavci iti akrtrimasya . atha v na idam sajkaraam . tadvadatidea ayam : bahugaavatuataya sakhyvat bhavanti iti . sa tarhi vatinirdea kartavya . na hi antarea vatim atidea
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (48 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

gamyate . antarea api vatim atidea gamyate . tat yath : ea brahmadatta . abrahmadattam brahmadatta iti ha . te manymahe : brahmadattavat ayam bhavati iti . evam iha api asakhym sakhy iti ha . sakhyvat iti gamyate . atha v cryapravrtti jpayati bhavati ekdiky sakhyy sakhypradeeu sakhysampratyaya iti yat ayam sakhyy atiadanty kan iti tiadanty pratiedham sti . katham krtv jpakam . na hi krtrim tyant adant v sakhy asti . nanu ca iyam asti ati . yat tarhi adanty pratiedham sti . yat ca api tyanty pratiedham sti . nanu ca uktam atyartham etat syt iti . arthavadgrahae na anarthakasya iti arthavata tiabdasya grahaam . na ca ate tiabda arthavn. atha v mahat iyam saj kriyate . saj ca nma yata na laghya . kuta etat . laghvartham hi sajkaraam . tatra mahaty sajy karae etat prayojanam anvarthasaj yatha vijyeta . sakhyyate anay sakhy iti . ekdikay ca api sakhyyate . uttarrthena ca api na artha sakhygrahaena . idam prakrtam anuvartiyate . idam vai sajrtham uttaratra ca sajivieartha . na ca anyrtham prakrtam anyrtham bhavati . na khalu api anyat prakrtam anuvartant anyat bhavati . na hi godh sarpant sarpat ahi bhavati . yat tvat ucyate na ca anyrtham prakrtam anyrtham bhavati iti anyrtham api prakrtam anyrtham bhavati . tat yath : lyartham kuly prayante tbhya ca pyam pyate upapryate ca laya ca bhvyante . yad api ucyate na khalu api anyat prakrtam anuvartant anyat bhavati . na hi godh sarpant sarpat ahi bhavati iti . bhavet dravyeu etat evam syt . abda tu khalu yena yena vieea abhisambadhyate tasya tasya vieaka bhavati . atha v speka ayam nirdea kriyate na ca anyat kim cit apekyam asti . te sakhym eva apekiymahe . (P_1,1.23.2) KA_I,82.10-83.8 Ro_I,263-265 adhyardhagrahaam ca samsakanvidhyartham . adhyardhagrahaam ca kartavyam . kim prayojanam . samsakanvidhyartham . samsavidhyartham kandvidhyartham ca . samsavidhyartham tvat : adhyardharpam . kanvidhyartham : adhyardhakam . luki ca agrahaam . luki ca adhyardhagrahaam na kartavyam bhavati : adhyardhaprvadvigo luk asajym iti . dvigo iti eva siddham . ardhaprvapada ca praapratyaynta . ardhaprvapada ca praapratyaynta sakhysaja bhavati iti vaktavyam . kim prayojanam . samsakanvidhyartham . samsavidhyartham kandvidhyartham ca . samsavidhyartham tvat : ardhapacamarpam . kanvidhyartham : ardhapacamakam . adhikagrahaam ca aluki samsottarapadavrddhyartham . adhikagrahaam ca aluki kartavyam . kim prayojanam . samsottarapadavrddhyartham . samsavrddhyartham uttaravrddhyartam ca . samsavrddhyartham tvat : adhikahika , adhikasptatika . uttarapadavrddhyartham adhikahika , adhikasptatika . aluki iti kim artham . adhikahika , adhikasptatika . bahuvrhau ca agrahaam . bahuvrhau ca adhikaabdasya grahaam na kartavyam bhavati : sakhyay avyaysanndrdhikasakhy sakhyeye iti . sakhy iti eva siddham . bahvdnm agrahaam . bahvdnm grahaam akyam akartum . kena idnm sakhypradeeu sakhyasampratyaya bhaviyati . jpakt siddham . kim jpakam . yat ayam vato i v iti sakhyy vihitasya kana vatvantt iam sti . vato eva tat jpakam syt . na iti ha . yogpekam jpakam . (P_1,1.24) KA_I,83.10-84.7 Ro_I,265-269 asajym upadeavacanam . asajym

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (49 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

upadeagrahaam kartavyam . upadee akranakrnt sakhy asaj bhavati iti vaktavyam . kim prayojanam . atdyaano numnuartham . atni sahasri . numi krte nt a iti asaj prpnoti . upadeagrahat na bhavati . anm iti atra tve krte asaj na prpnoti . upadeagrahat bhavati . uktam v . kim uktam . iha tvat atni sahasri iti . sanniptalakaa vidhi animittam tadvightasya iti . aana api uktam . kim uktam . aana drghagrahaam asajjpakam krntasya nuartham iti . atha v kra api atra nirdiyate . akrnt nakrnt krnt ca sakhy asaj bhavati iti . iha api tarhi prpnoti : sadhamadha dyumna ek ta ek iti . na ea doa . ekaabda ayam bahvartha . asti eva sakhypadam . tat yath : eka , dvau , bahava iti . asti asahyavc . tat yath : ekgnaya , ekahalni , ekkibhi kudrakai jitam iti . asahyai iti artha . asti anyrthe vartate . tat yath : prajam ek rakati urjam ek iti . any iti artha . sadhamada dyumna ek ta . any iti artha . tat ya anyrthe vartate tasya ea prayoga . iha tarhi prpnoti : dvabhym iaye viatya ca iti . evam tarhi saptame yogavibhga kariyate . abhya au . tata abhya : abhya ca yat uktam abhya api tat bhavati . tata luk : luk ca bhavati abhya iti . atha v uparit yogavibhga kariyate . aana vibhaktau . tata rya : rya ca vibhaktau krdea bhavati . hali iti ubhayo ea . yadi evam priyau priy iti na sidhyati priynau priyna iti ca prpnoti . yathlakaam aprayukte . (P_1,1.25) KA_I,84.9-12 Ro_I,269 idam atigrahaam dvi kriyate sakhysajym asajym ca . ekam akyam akartum . katham . yadi tvat sakhysajym kriyate asajym na kariyate . katham . nt a iti atra ati iti anuvartiyate . atha asajym kriyate sakhysajym na kariyate . ati ca iti atra sakhysaj anuvartiyate . (P_1,1.26) KA_I,84.14-85.17 Ro_I,270-272 nihsajym samnaabdapratiedha . nihsajym samnaabdnm pratiedha kartavya . lota garta iti . nihsajym samnaabdpratiedha . nihsajym samnaabdapratiedha . anarthaka pratiedha apratiedha . nihsaj kasmt na bhavati . anubandha anyatvakara . anubandha kriyate . sa anyatvam kariyati . anubandha anyatvakara iti cet na lopt . anubandha anyatvakara iti cet tat na . kim kraam . lopt . lupyate atra anubandha . lupte atra anubandhe na anyatvam bhaviyati . tat yath : katarat devadattasya grham . ada yatra asau kka iti . utpatite kke naam tat grham bhavati . evam iha api lupte anubandhe naa pratyaya bhavati . yadi api lupyate jnti tu asau snubandhakasya iyam saj krt iti . tat yath itaratra api : katarat devadattasya grham . ada yatra asau kka iti . utpatite kke yadi api naam tat grham bhavati antata tam uddeam jnti . siddhaviparysa ca . siddha ca viparysa . yadi api jnti sandeha tasya bhavati : ayam sa taabda lota garta iti ayam sa taabda lna gra iti . tat yath itaratra api : katarat devadattasya grham . ada yatra asau kka iti . utpatite kke yadi api naam tat grham bhavati antata tam uddeam jnti . sandeha tu tasya bhavati : idam tat grham idam tat grham iti . evam tarhi . krakaklaviet siddham . krakaklavieau updeyau . bhte ya taabda kartari karmai bhve ca iti . tat yath itaratra api . ya ea manuya prekprvakr bhavati sa adhruvea nimittena dhruvam nimittam updatte vedikm puarkam v . evam api prkra iti atra prpnoti . lui
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (50 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

sijdidarant . lui sijdidarant na bhaviyati . yatra tarhi sijdaya na dryante prbhitta iti . dryante atra api sijdaya . kim vaktavyam etat . na hi . katham anucyamnam gasyate . yath eva ayam anupadin krakaklavien avagacchati evam etat api avagantum arhati : yatra sijdaya na iti . (P_1,1.27.1) KA_I,86.2-8 Ro_I,273-274 sarvdni iti ka ayam samsa . bahuvrhi iti ha . ka asya vigraha . sarvaabda di yem tni imni iti . yadi evam sarvaabdasya sarvanmasaj na prpnoti . kim kraam . anyapadrthatvt bahuvrhe . bahuvrhi ayam anyapadrthe vartate . tena yat anyat sarvaabdt tasya sarvanmasj prpnoti . tat yath citragu nyatm iti ukte yasya t gva bhavanti sa nyate na gva . na ea doa . bhavati bahuvrhau tadguasavijnam api . tat yath : citravsam naya . lohito rtvija pracaranti . tadgua nyate tadgu ca pracaranti . (P_1,1.27.2) KA_I,86.9-87.6 Ro_I,274-277 iha sarvanmni iti prvapadt sajym aga iti atvam prpnoti . tasya pratiedha vaktavya . sarvanmasajym niptant atvbhva . sarvanmasajym niptant atvam na bhaviyati . kim etat niptanam nma . atha ka pratiedha nma . avieea kim cit uktv vieea na iti ucyate . tatra vyaktam cryasya abhiprya gamyate : idam na bhavati iti . niptanam api evajtyakam eva . avieea atvam uktv vieea niptanam kriyate . tatra vyaktam cryasya abhiprya gamyate : idam na bhavati iti . nanu ca niptant ca aatvam syt yathprptam ca atvam . kim anye api evam vidhaya bhavanti . iha ika ya aci iti vacant ca ya syt yathprpta ca ik ryeta . na ea doa . asti atra viea . ahy atra nirdea kriyate . ah ca puna sthninam nivartayati . iha tarhi : kartari ap divdibhya yan iti vacant ca yan syt yathprpta ca ap ryeta . na ea doa . abde yandaya kariyante . tat tarhi apa grahaam kartavyam . na kartavyam . prakrtam anuvartate . kva prakrtam . kartari ap iti . tat vai prathamnirdiam ahnirdiena ca iha artha . divdibhya iti e pacam ap iti prathamy ahm prakalpayiyati : tasmt iti uttarasya . pratyayavidhi ayam . na ca pratyayavidhau pacamya prakalpik bhavanti . na ayam pratyayavidhi . vihita pratyaya prakrta ca anuvartate . iha tarhi : avyayasarvanmnm akac prk e iti . vacant ca akac syt yathprpta ca ka ryeta . na ea doa . na aprpte hi ke akac rabhyate . sa bdhaka bhaviyati . niptanam api evajtyakam eva . na aprpte atve niptanam rabhyate . tat bdhakam bhaviyati . yadi tarhi niptanni api evajtyakni bhavanti sama tate doa bhavati . iha anye vaiykara sama tate vibh lopam rabhante : sama hi tatayo v iti . satatam , santatam , sahitam , sahitam iti . iha puna bhavn niptant ca malopam icchati aparaspar kriystatye iti yathprptam ca alopam santatam iti . etat na sidhyati . kartavya atra yatna . bdhakni eva hi niptanni bhavanti . (P_1,1.27.3) KA_I,87.7-89.3 Ro_I,278-285 sajopasarjanapratiedha . sajopasarjanbhtnm sarvdnm pratiedha vaktavya . sarva nma ka cit . tasmai sarvya dehi . atisarvya dehi . sa katham kartavya . pht paryudsa pahitnm sajkaraam . pht eva paryudsa kartavya . uddhnm pahitnm saj kartavy . sarvdni sarvanmasajni bhavanti . sajopasarjanbhtni na sarvdni . kim avieea . na iti ha . vieea ca . kim prayojanam . sarvdynantaryakryrtham . sarvdnm nantaryea yat ucyate kryam tat api sajopasarjanbhtnm m bht iti . kim
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (51 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prayojanam . prayojanam atardnm adbhve . atardnm adbhve prayojanam . atikrntam idam brhmaakulam katarat , atikataram brhmaakulam iti . tyaddividhau ca . tyaddividhau ca prayojanam . atikrnta ayam brhmaa tam atitat brhmaa iti . sajpratiedha tvat na vaktavya . uparit yogavibhga kariyate . prvaparvaradakiottarpardhari vyavasthym . tata asajym iti . sarvdni iti evam yni anukrntni asajym tni draavyni . upasarjanapratiedha ca na kartavya . anupasarjant iti ea yoga pratykhyyate . tam evam abhisambhantsyma : anupasarjana* a* at iti . kim idam a* at iti . akrtkrau iyamau anupasarjanasya draavyau . yadi evam atiyumat atyasmat iti na sidhyati . pralianirdea ayam : anupasarjana* a* a* at iti . akrntt akrtkrau iyamau anupasarjanasya draavyau . atha v agdhikre yat ucyate grhyamavibhakte tat bhavati . yadi evam paramapaca paramasapta abhya luk iti luk na prpnoti . na ea doa . apradhna ea samsa . iha tarhi priyasakthn brhmaena ana na prpnoti . saptamnirdie yat ucyate prakrtavibhaktau tat bhavati . yadi evam atitat , atitadau , atitada iti atvam prpnoti . tat ca api vaktavyam . na vaktavyam . iha tvat ad atardibhya pacabhya iti pacam agasya iti ah . tatra aakyam vivibhaktitvt atardibhya iti pacamy agam vieayitum . tatra kim anyat akyam vieayitum anyat ata vihitt pratyayt . atardibhya ya vihita iti . iha idnm asthidadhisakhthyakm ana udtta iti tyaddnm a bhavati iti asthydnm iti e ah agasya iti api tyaddnm iti api ah agasya iti api . tatra kmacra : grhyamena v vibhaktim vieayitum agena v . yvat kmacra iha tvat asthidadhisakhthyakm ana udtta iti agena vibhaktim vieayiyma asthydibhi anaam : agasya vibhaktau ana bhavati asthydnm iti . iha idnm tyaddnm a bhavati iti grhyamena vibhaktim vieayiyma agena akram : tyaddnm vibhaktau a bhavati agasya iti . yadi evam atisa : atvam na prpnoti . na ea doa . tyaddipradhna ea samsa . atha v na idam sajkaraam . phavieaam idam : sarvem yni nmni tni sarvdni . sajopasarjane ca viee avatihete . yadi evam sajrayam yat kryam tat na sidhyati : sarvanmna smai , mi sarvanmna su iti . anvarthagrahaam tatra vijsyate : sarvem yat nma tat sarvanma . sarvanmna uttarasya e smai bhavati . sarvanmna uttarasya ma su bhavati . yadi evam sakalam , krtsnam , jagat iti atra api prpnoti . etem ca api abdnm ekaikasya sa sa viaya . tasmin tasmin viaye ya ya abda vartate tasya tasya tasmin tasmin vartamnasya sarvanmakryam prpnoti . evam tarhi ubhayam anena kriyate . pha ca eva vieyate saj ca . katham puna ekena yatnena ubhayam labhyam . labhyam iti ha . katham. ekaeanirdet . ekaeanirdea ayam : sarvdni ca sarvdni ca sarvdni . sarvanmni ca sarvanmni ca sarvanmni . sarvdni sarvannasajni bhavanti . sarvem yni ca nmni tni sarvdni . sajopasarjane ca viee avatihete . atha v mahat iyam saj kriyate . saj ca nma yata na laghya . kuta etat . laghvartham hi sajkaraam . tatra mahaty sajy karae etat prayojanam anvarthasaj yath vijyeta . sarvdni sarvannasajni bhavanti sarvem nmni iti ca ata sarvanmni . sajopasarjane ca viee avatihete . (P_1,1.27.4) KA_I,89.4-90.3 Ro_I,286-289 atha ubhasya sarvanmatve ka artha . ubhasya sarvanmatve akajartha . ubhasya sarvanmatve akajartha pha kriyate : ubhakau . kim ucyate akajartha iti na puna anyni api sarvanmakryi . anybhva
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (52 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

dvivacanabviayatvt . anyem sarvanmkrym abhva . kim kraam . dvivacanabviayatvt . ubhaabda ayam dvivacanabviaya . anyni ca sarvanmakryi ekavacanabahuvacaneu ucyante . yad puna ayam ubhaabda dvivacanabviaya ka idnm asya anyatra bhavati . ubhaya anyatra . ubhayaabda asya anyatra bahvati . ubhaye devamanuy , ubhaya mai iti . kim ca syt yadi atra akac na syt . ka prasajyeta . ka ca idnm kkaco viea . ubhaabda ayam dvivacanabviaya iti uktam . tatra akaci sati akaca tanmadhyapatitatvt akyate etat vaktum : dvivacanapara ayam iti . ke puna sati na ayam dvivacanapara syt . tatra dvivacanaparat vaktavy . yath eva tarhi ke sati na ayam dvivacanapara evam pi api sati na ayam dvivacanapara syt . tatra api dvivacanaparat vaktavy . avacant api tatparavijnam . antarea api vacanam pi dvivacanapara ayam bhaviyati . kim vaktavyam etat . na hi . katham anucyamnam gasyate . ekdee krte dvivacanapara ayam antdivadbhvena . avacant pi tatparavijnam iti cet ke api tulyam . avacant pi tatparavijnam iti cet ke api antarea vacanam dvivacanapara bhaviyati . katham . svrthik pratyay prakrtita avii bhavanti iti prakrtigrahaena svrthiknm api grahaam bhavati . atha bhavata sarvanmatve kni projanni . bhavata akacchetvni . bhavata akacchetvni prayojanni . akac : bhavakn . ea : sa ca bhavn ca bhavantau . tvam : bhavdrk iti . kim puna idam parigaanam hosvit udharaamtram . udharaamtram iti ha . trtydaya api hi iyante . sarvanmna trty ca : bhavat hetun , bhavata heto iti . (P_1,1.28) KA_I,90.5-26 Ro_I,289-291 diggrahaam kimartham . na bahuvrhau iti pratiedham vakyati . tatra na jyate kva vibh kva pratiedha iti . diggrahae puna kriyame na doa bhavati . digupadie vibh anyatra pratiedha . atha samsagrahaam kimartham. samsa eva ya bahuvrhi tatra yath syt . bahuvrhivadbhvena ya bahuvrhi tatra m bht iti : dakiadakiasyai dehi iti . atha bahuvrhigrahaam kimartham . dvandve m bht dakiottaraprvm iti . na etat asti prayojanam . dvandve ca iti pratiedha bhaviyati . na aprpte pratiedhe iyam paribh rabhyate . s yath eva bahuvrhau iti etam pratiedham bdhate evam dvandve ca iti etam api bdheta . na bdhate . kim kraam . yena na aprpte tasya bdhanam bhavati . na ca aprpte na bahuvrhau iti etasmin pratiedhe iyam paribh rabhyate . dvandve ca iti etasmin puna prpte ca aprpte ca . atha v purastt apavd anantarn vidhn bdhante iti evam iyam vibh na bahuvrhau iti etam pratiedham bdhiyate dvandve ca iti etam pratiedham na bdhiyate . atha v idam tvat ayam praavya . iha kasmt na bhavati : y prv s uttar asya unmugdhasya sa ayam prvottara unmugdha , tasmai prvottarya dehi . lakaapratipadoktayo pratipadoktasya eva iti . yadi evam na artha bahuvrhigrahaena . dvandve kasmt na bhavati . lakaapratipadoktayo pratipadoktasya eva iti . uttarrtham tarhi bahuvrhigrahaam kartavyam . na kartavyam . kriyate tatra eva bahuvrhau iti . dvityam kartavyam . bahuvrhi eva ya bahuvrhi tatra yath syt . bahuvrhivadbhvena ya bahuvrhi tatra m bht iti : ekaikasmai dehi . etat api na asti prayojanam. samse iti vartate . tena bahuvrhim vieayiyma : samsa ya bahuvrhi iti . idam tarhi prayojanam . avayavabhtasya api bahuvrhe pratiedha yath syt . iha m bht vastram antaram em te ime vastrntar vasanam antaram em te ime vasanntar
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (53 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

vastrntar ca vasanntar ca vastrntaravasanntar . (P_1,1.29.1) KA_I,91.2-21 Ro_I,291-293 kim udharaam . priyavivya . na etat asti prayojanam . sarvdyantasya bahuvrhe pratiedhena bhavitavyam . vakyati ca etat : bahuvrhau sarvanmasakhyayo upasakhynam iti . tatra vivapriyya iti bhavitavyam . idam tarhi : dvyanyya tryanyya . nanu ca atra api sarvanmna eva prvaniptena bhavitavyam . na ea doa . vakyati etat : sakhysarvanmno ya bahuvrhi paratvt tatra sakhyy prvanipta bhavati iti . idam ca api udharaam priyavivya . nanu ca uktam vivapriyya iti bhavitavyam iti . vakyati etat : v priyasya iti . na khalu api avayam sarvdyantasya eva bahuvrhe pratiedhena bhavitavyam . kim tarhi . asarvdyantasya api bhavitavyam . kim prayojanam . akac m bht . kim ca syt yadi akac syt . ka na syt . ka ca idnm kkaco viea . vyajannteu viea . ahakam pit asya makatpitrka , tvakam pit asya tvakatpitrka iti prpnoti , matkapitrka tvatkapitrka iti ca iyate . katham puna icchat api bhavat bahiragena pratiedhena antaraga vidhi akhya bdhitum . antaragn api vidhn bahiraga vidhi bdhate gomatpriya iti yath . kriyate tatra yatna : pratyayottarapadayo ca iti . nanu ca iha api kriyate : na bahuvrhau iti . asti anyat etasya vacane prayojanam . kim . priyavivya . upasarjanapratiedhena api etat siddham . ayam khalu api bahuvrhi asti eva prthamakalpika yasmin aikapadyam aikasvaryam aikavibhaktikatvam ca . asti tdarthyt tcchabdyam : bahuvrhyarthni padni bahuvrhi iti . tat yat tdarthyt tcchabdyam tasya idam grahaam . gonardya ha akacsvarau tu kartavyau pratyagam muktasaayau . tvakatpitrka makatpitrka iti eva bhavitavyam iti . (P_1,1.29.2) KA_I,91.22-92.5 Ro_I,293-294 pratiedhe bhtaprvasya upasakhynam . pratiedhe bhtaprvasya upasakhynam kartavyam . hya bhtaprva hyaprva , hyaprvya dehi iti . pratiedhe bhtaprvasya upasakhynnarthakyam prvdnm vyavasthym iti vacant . pratiedhe bhtaprvasya upasakhynam narthakam . kim kraam . prvdnm vyavasthym iti vacant . prvdnm vyavasthym sarvanmasj ucyate . na ca atra vyavasth gamyate . (P_1,1.30) KA_I,92. 7-14 Ro_I,294 samse iti vartamne puna samsagrahaam kimartham . ayam trtysamsa asti eva prthamakalpika yasmin aikapadyam aikasvaryam aikavibhaktikatvam ca . asti tdarthyt tcchabdyam : trtysamsrthni padni trtysamsa iti . tat yat tdarthyt tcchabdyam tasya idam grahaam . atha v samase iti vartamne puna samsagrahaasya etat prayojanam : yoggam yath upajyeta . sati yogge yogavibhga kariyate . trty . trtysamse sarvdni sarvanmasajni na bhavanti . msaprvya dehi savatsaraprvya dehi . tata asamse . asamse ca trtyy sarvdni sarvanmasajni na bhavanti . msena prvya iti . (P_1,1.32) KA_I,92.16 Ro_I,295 jasa kryam prati vibh , akac hi na bhavati .

(P_1,1.34) KA_I,92.19-93.6 Ro_I,295-297 avardnm ca puna straphe grahanarthakyam gae pahitatvt . avardnm ca puna straphe grahaam anarthakam . kim kraam . gae pahitatvt . gae hi etni pahyante . katham puna jyate sa prva pha ayam puna pha iti . tni hi prvdni imni avardni . imni api
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (54 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prvdni . evam tarhi cryapravrtti jpayati sa prva pha ayam puna pha iti yat ayam prvdibhya navabhya v iti navagrahaam karoti . nava eva prvdni . idam tarhi prayojanam : vyavasthym asajym iti vakymi iti . etat api na asti prayojanam . evaviini eva etni gae pahyante . idam tarhi prayojanam dvydiparyudsena paryudsa m bht iti . etat api na asti prayojanam . cryapravrtti jpayati na em dvydiparyudsena paryudsa bhavati iti yat ayam prvatra asiddham iti niptanam karoti . vrttikakra ca pahati : jabhvt iti cet uttaratra abhvt apavdaprasaga iti . idam tarhi prayojanam jasi vibhm vakymi iti . (P_1,1.35) KA_I,93.8-9 Ro_I,297-298 khygrahaam kimartham . jtidhanaparyyavc ya svaabda tasya yath syt . iha m bht : sve putr sv putr sve gva sv gva . (P_1,1.36.1) KA_I,93.11-17 Ro_I,298-299 upasavynagrahaam anarthakam bahiryogea krtatvt . upasavynagrahaam anarthakam . kim kraam . bahiryogea krtatvt . bahiryoge iti eva siddham . na v akayugdyartham . na v anarthakam . kim kraam . akayugdyartham . akayugdyartham tarhi idam vaktavyam yatra etat na jyate kim antaryam kim uttaryam iti. atra api ya ea manuya prekprvakr bhavati nirjtam tasya bhavati idam antaryam idam uttaryam iti . (P_1,1.36.2) KA_I,93.18-23 Ro_I,299 apuri iti vaktavyam . iha m bht : antarym puri vasati iti . vprakarae tyasya itsu upasakhynam . vprakarae tyasya itsu upasakhynam kartavyam : dvityyai dvityasyai trtyyai trtyasyai . vibh dvitytrtybhym iti etat na vaktavyam bhavati . kim puna atra jyya . upasakhynam eva atra jyya . idam api siddham bhavati : dvityya dvityasmai trtyya trtyasmai . (P_1,1.37) KA_I,94.2-8 Ro_I,299-300 kimartham prthak grahaam svardnm kriyate na cdiu eva pahyeran . cdnm vai asattvavacannm niptasaj svardnm puna sattvavacannm asattvavacannm ca . atha kimartham ubhe saje kriyete na niptsaj eva syt . na evam akyam . nipta ekc an iti pragrhyasaj ukt . s svardnm api ekcm prasajyeta . evam tarhi avyayasaj eva astu . tat ca aakyam . vakyati etat : avyaye nakuniptnm iti . tat garyas nysena parigaanam kartavyam syt . tasmt prthak grahaam kartavyam ubhe ca saje kartavye . (P_1,1.38.1) KA_I,94.10-19 Ro_I,300-301 asarvavibhaktau avibhaktinimittasya upasakhynam . asarvavibhaktau avibhaktinimittasya upasakhynam kartavyam : nn vin . kim puna kraam na sidhyati . sarvavibhakti hi aviet. sarvavibhakti hi ea bhavati . kim kraam . aviet . avieea vihitatvt . traldnm ca upasakhynam . traldnm ca upasakhynam kartavyam . tatra yatra tata yata . nanu ca vieea ete vidhyante : pacamy tasil saptamy tral iti . vakyati etat : itarbhya api dryante iti . (P_1,1.38.2) KA_I,94.18-95.11 Ro_I,302-303 yadi puna avibhakti abda avyayasaja bhavati iti ucyeta . avibhaktau itaretarrayatvt aprasiddhi . avibhaktau itaretarrayatvt aprasiddhi sajy . k itaretarrayat . sati avibhaktitve sajay bhavitavyam sajay ca avibhaktitvam bhvyate . tat itaretarrayam bhavati , itaretarrayi ca kryi na
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (55 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prakalpante . aligam asakhyam iti v . atha v aligam asakhyam avyayam iti vaktavyam . evam api itaretarrayam eva bhavati . k itaretarrayat . sati aligsakhyatve sajay bhavitavyam sajay ca aligsakhyatvam bhvyate . tat itaretarrayam bhavati , itaretarrayi ca kryi na prakalpante . na idam vcanikam aligat asakhyat ca . kim tarhi . svbhvikam etat . tat yath : samnam hamnnm adhynnm ca ke cit arthai yujyante apare na . tatra kim asmbhi kartum akyam . svbhvikam etat . tat tarhi vaktavyam aligam asakhyam iti . na vaktavyam . siddham tu pht . pht v siddham etat. katham pha kartavya . tasildaya prk psapa , asprabhrtaya prk samsntebhya , mnta , krtvortha , tasivat , nnau iti . (P_1,1.38.3) KA_I,95.12-22 Ro_I,303-304 atha v puna astu avibhakti abda avyayasaja bhavati iti eva . nanu ca uktam avibhaktau itaretarrayatvt aprasiddhi iti . na ea doa . idam tvat ayam praavya . yadi api vaiykara vibhaktilopam rabham avibhaktikn abd prayujate ye tu ete vaiykaraebhya anye manuy katham te avibhaktikn abdn prayujate iti . abhij ca puna laukik ekatvdnm arthnm . ta ca abhij : anyena hi vasnena ekam gm kranti , anyena dvau , anyena trn . abhij ca na ca prayujate . tat etat evam sandryatm : artharpam etat evajtyakam yena atra vibhakti na bhavati iti . tat ca api etat evam anugamyamnam dryatm : kim cit avyayam vibhaktyarthapradhnam kim cit kriypradhnam . uccai , ncai iti vibhaktyarthapradhnam , hiruk prthak iti kriypradhnam . taddhita ca api ka cit vibhaktyarthapradhna ka cit kriypradhna . tatra yatra iti vibhaktyarthapradhna , nn vina iti kriypradhna . na ca etayo arthayo ligasakhybhym yoga asti . (P_1,1.38.4) KA_I,95.23-96.5 Ro_I,304-307 atha api asarvavibhakti iti ucyate evam api na doa . katham . idam ca api adyatve atibahu kriyate : ekasmin ekavacanam , dvayo dvivacanam , bahuu bahuvacanam iti . katham tarhi . ekavacanam utsarga kariyate . tasya dvibahvo arthayo dvivacanabahuvacane bdhake bhaviyata . na ca api evam vigraha kariyate : na sarv asarv , asarv vibhaktaya asmt iti . katham tarhi . na sarv asarv , asarv vibhakti asmt iti . trikam puna vibhaktisajam . evam gate krti api tulyam etat mntasya kryam grahaam na tatra . tata pare ca abhimat kry traya krdarth grahaena yog . krttaddhitnm grahaam tu kryam sakhyvieam hi abhinirit ye . tem pratiedha bhavati iti vaktavyam . iha m bht : eka , dvau , bahava iti . tasmt svardigrahaam ca kryam krttaddhitnm ca phe . (P_1,1.38.5) KA_I,96.6-17 Ro_I,307-308 phena iyam avyayasaj kriyate . s iha na prpnoti : paramoccai , paramancai iti . tadantavidhin bhaviyati . iha api tarhi prpnoti : atyuccai atyuccaisau atyuccaisa iti . upasarjanasya na iti pratiedha bhaviyati . sa tarhi pratiedha vaktavya . na vaktavya . sarvanmasajym prakrta pratiedha iha anuvartiyate . sa vai tatra pratykhyyate . yath sa tatra pratykhyyate iha api tath akya pratykhytum . katham sa tatra pratykhyyate . mahat iyam saj kriyate . iyam api ca mahat saj kriyate . saj ca nma yata na laghya . kuta etat . laghvartham hi sajkaraam . tatra mahaty sajy karae etat prayojanam anvarthasaj yath vijyeta : na vyeti iti avyayam iti . kva puna na vyeti . strpunapusakni sattvagu ekatvadvitvabahutvni ca . etn arthn ke cit viyanti ke cit na viyanti . ye na viyanti tad
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (56 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

avyayam . sadram triu ligeu sarvsu ca vibhaktiu vacaneu ca sarveu yat na vyeti tat avyayam . (P_1,1.39.1) KA_I,96.19-97.2 Ro_I,308-310 katham idam vijyate : krt ya mnta iti hosvit krdantam yat mntam iti . kim ca ata . yadi vijyate krt ya mnta iti kraym cakra hraym cakra iti atra na prpnoti . atha vijyate krdantam yat mntam iti pratmau pratma iti atra api prpnoti . yath icchasi tath astu . astu tvat krt ya mnta iti . katham kraym cakra hraym cakra iti . kim puna atra avyayasajay prrthyate . avyayt iti luk yath syt . m bht evam . ma iti evam bhaviyati . na sidhyati . ligrahaam tatra anuvartate . ligrahaam nivartiyate . yadi nivartate pratyayamtrasya luk prpnoti . iyate ca pratyayamtrasya . ta ca iyate . evam hi ha : kr ca anuprayujyate lii iti . yadi ca pratyayamtrasya luk bhavati tata etat upapannam bhavati . atha v puna astu krdantam yat mntam iti . katham pratmau pratma iti . cryapravrtti jpayati na pratyayalakaena avyayasaj bhavati iti yat ayam pranabdam svardiu pahati . (P_1,1.39.2) KA_I,97.3-100.4 Ro_I,310-318 krt mejanta ca anikrokraprakrti . krt mejanta ca anikrokraprakrti iti vaktavyam . iha m bht : dhaye , dhe , cikrave , cikro iti . ananyaprakrti iti v . atha v ananyaprakrti krt avyayasaja bhavati iti vaktavyam . kim puna atra jyya . ananyaprakrtivacanam eva jyya . idam api siddham bhavati : kumbhakrebhya , nagarakrebhya iti . tat tarhi vaktavyam . na v sanniptalakaa vidhi animittam tadvightasya . na v vaktavyam . kim kraam . sanniptalakaa vidhi animittam tadvightasya iti e paribh kartavy . ka puna atra viea e v paribh kriyeta ananyaprakrti iti v ucyeta . avayam e paribh kartavy . bahni etasy paribhy prayojanni . kni puna tni . prayojanam hrasvatam tugvidhe grmaikulam . grmaikulam , sennikulam iti atra hrasvatve krte hrasvasya piti krti tuk bhavati iti tuk prpnoti . sanniptalakaa vidhi animittam tadvightasya iti na doa bhavati . na etat asti prayojanam . bahiragam hrasvatvam . antaraga tuk . asiddham bahiragam antarage . nalopa vrtrahabhi . vrtrhabhi , bhrhabhi iti atra nalope krte hrasvasya piti krti tuk bhavati iti tuk prpnoti . sanniptalakaa vidhi animittam tadvightasya iti na doa bhavati . etat api na asti prayojanam . asiddha nalopa . tasya asiddhatvt na bhaviyati . udupadhatvam akittvasya nikucite . udupadhatvam akittvasya animittam . kva . nikucite . nikucita iti atra nalope krte udupadht bhvdikarmao anyatarasym iti akittvam prpnoti . sanniptalakaa vidhi animittam tadvightasya iti na doa bhavati . etat api na asti prayojanam . astu atra akittvam . na dhtulope rdhadhtuke iti pratiedha bhaviyati . nbhva yai drghatvasya amun . nbhva yai drghatvasya asnimittam . kva . amun . nbhve krte ata drgha yai supi ca iti drghatvam prpnoti . sanniptalakaa vidhi animittam tadvightasya iti na doa bhavati . etat api na asti prayojanam . vakyati etat : na mu dee iti . ttvam kittvasya updsta . ttvam kittvasya animittam . kva . updsta asya svara ikakasya iti . ttve krte sthghvo it ca iti ittvam prpnoti . sanniptalakaa vidhi animittam tadvightasya iti na doa bhavati . etat api na asti prayojanam . uktam etat : da pratiedha sthghvo ittve iti . tisrcatasrtvam bvidhe . tisrcatasrtvam bvidhe animittam . tisra tihanti catasra tihanti . tisrcatasrbhve krte rnnebhya p iti p prpnoti . sanniptalakaa vidhi animittam tadvightasya iti na doa
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (57 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

bhavati . etat api na asti prayojanam . cryapravrtti jpayati na tisrcatasrbhve krte p bhavati iti yat ayam na tisrcatasr iti nmi drghatvapratiedham sti . imni tarhi prayojanni : atni sahasri . numi krte nt a it asaj prpnoti . sanniptalakaa vidhi animittam tadvightasya iti na doa bhavati . akaau paddhatau . attve krte ata iti p prpnoti . sanniptalakaa vidhi animittam tadvightasya iti na doa bhavati . iyea , uvoa . gue krte ijde ca gurumata anrccha iti m prpnoti . sanniptalakaa vidhi animittam tadvightasya iti na doa bhavati . tasya doa varraya pratyaya varaviclasya . tasya etasya lakaasya doa varraya pratyaya varaviclasya animittam syt . kva . ata i : dki , plki . na pratyaya sanniptalakaa . agasaj tarhi animittam syt . ttvam pugvidhe krpayati . ttvam pugvidhe animittam syt . kva . krpayati iti . pug hrasvatvasya addapat . puk hrasvatvasya animittam syt . kva . addapat iti . tyaddyakra bvidhe . tyaddyakra bvidhe animittam syt . kva . y s . ividhi kralopasya papivn . ividhi kralopasya animittam syt . kva . papivn tasthivn iti . matubvibhaktyudttatvam prvanightasya . matubvibhaktyudttatvam prvanightasya animittam syt . kva . agnimn vyumn paramavc paramavce . nadhrasvratvam sambuddhilopasya . nadhrasvratvam sambuddhilopasya animittam syt . kva . nadi kumri kiori brhmai brahmabandhu . hrasvatve krte ehrasvt sambuddhe iti lopa na prpnoti . m bht evam . yantt iti evam bhaviyati . na sidhyati . drght iti ucyate . hrasvntt ca na prpnoti . idam iha sampradhryam : hrasvatvam kriyatm sambuddhilopa iti kim atra kartavyam . paratvt hrasvatvam . nitya sambuddhilopa . krte api hrasvatve prpnoti akrte api . anitya sambuddhilopa . na hi krte hrasvatve prpnoti . kim kraam . sanniptalakaa vidhi animittam tadvightasya iti . ete do sam bhysa v . tasmt na artha anay paribhay . na hi do santi iti paribh na kartavy lakaam v na praeyam . na hi bhikuk santi iti sthlya na adhiryante na ca mrg santi iti yav na upyante . do khalu api skalyena parigait prayojannm udharaamtram . kuta etat . na hi dom lakaam asti . tasmt yni etasy paribhy prayojanni tadartham e paribh kartavy pratividheyam ca doeu . (P_1,1.41) KA_I,100.6-26 Ro_I,318-320 avyaybhvasya avyayatve prayojanam lugmukhsvaropacr . avyaybhvasya avyayatve prayojanam kim . lugmukhsvaropacr . luk : upgni pratyagni . avyayt iti luk siddha bhavati . mukhasvara . upgnimukha , pratyagnimukha . na avyayadikabdgomahatsthlaprthuvatsebhya iti pratiedha siddha bhavati . upacra : upapayakra , upapayakma iti . ata krkamikasakumbhaptrakukaru anavyayasya iti pratiedha siddha bhavati . kim puna idam parigaanam hosvit udharaamtram . parigaanam iti ha . api khalu api hu . yat anyat avyaybhvasya avyayakrtam prpnoti tasya pratiedha vaktavya iti . kim puna tat . pargavadbhva . pargavadbhve avyayapratiedha codita uccai adhyna ncai adhyna iti evamartham . sa iha api prpnoti : upgni adhyna pratyagni adhyna . akaci avyayagrahaam kriyate uccakai , ncakai iti evamartham . tat iha api prpnoti : upgnikam , pratyagnikam iti . mumi avyayapratiedha ucyate domanyam aha , divmany rtri iti evamartham . sa iha api prpnoti : aupakumbhammanya , upamaikammanya . asya cvau avyayapratiedha ucyate dobhtam aha , divbht rtri iti evamartham . sa iha api prpnoti : upakumbhbhtam upamaikbhtam . yadi
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (58 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

parigaanam kriyate na artha avyaybhvasya avyayasajay . katham yni avyaybhvasya avyayatve prayojanni . na etni santi . yat tvat ucyate luk iti : cryapravrtti jpayati bhavati avyaybhvt luk iti yad ayam na avyaybhvt ata iti pratiedham sti . upacra : anuttarapadasthasya iti vartate . tatra mukhasvara eka prayojayati . na ca ekam prayojanam yogrambham prayojayati . yadi etvat prayojanam syt tatra eva ayam bryt nvyayt avyaybhvt ca iti . (P_1,1.42-43) KA_I,101.2-16 Ro_I,320-322 i sarvanmasthnam su anapusakasya iti cet jasi ipratiedha . i sarvanmasthnam su anapusakasya iti cet jasi e pratiedha prpnoti : kuni tihanti vanni tihanti . asamarthasamsa ca ayam draavya anapusakasya iti . na hi naa napusakena smarthyam. kena tarhi . bhavatin : na bhavati napusakasya iti . yat tvat ucyate i sarvanmasthnam su anapusakasya iti cet jasi ipratiedha iti . na apratiedht . na ayam prasajyapratiedha : napusakasya na iti . kim tarhi . paryudsa ayam : yat anyat napusakt iti . napusake avypra . yadi kena cit prpnoti tena bhaviyati . prvea ca prpnoti . aprpte v . atha v anantar y prpti s pratiidhyate . kuta etat . anantarasya vidhi v bhavati pratiedha v iti . prv prpti apratiiddh . tay bhaviyati . nanu ca iyam prpti prvm prptim bdhate . na utsahate pratiiddh sat bdhitum . yat api ucyate . asamarthasamsa ca ayam draavya iti yadi api vaktavya atha v etarhi bahni prayojanni . kni . asryampayni mukhni , apunargey lok , arddhabhoj brhmaa iti . (P_1,1.44.1) KA_I,101.18-102.10 Ro_I,322-323 na v iti vibhym arthasajkaraam . na v iti vibhym arthasya saj kartavy . navabdasya ya artha tasya saj bhavati iti vaktavyam . kim prayojanam . abdasajym hi arthsampratyaya yath anyatra . abdasajym hi satym arthasya asampratyaya syt yath anyatra . anyatra api abdasajym abdasya sampratyaya bhavati na arthasya . kva anyatra . ddh ghu adp taraptamapau gha iti ghugrahaeu ghagrahaeu ca abdasya sampratyaya bhavati na arthasya . tat tarhi vaktavyam . na vaktavyam . itikaraa arthanirdertha . itikaraa kriyate . sa arthanirdertha bhaviyati . kim gatam etat itin hosvit abdhikyt arthdhikyam . gatam iti ha . kuta . lokata . tat yath loke gau ayam iti ha iti goabdt itikaraa para prayujyamna goabdam svasmt padrtht pracyvayati . sa asau svasmt padrtht pracyuta y asau arthapadrthakat tasy abdapadrthaka sampadyate . evam iha api navabdt itikaraa para prayujyamna navabdam svasmt padrtht pracyvayati . sa asau svasmt padrtht pracyuta y asau abdapadrthakat tasy laukikam artham sampratyyayati . na v iti yat gamyate na v iti yat pratyate iti . (P_1,1.44.2) KA_I,102.11-103.2 Ro_I,324-325 samnaabdapratiedha . samnaabdnm pratiedha vaktavya : nav kuik nav ghaik iti . kim ca syt yadi etem api vibhsaj syt . vibh diksamse bahuvrhau : dakiaprvasym lym . acirakrtym sampratyaya syt . na v vidhiprvakatvt pratiedhasamapratyaya yath loke . na v ea doa . kim kraam . vidhiprvakatvt . vidhya kim cit na v iti ucyate . tena pratiedhavcina samapratyaya bhavati . tat yath loke : grma bhavat gantavya na v . na iti gamyate . asti kram yena loke pratiedhavcina samapratyaya bhavati . kim kraam . viligam hi bhavn loke nirdeam karoti . ga hi samnaliga nirdea kriyatm
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (59 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

pratyagravcina sampratyaya bhaviyati . tat yath : grma bhavat gantavya nava . pratyagra iti gamyate . etat ca eva na jnma : kva cit vykarae samnaliga nirdea kriyate iti . api ca kmacra prayoktu abdnm abhisambandhe . tat yath : yavg bhavat bhoktavy nav . yad yavgabda bhujin abhisambadhyate bhuji navabdena tad pratiedhavcina sampratyaya bhavati : yavg bhavat bhoktavy nav . na iti gamyate . yad yavgabda navabdena abhisambadhyate na bhujin tad pratyagravcina sampratyaya bhavati : yavg nav bhavat bhoktavy . pratyagr iti gamyate . na ca iha vayam vibhgrahaena sarvdni abhisambadhnma : diksamse bahuvrhau sarvdni vibh bhavanti iti . kim tarhi . bhavati abhisambadhyate : diksamse bahuvrhau sarvdni bhavanti vibh iti . (P_1,1.44.3) KA_I,103.3-104.7 Ro_I,325-328 vidhyanityatvam anupapannam pratiedhasajkarat . vidhyanityatvam na upapadyate : uva , uuvatu , uuvu , ivya , iviyatu , iviyu . kim kraam . pratiedhasajkarat . pratiedhasya iyam saj kriyate . tena vibhpradeeu pratiedhasya eva sampratyaya syt . siddham tu prasajyapratiedht . siddham etat . katham . prasajyapratiedht . prasajya kim cit na v iti ucyate . tena ubhayam bhaviyati . vipratiiddham tu . vipratiiddham tu bhavati . atra na jyate : kena abhipryea prasajati kena nivrttim karoti iti . na v prasagasmarthyt anyatra pratiedhaviayt . na v ea doa . kim kraam . prasagasmarthyt . prasagasmarthyt ca vidhi bhaviyati anyatra pratiedhaviayt pratiedhasmarthyt ca pratiedha bhaviyati anyatra vidhiviayt . tat etat kva siddham bhavati . y aprpte vibh . y hi prpte krtasmarthya tatra prvea vidhi iti krtv pratiedhasya eva sampratyaya syt . etat api siddham . katham . vibh iti mahatsaj kriyate . saj ca nma yata na laghya . kuta etat . laghvartham hi sajkaraam . tatra mahaty sajy karae etat prayojanam ubhayo saj yath vijyeta : na iti ca v iti ca . tatra y tvat aprpte vibh tatra pratiedhyam na asti iti krtv v iti anena vikalpa bhaviyati . y hi prpte vibh tatra ubhayam upasthitam bhavati : na iti ca v iti ca . tatra na iti anena pratiiddhe v iti anena vikalpa bhaviyati . evam api vipratiedhayo yugapadvacannupapatti . vipratiedhayo yugapadvacanam na upapadyate : uva uuvatu uuvu ivya iviyatu iviyu . kim kraam . bhavati iti cet na pratiedha . bhavati iti cet pratiedha na prpnoti . na iti cet na vidhi . na it cet vidhi na sidhyati . siddham tu prvasya uttarea bdhitatvt . siddham etat. katham . prvavidhim uttarvidhi bdhate . itikaraa arthanirdertha iti uktam . (P_1,1.44.4) KA_I,104.8-105.13 Ro_I,328-332 sdhvanusane asmin yasya vibh tasya sdhutvam . sdhvanusane asmin stre yasya vibh kriyate sa vibh sdhu syt . samsa ca eva hi vibh . tena samsasya eva vibh sdhutvam syt . astu . ya sdhu sa prayokyate. asdhu na prayokyate . na ca eva hi kad cit rjapurua iti asym avasthym asdhutvam iyate . api ca dvedhpratipatti . dvaidham abdnm apratipatti . icchma ca puna vibhpradeeu dvaidham abdnm pratipatti syt iti tat ca na sidhyati . yasya puna kry abd vibh asau samsam nirvartayati . yasya api nity abd tasya api ea na doa . katham . na vibhgrahaena sdhutvam abhisambadhyate . kim tarhi . samsasaj abhisambadhyate : samsa iti e saj
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (60 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

vibh bhavati iti . tat yath : medhya pau vibhita . medhya anavn vibhita iti . na etat vicryate : anavn na anavn iti . kim tarhi labdhavya na labdhavya iti . krye yugapadanvcayayaugapadyam . kryeu abdeu yugapat anvcayena ca yat ucyate tasya yugapadvacanat prpnoti : tavyattavynyara , hak ca makt iti . yasya puna nity abd prayuktnm asau sdhutvam anvcae . nanu ca yasya api kry tasya api ea na doa . katham . pratyaya para bhavati iti ucyate . na ca ekasy prakrte anekasya pratyayasya yugapat paratvena sambhava asti . na api brma pratyayaml prpnoti . kim tarhi . kartavyam iti prayoktavye yugapat dvityasya trtyasya ca prayoga prpnoti . na ea doa . arthagatyartha abdaprayoga . artham sampratyyayiymi iti abda prayujyate . tatra ekena uktatvt tasya arthasya dvityasya prayogea na bhavitavyam uktrthnm aprayoga iti . cryadealane ca tadviayat . cryadealanena yat ucyate tasya tadviayat prpnoti . ika hrasva aya glavasya prcm avrddht phin bahulam iti glav eva hrasvn prayujran prku ca eva hi phin syt . tat yath : jamadagni vai etat pacamam avadnam avdyat tasmt na ajmadagnya pacvattam juhoti . yasya puna nity abd glavagrahaam tasya pjrtham deagrahaam ca krtyartham . nanu ca yasya api kry tasya api pjrtham glavagrahaam syt deagraham ca krtyartham . tatkrtane ca dvedhpratipatti . tatkrtane ca dvaidham abdnm apratipatti syt . icchma ca puna cryagrahaeu deagrahaeu ca dvaidham abdnm pratipatti syt iti tat ca na sidhyati . (P_1,1.44.5) KA_I,105.14-20 Ro_I,332-333 aiya v viditatvt . aiya v puna ayam yoga . kim kraam . viditatvt . yat anena yogena prrthyate tasya arthasya viditatvt . ye api hi etm sajm na rabhante te api vibh iti ukte anityatvam avagacchanti . yjik khalu api sajm anrabham vibh iti ukte anityatvam avagacchanti . tat yath . medhya pau vibhita . medhya anavn vibhita iti . labdhavya na labdhavya iti gamyate . crya khalu api sajm rabhama bhyiham anyai api abdai etam artham sampratyyayati bahulam anyatarasym ubhayath v ekem iti . (P_1,1.44.6) KA_I,105.21-108.7 Ro_I,333-339 aprpte trisaay . ita uttaram y vibh anukramiyma aprpte t draavy . trisaay tu bhavanti : prpte aprpte ubhayatra v iti . dvandve ca vibh jasi : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . ubhayaabda sarvdiu pahyate tayapa ca ayajdea kriyate . tena v nitye prpte anyatra v aprpte ubhayatra v iti . aprpte . ayac pratyayntaram . yadi pratyayntaram ubhay iti kra na prpnoti . m bht evam . mtraca iti evam bhaviyati . katham . mtrac iti na idam pratyayagrahaam . kim tarhi . pratyhragrahaam . kva sannivinm pratyhra . mtraabdt prabhrti yaca cakrt . yadi pratyhragrahaam kati tihanti : atra api prpnoti . ata iti vartate . evam api tailamtr ghrtamtr iti atra api prpnoti . sadrasya api asanniviasya na bhaviyati pratyhrea grahaam . ro vibh : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . asayogt li kit iti v nitye prpte anyatra v aprpte ubhayatra v iti . aprpte . anyat hi kittvam anyat ittvam . ekam cet itkitau . yadi ekam itkitau tata asti sandeha . atha hi nn na asti sandeha . yadi api nn evam api sandeha . katham . prauruvi iti . srvadhtukam apit iti v nitye prpte anyatra v aprpte
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (61 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

ubhayatra v iti . aprpte . vibh upayamane : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . gandhane iti v nitye prpte anyatra v aprpte ubhayatra v iti . aprpte . gandhane iti nivrttam . anupasargt v : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . vrttisargatyaneu krama iti v nitye prpte anyatra v aprpte ubhayatra v iti . aprpte . vrttydiu iti nivrttam . vibh vrkamrgdnm : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . jti aprinm iti v nitye prpte anyatra v aprpte ubhayatra v iti . aprpte . jti aprinm iti nivrttam . uavidajgrbhya anyatarasym : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . pratyayntt iti v nitye prpte anyatra v aprpte ubhayatra v iti . aprpte . pratyaynt dhtvantari . dpdnm vibh : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . bhvakarmao iti v nitye prpte anyatra v aprpte ubhayatra v iti . aprpte . kartari iti vartate . evam api sandeha : nyyye v kartari karmakartari v iti . na asti sandeha . sakarmakasya kart karmavat bhavati akarmak ca dpdaya . akarmak api vai sopasarg sakarmak bhavanti . karmpadi vidhaya karmasthabhvaknm karmasthakriym ca bhavanti kartrsthabhvak ca dpdaya . vibh agreprathamaprveu : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . bhkye iti v nitye prpte anyatra v aprpte ubhayatra v iti . aprpte . bhkye iti nivrttam . trndnm vibh : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . kroe iti v nitye prpte anyatra v aprpte ubhayatra v iti . aprpte . kroe iti nivrttam . ekahaldau prayitavye anyatarasym . prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . udakasya uda sajym iti v nitye prpte anyatra v aprpte ubhayatra v iti . aprpte . sajym iti nivrttam . vde ii padntasya anyatarasym . prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . ii iti v nitye prpte anyatra v aprpte ubhayatra v iti . aprpte . ii iti nivrttam . saprvy prathamy vibh . prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . cdibhi yoge iti v nitye prpte anyatra v aprpte ubhayatra v iti . aprpte . cdibhi yoge iti nivrttam . gra yai aci vibh . prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . yai iti v nitye prpte anyatra v aprpte ubhayatra v iti . aprpte . aprpte . yai iti nivrttam (P_1,1.44.7) KA_I,108.8-109.3 Ro_I,339-40 prpte ca . ita uttaram y vibh anukramiyma prpte t draavy . trisaay tu bhavanti : prpte aprpte ubhayatra v iti . vibh vipralpe : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . vyaktavcm iti v nitye prpte anyatra v aprpte ubhayatra v iti . prpte . vyaktavcm iti hi vartate . vibh upapadena pratyamne : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . svaritaita iti v nitye prpte anyatra v aprpte ubhayatra v iti . prpte . svaritaita iti hi vartate . tira antardhau vibh kri : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . antardhau iti v nitye
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (62 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prpte anyatra v aprpte ubhayatra v iti . prpte . antardhau iti hi vartate . adhi vare vibh kri : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . vare iti v nitye prpte anyatra v aprpte ubhayatra v iti . prpte . vare iti hi vartate . diva tadarthasya vibh upasarge : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . tadarthasya iti v nitye prpte anyatra v aprpte ubhayatra v iti . prpte . tadarthasya iti vartate (P_1,1.44.8) KA_I,109.4-110.8 Ro_I,340-341 ubhayatra ca . ita uttaram y vibh anukramiyma ubhayatra t draavy . trisaay tu bhavanti : prpte aprpte ubhayatra v iti . hrkro anyatarasym : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . gatibuddhipratyavasnrthaabdakarmkarmakm iti v nitye prpte anyatra v aprpte ubhayatra v iti . ubhayatra . prpte tvat : abhyavahrayati saindhavn , abhyavahrayati saindhavai , vikrayati saindhavn , vikrayati saindhavai . aprpte : harati bhram devadatta . hrayati bhram devadattam , hrayati bhram devadattena . karoti kaam devadatta . krayati kaam devadattam , krayati kaam devadattena . na yadi vibh skke : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra .yadi iti v nitye prpte anyatra v aprpte ubhayatra v iti . ubhayatra . prpte tvat : abhijnsi devadatta yat kamreu vatsyma , yat kamreu avasma , yat tatra odann bhokymahe , yat tatra odann abhujmahi . aprpte : abhijnsi devadatta kamrn gamiyma , kamrn agacchma , tatra odanm bhokymahe , tatra odann abhujmahi . vibh ve : prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra .kiti iti v nitye prpte anyatra v aprpte ubhayatra v iti . ubhayatra . prpte tvat : uuvatu , uuvu , iviyatu , iviyu . aprpte : uva uavitha ivya ivayitha . vibh saghusvanm : samprvt ghue prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . ghui aviabdane iti v nitye prpte anyatra v aprpte ubhayatra v iti . ubhayatra . prpte tvat : saghu rajju , saghuit rajju . aprpte : saghuam vkyam , saghuitam vkyam . prvt svane prpte aprpte ubhayatra v iti sandeha . katham ca prpte katham v aprpte katham v ubhayatra . manasi iti v nitye prpte anyatra v aprpte ubhayatra v iti . ubhayatra . prpte tvat : svntam mana , svanitam mana . aprpte : svnta devadatta , svanita devadatta iti . (P_1,1.45) KA_I,111.2-112.17 Ro_I,342-346 fkim iyam vkyasya samprasraasaj kriyate : ik yaa iti etat vkyam samprasraasajam bhavati iti , hosvit varasya : ik ya yaa sthne sa samprasraasaja bhavati iti . ka ca atra viea . samprasraasajym vkyasaj cet varavidhi . samprasraasajym vkyasaj cet varavidhi na sidhyati : samprasrat para prva bhavati , samprasraasya drgha bhavati iti . na hi vkyasya samprasraasajym satym ea nirdea upapadyate na api etayo kryayo sambhava asti . astu tarhi varasya . varasaj cet nirvrtti . varasaj cet nirvrtti na sidhyati : yaa samprasraam iti . sa eva hi tvat ik durlabha yasya saj kriyate . atha api katham cit labhyeta kena asu yaa sthne syt . anena eva hi asau vyavasthpyate . tat etat itaretarrayam bhavati , itaretarrayi ca kryi na prakalpante .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (63 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

vibhaktivieanirdea tu jpaka ubhayasajtvasya . yat ayam vibhaktivieai nirdeam karoti samprasrat para prva bhavati samprasraasya drgha bhavati yaa samprasraam iti tena jyate ubhayo saj bhavati iti . yat tvat ha samprasrat para prva bhavati samprasraasya drgha bhavati iti tena jyate varasya bhavati iti . yat api ha yaa samprasraam iti tena jyate vkyasya api saj bhavati iti . atha v puna astu vkyasya eva . nanu ca uktam samprasraasajym vkyasaj cet varavidhi iti . na ea doa . yath kkt jta kka , yent jta yena evam samprasrat jtam samprasraam . yat tat samprasrat jtam samprasraam tasmt para prva bhavati tasya drgha bhavati iti . atha v dryante hi vkyeu vkyaikaden prayujn padeu ca padaikaden . vkyeu tvat vkyaikaden : pravia pim , pravia tarparam . padeu padaikaden : devadatta datta , satyabhm bhm iti . evam iha api samprasraanirvrttt samprasraanirvrttasya iti etasya vkyasya arthe samprasrat samprasraasya iti vkyaikadea prayujyate . tena nirvrttasya vidhim vijsyma . samprasraanirvrttt samprasraanirvrttasya iti . atha v ha ayam samprasrat para prva bhavati samprasraasya drgha bhavati iti . na ca vkyasya samprasraasajym satym ea nirdea upapadyate na api etayo kryayo sambhava asti . tatra vacant bhaviyati . atha v puna astu varasya . nanu ca uktam varasaj cet nirvrtti iti . na ea doa . itaretarrayamtram etat coditam . sarvi ca itaretarrayi ekatvena parihrtni siddham tu nityaabdatvt iti . na idam tulyam anyai itaretarrayai . na hi tatra kim cit ucyate asya sthne ye kraikraukr bhvyante te vrddhisaj bhavanti iti . iha puna ucyate ik ya yaa sthne sa samprasraasaja bhavati iti . evam tarhi bhvin iyam saj vijsyate . tat yath : ka cit kam cit tantuvyam ha : asya strasya akam vaya iti . sa payati : yadi aka na vtavya atha vtavya na aka . aka vtavya iti vipratiiddham . bhvin khalu asya saj abhipret . sa manye vtavya yasmin ute aka iti etat bhavati iti . evam iha api sa yaa sthne bhavati yasya abhinirvrttasya samprasraam iti e saj bhaviyati . atha v ijdiyajdipravrtti ca eva hi loke lakyate . yajdyupadet tu ijdinivrtti prasakt . prayujate ca puna lok iam uptam iti . te manymahe : asya yaa sthne imam ikam prayujate iti . tatra tasya asdhvabhimatasya strea sdhutvam avasthpyate : kiti sdhu bhavati iti sdhu bhavati iti . (P_1,1.46.1) KA_I,112.19-22 Ro_I, 346 samsanirdea ayam . tatra na jyate ka di ka anta iti . tat yath : ajvidhanau devadattayajadattau iti ukte na jyate kasya aj dhanam kasya avaya iti . yadi api tvat loke ea drnta drntasya api pururambha nivartaka bhavati . asti ca iha ka cit pururambha . asti iti ha . ka . sakhytanudea nma . (P_1,1.46.2) KA_I,112.23-113.15 Ro_I,346-349 kau puna akitau dyantau bhavata . gamau iti ha . yuktam puna yat nityeu nma abdeu gamasanam syt na nityeu abdeu kasthai aviclibhi varai bhavitavyam anapyopajanavikribhi . gama ca nma aprva abdopajana . atha yuktam yat nityeu abdeu de syu . bham yuktam . abdntarai iha bhavitavyam . tatra abdntart abdntarasya pratipatti yukt . de tarhi ime bhaviyanti angamaknm sgamak . tat katham . sajdhikra ayam .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (64 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

dyantau ca iha sakrtyete . akrkakrau itau udhriyete . tatra dyantayo akrakakrau itau saje bhaviyata . tatra rdhadhtukasya i valde iti upasthitam idam bhavati : di iti . tena ikrdi dea bhaviyati . etvat iha stram i iti . katham puna iyat strea ikrdi dea labhya . labhya iti ha . katham. bahuvrhinirdet . bahuvrhinirdea ayam : ikra di asya iti . yadi api tvat atra etat akyate vakutm iha katham : lulalrku a udtta iti yatra aakyam udttagrahaena akra vieayitum . tatra ka doa . agasya udttatvam prasajyeta . na ea doa . tripada ayam bahuvrhi . tatra vkye eva udttagrahaena akra vieyate : akra udtta di asya iti . yatra tarhi anuvrtty etat bhavati : ajdnm iti . vakyati etat : ajdnm a siddham iti . atha v yat tvat ayam smnyena aknoti upadeum tat tvat upadiati prakrtim tata valdi rdhadhtukam tata pact ikram . tena ayam vieea abdntaram samudyam pratipadyate . tat yath khadiraburburayo : khadiraburburau gaurakau skmaparau . tata pact ha kaakavn khadira iti . tena asau vieea dravyntaram samudyam pratipadyate . atha v etay nuprvy ayam abdntaram upadiati : prakrtim tata valdi rdhadhtukam tata pact ikram yasmin tasya gamabuddhi bhavati . (P_1,1.46.3) KA_I,113.16-114.16 Ro_I,349-351 akito dyantavidhne pratyayapratiedha . akito dyantavidhne pratyayasya pratiedha vaktavya . pratyaya di anta v m bht : care a ta anupasarge ka iti . paravacant siddham . paravacant pratyaya di anta v na bhaviyati . paravacant siddham iti cet na apavdatvt . paravacant siddham iti cet na . kim kraam . apavdatvt . apavda ayam yoga . tat yath mit aca antyt para iti ea yoga sthneyogatvasya pratyayaparatvasya ca apavda . viama upanysa . yuktam tatra yat anavakam mitkaraam sthneyogatvam pratyayaparatvam ca bdhate . iha puna ubhayam svaksam . ka avaka . itkaraasya avaka : ita iti kra yath syt . kitkaraasya avaka : kiti iti kralopa yath syt . prayojanam nma tat vaktavyam yat niyogata syt . yadi ca ayam niyogata para syt tata etat prayojanam syt . kuta nu khalu etat itkarat ayam para bhaviyati na puna di iti kitkarat ca para bhaviyati na puna anta iti . ita khalu api ea parihra yatra na asti sambhava yat para ca syt di ca . kita tu aparihra . asti hi sambhava yat para ca syt anta ca . tatra ka doa . upasarge gho ki : dhyo , pradhyo . nodhtvo iti pratiedha prasajyeta . ita ca api aparihra . syt eva hi ayam itkarat di na puna para . kva tarhi idnm idam syt : ita kra bhavati iti . ya ubhayavn : gpo ak iti . siddham tu ahyadhikre vacant . siddham etat . katham . ahyadhikre ayam yoga karatvya : dyantau akitau ahnirdiasya iti . dyantayo v athyarthatvt tadabhve asampratyaya . dyantayo v athyarthatvt ahy abhve asampratyaya . di anta v na bhaviyati . yuktam puna yat abdanimittaka nma artha syt na arthanimittakena abdena bhavitavyam . arthanimittaka eva abda . tat katham . dyantau ahyarthau . na ca atra ahm payma . te manymahe : dyantau eva atra na sta . tayo abhve ah api na bhavati iti . (P_1,1.47.1) KA_I,114.18-115.4 Ro_I,352 kimartham idam ucyate . mit aca antyt para iti sthnaparapratyaypavda . mit aca antyt para iti ucyate sthneyogatvasya pratyayaparatvasya ca apavda . sthneyogatvasya tvat : kuni vanni paysi
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (65 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

yasi . pratyayaparatvasya : bhinatti chinatti . bhavet idam yuktam udharaam kuni vanni yatra na asti sambhava yat ayam aca anytt para ca syt sthne ca iti . idam tu ayuktam paysi yasi . asti hi sambhava yat aca anytt para ca syt sthne ca . etat api yuktam . katham . na eva vara jpayati na api dharmastrakr pahanti apavdai utsarg bdhyantm iti . kim tarhi . laukika ayam drnta . loke hi sati api sambhave bdhanam bhavati . tat yath : dadhi brhmaebhya dyatm takram kauinyya iti sati api sambhave dadhidnasya takradnam nivartakam bhavati . evam iha api sati api sambhave acm antyt paratvam ahsthneyogatvam bdhiyate . (P_1,1.47.2) KA_I,115.5-12 Ro_I,352-353 antyt prva masje anuagasayogdiloprtham . antyt prva masje mit vaktavya . kim prayojanam . anuagasayogdiloprtham . anuagaloprtham sayogdiloprtham ca . anuagaloprtham tvat : magna , magnavn . sayogdiloprtham makt maktum , maktavyam . bharjimarcyo ca . bharjimarcyo ca antyt prva mit vaktavya . bharj marcaya iti . sa tarhi vaktavya . na vaktavya . niptant siddham . kim niptanam . bharjabda agulydiu pahyate marciabda bhvdiu . (P_1,1.47.3) KA_I,115.13-117.2 Ro_I,353-357 kim puna ayam prvnta hosvit pardi hosvit abhakta . katham ca ayam prvnta syt katham v pardi katham v abhakta . yadi anta iti vartate tata prvnta . atha di iti vartate tata pardi . atha ubhayam nivrttam tata abhakta . ka ca atra viea . abhakte drghanalopasvaraatvnusvrabhv . yadi abhakta drghatvam na prpnoti : kuni vanni . nopadhy sarvanmasthne ca asambuddhau iti drghatvam na prpnoti . drgha . nalopa : nalopa ca na sidhyati : agne tr te vajin tr sadhasth , ta t pinm . nalopa prtipadikntasya iti nalopa na prpnoti . nalopa . svara : svara ca na sidhyati : sarvi jyoti . sarvasya supi iti dyudttatvam na prpnoti . svara . atva : atvam ca na sidhyati : mavpi vrhivpi . prvnte prtipadikntanakrasya iti siddham , pardau vibhaktinakrasya , abhakte numa grahaam kartavyam . na kartavyam . kriyate nyse eva : prtipadikntanumvibhaktiu iti . atva . anusvra : anusvra ca na sidhyati : dviantapa , parantapa . ma anusvra hali iti anusvra na prpnoti . m bht evam . na ca apadntasya jhali iti evam bhaviyati . ya tarhi na jhalpara : vahaliha gau , abhraliha vyu . anusvra . bhva : bhva ca na sidhyati : trapu jatun tumburu . napusakt uttarasya aua bhva bhavati iti bhva na prpnoti . bhva . evam tarhi pardi kariyate . pardau guavrddhyauttvadrghanalopnusvrabhvenakrapratiedha . yadi pardi gua pratiedhya : trapue jatune tumburue . ghe iti iti gua prpnoti . gua . vrddhi : vrddhi pratiedhy : atisakhni brhmaakulni . sakhyu asambuddhau iti ittve aca iti iti vrddhi prpnoti . vrddhi . auttva : auttvam ca pratiedhyam : trapui jatuni tumburui . idudbhym aut at ca ghe iti auttvam prpnoti . auttva . drgha : drghatvam ca na sidhyati : kuni vanni . nopadhy sarvanmasthne ca asambuddhau iti drghatvam na prpnoti . m bht evam . ata drgha yai supi ca iti evam bhaviyati . iha tarhi : asthni dadhni priyasakhni brhmaakulni . drgha . nalopa : nalopa ca na sidhyati : agne tr te vajin tr sadhasth , ta t pinm . nalopa prtipadikntasya iti nalopa na prpnoti . nalopa . anusvra : anusvra ca na sidhyati : dviantapa , parantapa . ma anusvra hali iti
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (66 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

anusvra na prpnoti . m bht evam . na ca apadntasya jhali iti evam bhaviyati . ya tarhi na jhalpara : vahaliha gau , abhraliha vyu . anusvra . bhvenakrapratiedha : bhve nakrasya pratiedha vaktavya : trapu jatun tumburu . sanumkasya bhva prpnoti . na ea doa . nirdiyamnasya de bhavanti iti evam na bhaviyati . ya tarhi nirdiyate tasya na prpnoti . kasmt . num vyavahitatvt . evam tarhi prvnta kariyate . prvnte napusakopasarjanahrasvatvam dvigusvara ca . yadi prvanta kriyate napusakopasarjanahrasvatvam dvigusvara ca na sidhyati . napusakopasarjanahrasvatvam : rastri dhnakulin nikaumbin nirvrasin . dvigusvara : pacratnin daratnin . numi krte anantyatvt ete vidhaya na prpnunvanti . na v bahiragalakaatvt . na v ea doa . kim kraam . bahiragalakaatvt . bahiraga num , antarag ete vidhaya . asiddham bahiragam antarage . dvigusvare bhyn parihra : saghtabhakta asau na utsahate avayavasya igantatm vihantum iti krtv dvigusvara bhaviyati . (P_1,1.48) KA_I,117.4-118.4 Ro_I,357-359 kimartham idam ucyate . eca ik savarkranivrttyartham . eca ik bhavati iti ucyate savaranivrttyartham akranivrttyartham ca . savarnivrttyartham tvat : ea hrasvasaneu ardha ekra ardha okra v m bht iti . akranivrttyartham ca . imau aicau samhravarau . mtr avarasya mtr ivarovarayo . tayo hrasvasaneu kad cit avara syt kad cit ivarovarau . m kad cit avaram bht iti evamartham idam ucyate . asti prayojanam etat . kim tarhi iti . drghaprasaga . drgh tu ika prpnuvanti . kim kraam . sthne antaratama bhavati iti . nanu ca hrasvdee iti ucyate . tena drgh na bhaviyanti . viyrtham etat syt . eca hrasvaprasage ik bhavati iti . drghprasaga tu nivartakatvt . drghm tu ikm aprasaga . kim kraam . nivartakatvt . na anena ika nirvartyante . kim tarhi . anika nivartyante . siddh eva hrasv ika ca anika ca . tatra anena anika nivartyante . savaranivrttyarthena tvat na artha . siddham ea sasthnatvt . siddham etat . katham . ea sasthnatvt ikrokrau bhaviyata . ardha ekra aradha okra v na bhaviyati . nanu ca ea sasthnatarau ardha ekraukrau . na tau sta . yadi hi tau sytm tau eva ayam upadiet . nanu ca bho chandognm styamugriryany ardham ekram ardham okram ca adhyate : sujte evasnrte , adhvaryo odribhi sutam , ukram te enyat yajatam te enyat iti . pradakrti e tatrabhavatm . na eva loke na anyasmin vede ardha ekra ardha okra v asti . akranivrttyarthena api na artha . aico ca uttarabhyastvt . aico ca uttarabhyastvt avara na bhaviyati . bhyas mtr ivarovarayo alpyas avarasya . bhyasa eva grahani bhaviyanti . tat yath brhmaagrma nyatm iti ucyate tatra ca avarata pacakruk bhavati . (P_1,1.49.1) KA_I,118.6-7 Ro_I,360 kim idam sthneyog iti . sthne yoga asy s iyam sthneyog . saptamyalopa niptant . trtiyy v etvam : sthnena yoga asy s iyam sthneyog . (P_1,1.49.2) KA_I,118.8-119.28 Ro_I,360-364 kimartham puna idam ucyate . ahy sthneyogavacanam niyamrtham . niyamrtha ayam rambha . ekaatam ahyarth yvanta v te sarve ahym uccritym prpnuvanti . iyate ca vykarae y ah s sthneyog eva syt iti . tat ca antarea yatnam na sidhyati iti ahy sthneyogavacanam
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (67 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

niyamrtham . evamartham idam ucyate . asti prayojanam etat . kim tarhi iti . avayavaahydiu atiprasaga sa goha iti . avayavaahydaya tu na sidhyanti . tatra ka doa . sa it ahalo iti se ca antyasya syt upadhmtrasya ca . t upadhy goha iti goha ca antyasya syt upadhmtrasya ca . avayavaahydnm ca aprpti yogasya asandigdhatvt . avayavaahydnm ca niyamasya aprpti . kim kraam . yogasya asandigdhatvt . sandehe niyama na ca avayavaahydiu sandeha . kim vaktavyam etat . na hi . katham anucyamnam gasyate. laukika ayam drta . tat yath loke : kam cit ka cit prcchati : grmntaram gamiymi panthnam me bhavn upadiatu iti . sa tasmai cae . amumin avake hastadakia grahtavya amumin avake hastavma iti . ya tu atra tiryakpatha bhavati na tasmin sandeha iti krtv na asau upadiyate . evam iha api sandehe niyama na ca avayavaahydiu sandeha . atha v sthne ayog sthneyog kim idam ayog iti . avyaktayog ayog . atha v yogavat yog . k puna yogavat . yasy bahava yog . kuta etat . bhmni hi matup bhavati . vii v ah sthneyog . atha v kim cid ligam sajya vakymi : itthalig ah sthneyog bhavati iti . na tat ligam avayavaahydiu kariyate . yadi evam sa it ahalo hau sigrahaam kartavyam sthneyogrtham ligam sakymi iti . na kartavyam . yat eva ada purastt avayavaahyartham prakrtam etat uttaratra anuvrttam sat sthneyogrtham bhaviyati . katham . adhikra nma triprakra . ka cit ekadeastha sarvam stram abhijvalayati yath pradpa supravijvalita sarvam vema abhijvalayati . apara adhikra yath rajjv ayas v baddham kham anukryate tadvat anukryate cakrea . apara adhikra pratiyogam tasya anirdertha iti yoge yoge upatihate . tat yad ea paka adhikra pratiyogam tasya anirdertha iti tad hi yat eva ada purastt avayavaahyartham prakartam etat uttaratra anuvrttam sat sthneyogrtham bhaviyati . sampratyayamtram etat bhavati . na hi anuccrya abdam ligam akyam saktum . evam tarhi dee tat ligam kariyate tat prakrtim skantsyati . yadi niyama kriyate yatra ek ah anekam ca vieyam tatra na sidhyati : agasya , hala , aa , samprasraasya iti . hal api vieya a api vieya samprasraam api vieyam . asati puna niyame kmacra ekay athy anekam vieayitum . tat yath . devadattasya putra pi kambala iti . tasmt na artha niyamena . nanu ca uktam ekaatam ahyarth yvanta v te sarve ahym uccritym prpnuvanti iti . na ea doa . yadi api loke bahava abhisambandh rth yaun maukh srauv ca abdasya tu abdena ka anya abhisambandha bhavitum arhati anyat ata sthnt . abdasya api abdena anantardaya abhisambandh . aste bh bhavati iti sandeha : sthne anantare sampe iti . sandehamtram etat bhavati . sarvasandeheu ca idam upatihate : vykhynata vieapratipatti na hi sandeht alakaam iti . sthne iti vykhysyma . na tarhi idnm ayam yoga vaktavya . vaktavya ca . kim prayojanam . ahyantam sthnena yath yujyeta yata ah uccrit . kim krtam bhavati . nirdiyamnasya de bhavanti iti e paribh na kartavy bhavati . (P_1,1.50.1) KA_I,120.2-13 Ro_I,364-366 kim udharaam . ika ya aci : dadhi atra madhu atra : tlusthnasya tlusthna ohasthnasya ohasthna yath syt . na etat asti . sakhytnudeena api etat siddham . idam tarhi : tasthasthamipm tmtamtma iti ekrthasya ekrtha dvyarthasya dvyartha bahvarthasya bahuvartha yath syt . nanu ca
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (68 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

etat api sakhytnudeena eva siddham . idam tarhi : aka savare drgha iti : dagram , kupgram , dadhi indra , madhu ura iti : kahasthnayo kahasthna tlusthnayo tlusthna ohasthnayo ohasthna yath syt iti . atha sthne iti vartamne puna sthnagrahaam kimartham . yatra anekavidham ntaryam tatra sthnata eva ntaryam balya yath syt . kim puna tat . cet stot : pramata akra gua prpnoti sthnata ekraukrau . puna sthnagrahat ekraukrau bhavata . atha tamabgrahaam kimartham . jhaya ha anyatarasym iti atra somaa soma iti dvity prasakt ndavata ndavanta iti trty . tamapgrahaena soma ndavanta ca te bhavanti caturth : vg ghasati triub bhasati iti . (P_1,1.50.2) KA_I,120.14-121.29 Ro_I,366-370 kimartham puna idam ucyate . sthnina ekatvanirdet anekdeanirdet ca sarvaprasaga tasmt sthnentaratamavacanam . sthn ekatvena nirdiyate : aka iti , aneka ca puna dea pratinirdiyate : drgha iti . sthnina ekatvanirdet anekdeanirdet ca sarvaprasaga . sarve sarvatra prpnuvanti . iyate ca antaratam eva syu iti . tat ca antarea yatnam na sidhyati . tasmt sthne antaratama iti vacanam niyamrtham . evamartham idam ucyate . asti prayojanam etat . kim tarhi iti . yath puna iyam antaratamanirvrttti s kim prakrtita bhavati : sthnini antaratame ah , hosvit deata : sthne prpyamnm antaratama dea bhavati iti . kuta puna iyam vicra . ubhayath api tuly sahit : sthnentaratama , ura rapara iti . kim ca ata . yadi prakrtita : ika ya aci : yam ye antaratam ika tatra ah , yatra ah tatra de bhavanti iti iha eva syt : dadhi atra madhu atra . kumr atra brahmabandhvartham iti atra na syt . deata puna antaratamanirvrttau satym sarvatra ah , yatra ah tatra de bhavanti iti sarvatra siddham bhavati . tath ika guavrddh : guavrddhyo ye antaratam ika tatra ah , yatra ah tatra de bhavanti iti iha eva syt : net lavit nyaka lvaka . cet stot cyaka stvaka iti atra na syt . deata puna antaratamanirvrttau satym sarvatra ah , yatra ah tatra de bhavanti iti sarvatra siddham bhavati . tath rvarasya guavrddhiprasage guavrddhyo yat antaratamam rvaram tatra ah , yatra ah tatra de bhavanti iti iha eva syt : kart hart , straka , nipraka . starit niparit kraka , hraka iti atra na syt . deata puna antaratamanirvrttau satym sarvatra ah , yatra ah tatra de bhavanti iti sarvatra siddham bhavati . atha deata antaratamanirvrttau satym ayam doa : vnta yi pratyaye : sthninirdea kartavya . okraukrayo iti vaktavyam ekraikrayo m bht iti . prakrtita puna antaratamanirvrttau satym vntdeasya y antaratam prakrti tatra ah , yatra ah tatra de bhavanti iti antarea sthninirdeam siddham bhavati . deata api antaratamanirvrttau satym na doa . katham . vntagrahaam na kariyate . yi pratyaye eca aydaya bhavanti iti eva. yadi na kriyate ceyam , jeyam iti atra api prpnoti . kayyajayyau akyrthe iti etat niyamrtham bhaviyati : kijyo eva eca iti . tayo tarhi akyrtht anyatra api prpnoti : keyam ppam jeya vrala iti . ubhayata niyama vijsyate : kijyo eva eca anayo ca akyrthe eva iti . iha api tarhi niyamt na prpnoti : lavyam , pavyam avayalvyam avayapvyam iti . tulyajtyasya niyama . ka ca tulyajtya . yathjtyaka kijyo ec . kathajtyaka kijyo ec . ekra . evam api ryam icchati raiyati atra api prpnoti . ryi chndasa . drnuvidhi chandasi bhavati . dupadhay goha : deata antaratamanirvrttau satym upadhgrahaam kartavyam .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (69 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prakrtita puna antaratamanirvrttau satym krasya goha y antaratam prakrti tatra ah , yatra ah tatra de bhavanti iti antarea upadhgrahaam siddham bhavati . deata api antaratamanirvrttau satym na doa . kriyate etat nyse eva . radbhym nihta na prvasya ca da : deata antaratamanirvrttau satym takragrahaam kartavyam . prakrtita puna antaratamanirvrttau satym nakrasya nihym y antaratam prakrti tatra ah , yatra ah tatra de bhavanti iti antarea takragrahaam siddham bhavati . deata api antaratamanirvrttau satym na doa . kriyate etat nyse eva . (P_1,1.50.3) KA_I,122.1-20 Ro_I,370-372 kim puna idam nirvartakam : antaratam anena nirvartyante , hosvit pratipdakam : anyena nirvrttnm anena pratipatti . ka ca atra viea . sthne antaratamanirvatake sthninivrtti . sthne antaratamanirvatake sarvasthninm nivrtti prpnoti . asya api prpnoti : dadhi madhu . astu . na ka cit anya dea pratinirdiyate . tatra ntaryata dadhiabdasya dadhiabda eva madhuabdasya madhuabda eva dea bhaviyati . yadi ca evam kva cit vairpyam tatra doa syt : bisam bisam , musalam musalam . iko iti atvam prpnoti . api ca i vyavasth na prakalpeta . tat yath tapte bhrre til kipt muhrtam api na avatihante evam ime var muhrtam api na avatiheran . astu tarhi pratipdakam : anyena nirvrttnm anena pratipatti . nirvrttapratipattau nirvrtti . nirvrttapratipattau nirvrtti na sidhyati . sarve sarvatra prpnuvanti . kim tarhi ucyate nirvrtti na sidhyati iti . na sdhya nirvrtti siddh bhavati . na brma nirvrtti na sidhyati iti . kim tarhi . i vyavasth na prakalpeta . na sarve sarvatra iyante . idam idnm kimartham syt . anarthakam ca . anarthakam etat syt . ya hi bhuktavantam bryt m bhukth iti kim tena krtam syt . uktam v . kim uktam . siddham tu ahyadhikre vacant iti . ahyadhikre ayam yoga kartvya : sthne antaratama ahnirdiasya . (P_1,1.50.4) KA_I,122.21-123.16 Ro_I,372-373 pratytmavacanam ca . pratytmam iti ca vaktavyam . kim prayojanam . ya yasya antaratama sa tasya sthne yath syt anyasya antaratama anyasya sthne m bht iti . pratytmavacanam aiyam svabhvasiddhatvt . pratytmavacanam aiyam . kim kraam . svabhvasiddhatvt . svabhvata etat siddham . tat yath : samjeu sameu samavyeu ca syatm iti ucyate . na ca ucyate pratytmam iti pratytmam ca sate . antaratamavacanam ca . antaratamavacanam ca aiyam . yoga ca api ayam aiya . kuta . svabhvasiddhatvt eva . tat yath : samjeu sameu samavyeu ca syatm iti ukte na eva kr krai saha sata na pava pubhi . yem eva kim cit arthakrtam ntaryam tai eva sa sate . tath gva divasam caritavatya ya yasy prasava bhavati tena saha erate . tath yni etni goyuktakni saghuakni bhavanti tni anyonyam payanti sabdam kurvanti . evam tvat cetanvatsu . acetaneu api . loa kipta bhuvegam gatv na eva tiryak gacchati na rdhvam rohati prthivvikra prthivm gacchati ntaryata . tath y et ntarikya skm pa tsm vikra dhma sa kadee nivte na eva tiryak gacchati na avk avarohati abvikra apa eva gacchati ntaryata . tath jyotia vikra arci kadee nivte suprajvalita na eva tiryak gacchati na avk avarohati jyotia vikra jyoti eva gacchati ntaryata . (P_1,1.50.5) KA_I,123.17-125.15 Ro_I, 373-377 vyajanasvaravyatikrame ca tatklaprasaga . vyajanavyatikrame svaravyatikrame ca tatklat prpnoti .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (70 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

vyajanavyatikrame : iam uptam . ntaryata ardhamtrikasya vyajanasya ardhamtrika ik prpnoti . na eva loke na ca vede ardhamtrika ik asti . ka tarhi . mtrika . ya asti sa bhaviyati . svaravyatikrame : dadhi atra madhu atra kumr atra brahmabandhvartham iti . ntaryata mtrikasya dvimtrikasya ika mtrika dvimtrika v ya prpnoti . na eva loke na ca vede mtrika dvimtrika v ya asti .ka tarhi . ardhamtrika . ya asti sa bhaviyati . aku ca anekavardeeu . aku ca anekavardeeu tatklat prpnoti . idama i : ntaryata ardhtrtyamtrasya idama sthne ardhtrtyamtram ivaram prpnoti . na ea doa . bhvyamnena savarnm grahaam na iti evam na bhaviyati . guavrddhyejbhveu ca . guavrddhyejbhveu ca tatklat prpnoti : khav indra khavendra khav udakam khavodakam khav khave khav h khavoh khav elak khavailak khav odana khavaudana , khav aitikayana khavaitikyana , khav aupagava khavaupagava iti . ntaryata trimtrcaturmtrm sthninm trimtracaturmtr de prpnuvanti . na ea do . tapare guavrddh . nanu ca ta para yasmt sa ayam tapara . na iti ha . tt api para tapara . yadi tt api para tapara rdo ap iti iha eva syt : yava , stava . lava , pava iti atra na syt . na ea takra . ka tarhi . dakra . kim dakre prayojanam . atha kim takre prayojanam . yadi asandehrtha takra dakra api . atha mukhasukhrtha takra dakra api . ejbhve : kurvte kurvthe . ntaryata ardhatrtyamtrasya isajakasya ardhatrtyamtra e prpnoti . na eva loke na ca vede ardhatrtyamtra e asti . rvarasya guavrddhiprasage sarvaprasaga aviet . rvarasya guavrddhiprasage sarvaprasaga . sarve guavrddhisajak rvarasya sthne prpnuvanti . kim kraam . aviet . na hi ka cit viea updyate evajtyaka guavrddhisajaka rvarasya sthne bhavati iti . anupdyamne viee sarvaprasaga . na v rvarasya sthne raparaprasagt avarasya ntaryam . na v ea doa . kim kraam . rvarasya sthne raparaprasagt . u sthne a prasajyamna eva rapara bhavati iti ucyate . tatra rvarasya ntaryata rephavata rephavn akra eva antaratama bhavati . sarvdeaprasaga tu anekltvt . sarvdeaprasaga tu guavrddhisajaka rvarasya prpnoti . kim kraam . anekltvt . anekl it sarvasya iti . na v anekltvasya tadrayatvt rvardeasya avighta . na v ea doa . kim kraam . anekltvasya tadrayatvt . yad ayam u sthne tad anekl . anekltvasya tadrayatvt rvardeasya vighta na bhaviyati . athav anntaryam eva etayo ntaryam . ekasya api antaratam prakrti na asti aparasya api antaratama dea na asti . etat eva etayo ntaryam . samprayoga v navadagdharathavat . atha v navadagdharathavat samprayoga bhavati . tat yath : tava ava naa mama api ratha dagdha . ubhau samprayujyvahai iti . evam iha api : tava api antaratam prakrti na asti mama api antaratama dea na asti . astu nau samprayoga iti . viama upanysa . cetanvatsu artht prakarat v loke samprayoga bhavati . var ca puna acetan . tatra kikrta samprayoga . yadi api var acetan ya tu asau prayukte sa cetanvn . ejavarayo dee avaram sthnina avarapradhnatvt . ejavarayo dee avaram prpnoti :khav elak , ml aupagava . kim kraam . sthnina avarapradhnatvt . sthn hi atra avarapradhna . siddham tu ubhayntaryt . siddham etat . katham . ubhayo ya antaratama tena bhavitavyam . na ca avaram ubhayo antaratamam . (P_1,1.51.1) KA_I,125.17-126.19 Ro_I,378-381 kim idam uraraparavacanam

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (71 of 190) [3/8/2008 12:51:10 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

anyanivrttyartham : u sthne a eva bhavati rapara ca iti , hosvit raparatvam anena vidhyate : u sthne a ca ana ca a tu rapara eva . ka ca atra viea . uraraparavacanam anyanivrttyartham cet udttdiu doa . uraraparavacanam anyanivrttyartham cet udttdiu doa bhavati . ke puna udttdaya . udttnudttasvaritnunsik . krti , hrti , krtam , hrtam , prakrtam , prahrtam nrm phi . astu tarhi u sthne a ca ana ca a tu rapara iti . ya u sthne sa rapara iti cet guavrddhyo avarpratipatti . ya u sthne sa rapara iti cet guavrddhyo avarpratipatti . kart hart vragaya . kim hi sdhya rvarasya asavare yat avaram syt na puna eaicau . prvasmin api pake ea doa . kim hi sdhya tatra api rvarasya asavare yat avaram syt na puna ivarovarau . atha matam etat u sthne aa ca anaa ca prasage a eva bhavati rapara ca iti siddh prvasmin pake avarasya pratipatti . yat tu tat uktam udttdiu doa bhavati iti iha sa doa jyate . na jyate . jyate sa doa . katham . udtta iti anena aa api pratinirdiyante anaa api . yadi api pratinirdiyante na tu prpnuvanti . kim kraam . sthne antaratama bhavati . kuta nu khalu dvayo paribhayo svakayo samavasthitayo sthne antaratama u a rapara iti ca sthne antaratama iti anay paribhay vyavasth bhaviyati na puna u a rapara iti . ata kim . ata ea doa jyate : udttdiu doa iti . ye ca api ete rvarasya sthne pratipadam de ucyante teu raparatvam na prpnoti : rta it dhto ut ohyaprvasya iti . siddham tu prasage raparatvt . siddham etat . katham . prasage raparatvt . u sthne a prasajyamna eva rapara bhavati iti . kim vaktavyam etat . na hi . katham anucyamnam gasyate . sthne iti vartate sthnaabda ca prasagavc . yadi evam dea avieita bhavati . dea ca vieita . katham . dvityam sthnagrahaam prakrtam anuvartate. tatra evam abhisambandha kariyate : u sthne a sthne iti . u prasage a prasajyamna eva rapara bhavati . (P_1,1.51.2) KA_I,126.20-127.3 Ro_I,382 atha agrahaam kimartham na u rapara iti eva ucyeta . u rapara iti iyati ucyamne ka idnm rapara syt . ya u sthne bhavati . ka ca u sthne bhavati . dea . dea rapara iti cet rrividhiu raparapratiedha . dea rapara iti cet rrividhiu raparatvasya pratiedha vaktavya . ke puna rrividhaya . akalopnaanarride . aka: saudhtaki . lopa : paitrvaseya . na : hotpotrau . ana : kart hart . r : mtryati pitryati . ri : kriyate hriyate . udttdiu ca . kim . raparatvasya pratiedha vaktavya . krti , hrti , krtam , hrtam , prakrtam , prahrtam nrm phi . tasmt agrahaam kartavyam . (P_1,1.51.3) KA_I,127.4-24 Ro_I,382-385 ekdeasya upasakhynam . ekdeasya upasakhynam kartavyam : khavarya , mlarya . kim puna kraam na sidhyati . u sthne a prasajyamna eva rapara bhavati iti ucyate na ca ayam u eva sthne a iyate . kim tarhi . u ca anyasya ca . avayavagrahat siddham . yat atra rvaram tadrayam raparatvam bhaviyati . tat yath m na bhoktavy iti mir api na bhujyante . avayavagrahat siddham iti cet dee rntapratiedha . avyayavagrahat siddham iti cet dee rntasya pratiedha vaktavya : hotpotrau . yath eva u ca anyasya ca sthne a rapara bhavati evam ya u sthne a ca ana ca sa api rapara syt . yadi puna rvarntasya sthnina raparatvam ucyeta : khavarya , mlarya . na evam
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (72 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

akyam . iha hi doa syt : kart hart kirati girati . rvarntasya iti ucyate . na ca etat rvarntam . nanu ca etat api vyapadeivadbhvena rvarntam . arthavat vyapadeivadbhva na ca ea arthavn . tasmt na evam akyam . na cet evam upasakhynam kartavyam . iha ca raparatvapratiedha vaktavya : mtu , pitu iti . ubhayam na vaktavyam . katham . iha ya dvayo ahnirdiayo prasage bhavati labhate asau anyatarata vyapadeam . tat yath devadattasya putra , devadatty putra iti . katham mtu pitu iti . astu atra raparatvam . k rpasiddi . rt sasya iti sakrasya lopa rephasya visarjanya . na evam akyam . iha hi mtu karoti , pitu karoti iti apratyayavisarjanyasya iti atvam prasajyeta . apratyayasvisarjanyasya iti ucyate . pratyayavisarjanya ca ayam . lupyate atra pratyaya rt sasya iti . evam tarhi bhrtuputragrahaam jpakam ekdeanimittt atvapratiedhasya . yat ayam kaskdiu bhrtuputraabdam pahati tat jpayati crya na ekdeanimitttt atvam bhavati iti. (P_1,1.51.4) KA_I,127.25-130.2 Ro_I,385-391 kim puna ayam prvnta hosvit pardi hosvit abhakta . katham ca ayam prvnta syt katham v pardi katham v abhakta . yadi anta iti vartate tata prvnta . atha di iti vartate tata pardi . atha ubhayam nivrttam tata abhakta . ka ca atra viea . abhakte drghalatvayagabhyastasvarahaldieavisarjanyapratiedha pratyayvyavasth ca . yadi abhakta drghatvam na prpnoti : g , p . rephavakrntasya dhto iti drghatvam na prpnoti . kim puna kraam rephavakrbhym dhtu vieyate na puna padam vieyate rephavakrntasya padasya iti . na evam akyam . iha api prasajyeta : agni , vyu iti . evam tarhi rephavakrbhym padam vieayiyma dhtun ikam : rephavakrntasya padasya ika dhto iti . evam api priyam grmai kulam asya priyagrmai , priyasenni atra api prpnoti . tasmt dhtu eva vieyate . dhtau ca vieyame iha drghatvam na prpnoti : g , p . drgha . latva : latvam ca na sidhyati : nijegilyate . gra yai iti latvam na prpnoti . na ea doa . gra iti anantarayog e ah . evam api sva jegilyate iti atra api prpnoti . evam tarhi ya nantaryam vieayiyma . atha v gra iti pacam . latva . yaksvara : yaksvara ca na sidhyati . gryate svayam eva , puryate svayam eva . aca kartryaki iti ea svara na prpnoti rephea vyavahitatvt . na ea doa . svaravidhau vyajanam avidyamnavat iti na asti vyavadhnam . yaksvara . abhyastasvara : abhyastasvara ca na sidhyati : ma hi sma te piparu , ma hi sma te bibharu . abhyastnm di udtta bhavati ajdau lasrvadhtuke iti ea svara na prpnoti rephea vyavahitatvt . na ea doa . svaravidhau vyajamam avidyamnavat iti na asti vyavadhnam . abhyastasvara . haldiea : haldiea ca na sidhyati : vavrte vavrdhe . abhysasya iti haldiea na prpnoti . haldiea . visarjanya : visarjanyasya ca pratiedha vaktavya : nrkua , nrpatya . kharavasnayo visarjanya iti visarjanya prpnoti . visarjanya . pratyayvyavasth : pratyaye vyavasth na prakalpate : kirata , girata . repha api abhakta pratyaya api . tatra vyavasth na prakalpate . evam tarhi prvnta kariyate . prvnte rvavadhraam visarjanyapratiedha yaksvara ca . yadi prvnta ro avadhraam kartavyam : ro supi . ro eva supi na anyasya rephasya : sarpiu dhanuu . iha m bht : gru pru . pardau api sati avadhraam kartavyam caturu iti evam artham . visarjanyapratiedha : visarjanyasya ca pratiedha vaktavya : nrkua , nrpatya . kharavasnayo visarjanya iti visarjanya prpnoti . pardau api visarjanyasya pratiedha
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (73 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

vaktavya nrkalpi iti evamartham . kalpipadasaghtabhakta asau na utsahate avayavasya padntatm vihantum iti krtv visarjanya prpnoti . yaksvara : yaksvara ca na sidhyati : gryate svayam eva , puryate svayam eva . aca kartryaki iti ea svara na prpnoti . na ea doa . upadee iti vartate . atha v puna astu pardi . pardau akralopautvapukpratiedha cai upadhhrasvatvam ia avyavasth abhysalopa abhyastatdisvara drghatvam ca . yadi pardi akralopa pratiedhya : kart hart : ata lopa rdhadhtuke iti akralopa prpnoti . na ea doa . upadee iti vartate . yadi upadee iti vartate dhinuta , kruta atra lopa na prpnoti . na upadeagrahaena prakrti abhisambadhyate . kim tarhi . rdhadhtukam abhisambadhyate . rdhadhtukopadee yat akrntam iti . akralopa . autva : autvam ca pratiedhyam : cakra jahra . ta au ala iti autvam prpnoti . na ea doa . nirdiyamnasya de bhavanti iti evam na bhaviyati . ya tarhi nirdiyate tasya kasmt na bhavati . rephena vyavahitatvt . autva . pukpratiedha : puk ca pratiedhya : krayati hrayati . tm puk iti puk prpnoti . pukpratiedha . cai upadhhrasvatvam ca na sidhyati : ackarat ajharat . au cai upadhy hrasva iti hrasvatvam na prpnoti . cai upadhhrasvatvam . ia avyavasth : ia ca vyavasth na prakalpate : starit niparit . i api pardi repha api . tatra vyavasth na prakalpate . ia avyavasth . abhysalopa : abhysalopa ca vaktavya : vavrte vavrdhe . abhysasya iti haldiea na prpnoti . abhysalopa . abhyastasvara : abhyastasvara ca na sidhyati : ma hi sma te piparu , ma hi sma te bibharu . abhyastnm di udtta bhavati ajdau lasrvadhtuke iti ea svara na prpnoti . abhyastasvara . tdisvara : tdisvara ca na sidhyati : prakart prakartum , prahart prahartum . tdau ca niti krti atau iti ea svara na prpnoti . na ea doa . uktam etat : krdupadee v tdyartham iartham iti . tdisvara . drghatvam : drghatvam ca na sidhyati : g , p . rephavakrntasya dhto iti drghatvam na prpnoti . (P_1,1.52.1) KA_I,130.4-11 Ro_I,391-392 kim idam algrahaam antyavieaam hosvit deavieaam . kim ca ata . yadi antyavieaam dea avieita bhavati . tatra ka doa . anekl api dea antyasya prasajyeta . yadi puna al antyasya iti ucyeta . tatra ayam api artha anekl it sarvasya iti etat na vaktavyam bhavati . idam niyamrtham bhaviyati : al eva antyasya bhavati na anya iti . evam api antya avieita bhavati . tatra ka doa . vkyasya api padasya api antyasya prasajyeta . yadi khalu api ea abhiprya tat na kriyeta iti antyavieae api sati tat na kariyate . katham . it ca ala antyasya iti etat niyamrtham bhaviyati : it eva anekl antyasya bhavati na anya iti . (P_1,1.52.2) KA_I,130.12-20 Ro_I,392-394 kimartham puna idam ucyate . ala antyasya iti sthne vijtasya anusahra . ala antyasya iti sthne vijtasya anusahra kriyate sthne prasaktasya . itarath hi aniaprasaga . itarath hi aniaprasaga prasajyeta . itkinmita api antyasya syu . yadi puna ayam yogaea vijyeta . yogaee ca . kim . aniam prasajyete . itkinmita api antyasya syu . tasmt suhu ucyate : ala antyasya iti sthne vijtasya anusahra itarath hi aniaprasaga iti . (P_1,1.53) KA_I,130.21-131.7 Ro_I,394-395 tta antyasya kasmt na bhavati . it ca ala antyasya iti prpnoti . ttai itkaraasya svakatvt vipratiedht sarvdea . ttai itkaraasya svakam . ka avaka . guavrddhipratiedhrtha akra . ttai
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (74 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

itkaraasya svakatvt vipratiedht sarvdea bhaviyati . prayojanam nma tat vaktavyam yat niyogata syt . yadi ca ayam niyogata sarvdea syt tata etat prayojanam syt . kuta nu khalu etat itkarat ayam sarvdea bhaviyati na puna antyasya syt iti . evam tarhi etat eva jpayati na tta antyasya sthne bhavati iti yat etam itam karoti . itarath hi loa eruprakarae eva bryt tihyo tt ii anyatarasym iti . (P_1,1.54) KA_I,131.9-17 Ro_I,395-396 ala antyasya ade parasya anekl it sarvasya iti apavdavipratiedht sarvdea . ala antyasya iti utsarga . tasya de parasya aneklit sarvasya iti apavdau . apavdavipratiedht tu sarvdea bhaviyati . de parasya iti asya avaka dvyantarupasargebhya apa t : dvpam anvpam . aneklit sarvasya iti asya avaka aste bh : bhavit bhavitum . iha ubhayam prpnoti : ata bhisa ais . aneklit sarvasya iti etat bhavati vipratiedhena . it sarvasya iti asya avaka idama i : ita , iha . de parasya iti asya avaka sa eva . iha ubhayam prpnoti : abhya au . it sarvasya iti etat bhavati vipratiedhena . (P_1,1.55) KA_I,131.19-132.7 Ro_I,396-397 it sarvasya iti kim udharaam . idama i : ita , iha . na etat asti prayojanam . itkarat eva atra sarvdea bhaviyati . idam tarhi : abhya au . nanu ca atra api itkarat eva sarvdea bhaviyati . idam tarhi : jasa jaaso i . nanu ca atra api itkarat eva sarvdea bhaviyati . asti anyat itkarae prayojanam . kim . vieartha . kva viearthena artha . i sarvanmasthnam vibh iyo iti . it sarvasya iti akyam akartum . katham . antyasya ayam sthne bhavan na pratyaya syt . asatym pratyayasajym itsaj na syt . asatym itsajym lopa na syt . asati lope anekl . yad anekl tad sarvdea . yad sarvdea tada pratyaya . yad pratyaya tad itsaj . yad itsaj tad lopa . evam tarhi siddhe sati yat it sarvasya iti ha tat jpayati crya asti e paribh : na anubandhakrtam anekltvam bhavati iti . kim etasya jpane prayojanam . tatra asarpasarvdeppratiedheu prthaktvanirdea ankrntatvt iti uktam . tat na vaktavyam bhavati iti . (P_1,1.56.1) KA_I,133.2-16 Ro_I,398-401 vatkaraam kimartham . sthn dea analvidhau iti iyati ucyamne sajdhikara ayam tatra sthn deasya saj syt . tatra ka doa . a yamahana tmanepadam bhavati iti vadhe eva syt . hante na syt . vatkarae puna kriyame na doa bhavati . sthnikryam dee atidiyate guruvat guruputra iti yath . atha deagrahaam kimartham . sthnivat analvidhau iti iyati ucyamne ka idnm sthnivat syt . ya sthne bhavati . ka ca sthne bhavati . dea . idam tarhi prayojanam deamtram sthnivat yath syt . ekadeavikrtasya upasakhynam codayiyati . tat na vaktavyam bhavati . atha vidhigrahaam kimartham. sarvavibhaktyanta samsa yath vijyeta : ala parasya vidhi alvidhi , ala vidhi alvidhi , ali vidhi alvidhi , al vidhi alvidhi iti . na etat asti prayojanam . prtipadikarnirdea ayam . prtipadikarnirde ca arthatantr bhavanti . na k cit prdhnyena vibhaktim rayanti . tatra prtipadikrthe nirdie ym ym vibhaktim rayitum buddhi upajyate s s rayitavy . idam tarhi prayojanam : uttarapadalopa yath vijyeta : alam rayate alraya , alraya vidhi alvidhi iti . yatra prdhnyena al ryate tatra eva pratiedha syt . yatra vieaatvena al ryate tatra pratiedha na syt . kim prayojanam . pradvya prasvya iti valdilakaa i m bht iti .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (75 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(P_1,1.56.2) KA_I,133.17-134.9 Ro_I,401-402 kimartham puna idam ucyate . sthnydeaprthaktvt dee sthnivadanudea guruvat guruputre iti yath . anya sthn anya dea . sthnydeaprthaktvt etasmt krat sthnikryam dee na prpnoti . tatra ka doa . a yamahana tmanepadam bhavati iti hante eva syt vadhe na syt . iyate ca vadhe api syt iti . tat ca antarea yatnam na sidhyati . tasmt . sthnivadanudea . evamartham idam ucyate . guruvat guruputra iti yath . tat yath guruvat asmin guruputre vartitavyam iti gurau yat kryam tat guruputre atidiyate , evam iha api sthnikryam dee atidiyate . na etat asti prayojanam . lokata etat siddham . tat yath loke ya yasya prasage bhavati labhate asau tatkryi . tat yath updhyyasya iya yjyakulni gatv agrsandni labhate . yadi api tvat loke ea drnta drntasya api tu pururambha nivartaka bhavati . asti ca iha ka cit pururambha . asti iti ha . ka . svarpavidhi . hante tmanepadam ucyamnam hante eva syt vadhe na syt . evam tarhi cryapravrtti jpayati sthnivat dea bhavati iti yat ayam yumadasmado andee iti deapratiedham sti . katham krtv jpakam . yumadasmado vibhaktau kryam ucyamnam ka prasaga yat dee syt . payati tu crya sthnivat dea bhavati iti . ata dee pratiedham sti . idam tarhi prayojanam : analvidhau iti pratiedham vakymi iti , iha m bht : dyau , panth , sa iti . etat api na asti prayojanam . cryapravrtti jpayati alvidhau sthnivadbhva na bhavati iti yat ayam ada jagdhi lyap ti kiti iti ti kiti iti eva siddhe lyabgrahaam karoti . tasmt na artha anena yogena . (P_1,1.56.3) KA_I,134.10-135.8 Ro_I,403-406 rabhyame api etasmin yoge alvidhau pratiedhe avieae aprpti tasya adarant . alvidhau pratiedhe asati api vieae samryamae asati tasmin vieae aprpti vidhe : pradvya prasvya . kim kraam . tasya adarant . valde iti ucyate na ca atra valdim payma . nanu ca evamartha eva ayam yatna kriyate : anyasya kryam ucyamnam anyasya yath syt iti . satyam evamartha na tu prpnoti . kim kraam . smnytidee vienatidea . smanye hi atidiyamne viea na atidia bhavati . tat yath : brahmaavat asmin katriye vartitavyam iti smnyam yat brhmaakryam tat katriye atidiyate . yat viiam mhare kauinye v na tat atidiyate . evam iha api smnyam yat pratyayakryam tat atidiyate yat viiam valde iti na tat atidiyate . yadi evam agraht iti ia i iti sica lopa na prpnoti . analvidhau iti puna ucyamne iha api pratiedha bhaviyati : pradvya prasvya iti . viiam hi ea alam rayate valam nma . iha ca pratiedha na bhaviyati : agraht iti . viiam hi ea analam rayati iam nma . yadi tarhi smnyam api atidiyate viea ca sati raye vidhi ia . sati ca valditve i bhavitavyam : aruditm aruditam arudita . kim ata yat sati bhavitavyam . pratiedha tu prpnoti alvidhitvt . pratiedha tu prpnoti . kim kraam . alvidhitvt . alvidhi ayam bhavati . tatra analvidhau iti pratiedha prpnoti . na v nudeikasya pratiedht itarea bhva . na v ea doa . kim kraam . nudeikasya pratiedht . astu atra nudeikasya valditvasya pratiedha . svrayam atra valditvam bhaviyati . na etat vivadmahe valdi na valdi iti . kim tarhi . sthnivadbhvt srvadhtukatvam eitavyam . tatra analvidhau iti pratiedha prpnoti . (P_1,1.56.4) KA_I,135.9-136.4 Ro_I,406-408 kim puna deini ali ryame pratiedha bhavati hosvit avieea dee deini ca . ka ca atra viea . deyalvidhipratiedhe
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (76 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

kuruvadhapibm guavrddhipratiedha . deyalvidhipratiedhe kuruvadhapibm guavrddhipratiedha vaktavya . kuru iti atra sthnivadbhvt agasaj vrayam ca laghpadhatvam . tatra laghpadhagua prpnoti . vadhakam iti atra sthnivadbhvt agasaj vrayam ca adupadhatvam . tatra vrddhi prpnoti . piba iti atra sthnivadbhvt agasaj vrayam ca laghpadhatvam . tatra gua prpnoti . astu tarhi avieea dee deini ca . deydee iti cet suptikrdatidieu upasakhynam . deydee iti cet suptikrdatidieu upasakhynam kartavyam . sup : vrkya plakya . sthnivadbhvt supsaj svrayam ca yaditvam . tatra pratiedha prpnoti . sup . ti : aruditm aruditam arudita . sthnivadbhvt srvadhtukasaj svrayam ca valditvam . tatra pratiedha prpnoti . ti . krdatidiam : bhuvanam , suvanam , dhuvanam . sthnivadbhvt pratyayasaj svrayam ca ajditvam . tatra pratiedha prpnoti . kim puna atra jyya . deini ali ryame pratiedha iti jyya . kuta etat . tath hi ayam viiam sthnikryam dee atidiati guruvat guruputre iti yath . tat yath : guruvat guruputre vartitavyam anyatra ucchiabhojant pdopasagrahac ca iti . yadi ca guruputra api guru bhavati tat api kartavyam . astu tarhi deini ali ryame pratiedha . nanu ca uktam deyalvidhipratiedhe kuruvadhapibm guavrddhipratiedha iti . na ea doa . karotau taparakaraanirdet siddham . pibati adanta . vadhakam iti na ayam vul . anya ayam akaabda kit audika rucaka iti yath . (P_1,1.56.5) KA_I,136.5-137.2 Ro_I,408-411 ekadeavikrtasya upasakhynam . ekadeavikrtasya upasakhynam kartavyam . kim prayojanam . pacatu pacantu . tigrahaena grahaam yath syt . ekadeavikrtasya ananyatvt siddham . ekadeavikrtam ananyavat bhavati iti tigrahaena grahaam bhaviyati . tat yatha : v kare v pucche v chinne v eva bhavati na ava na gardabha iti . anityatvavijnam tu tasmt upasakhyanam . anityatvavijnam tu bhavati . nity abd . nityeu nma abdeu kasthai aviclibhi varai bhavitavyam anapyopajanavikribhi . tatra sa eva ayam vikrta ca etat nityeu na upapadyate . tasmt upasakhyanam kartavyam . bhradvjy pahanti : ekadeavikrteu upasakhynam . ekadeavikrteu upasakhynam kartavyam . kim prayojanam . pacatu pacantu : tigrahaena grahaam yath syt . kim ca kraam na syt . andeatvt . dea sthnivat iti ucyate , na ca ime de . rpnyatvt ca . anyat khalu api rpam pacati iti anyat pacatu iti . ime api de . katham . diyate ya sa dea . ime ca api diyante . dea sthnivat iti cet na anritatvt . dea sthnivat iti cet tat na . kim kraam . anritatvt . ya atra dea na asau ryate ya ca ryate na asau dea . na etat mantavyam : samudye ryame avayava na ryate iti . abhyantara hi samudyasya avayava . tat yath : vrka pracalan saha avayavai pracalati . raya iti cet alvidhiprasaga . raya iti cet alvidhi ayam bhavati . tatra analvidhau iti pratiedha prpnoti . na ea doa . na evam sati ka cit api analvidhi syt . ucyate ca idam analvidhau iti . tatra prakaragati vijsyate : sdhya ya alvidhi iti . ka ca sdhya alvidhi . yatra prdhnyena al ryate . yatra nntaryaka al ryate na asau alvidhi . atha v uktam deagrahaasya prayojanam : deamtram sthnivat yath syt iti . (P_1,1.56.6) KA_I,137.3-26 Ro_I,411-412 anupapannam sthnydeatvam nityatvt . sthn dea iti etat nityeu abdeu na upapadyate . kim kraam . nityatvt . sthn hi nm ya
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (77 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

bhtv na bhavati . dea hi nma ya abhtv bhavati . etat ca nityeu abdeu na upapadyate yat sata nma vina syt asata v prdurbhva iti . siddham tu yath laukikavaidikeu abhtaprve api sthnaabdaprayogt . siddham etat . katham . yath laukikeu vaidikeu ca krtnteu abhtaprve api sthnaabda vartate . loke tvat : updhyyasya sthne iya iti ucyate na ca tatra updhyya bhtaprva bhavati . vede api : somasya sthne ptkatrni abhiuuyt iti ucyate na ca tatra soma bhtaprva bhavati . kryaviparimt v siddham . atha v kryaviparimt siddham etat . kim idam kryaviparimt iti . kry buddhi . s vipariamyate . nanu ca kryviparimt iti bhavitavyam . santi ca eva hi auttarpadikni hrasvatvni . api ca buddhi sampratyaya iti anarthntaram . kry buddhi krya sampratyaya kryasya sampratyayasya viparima kryaviparima kryaviparimt iti . parihrantaram eva idam matv pahitam . katham ca idam parihrntaram syt . yadi bhtaprve sthnaabda vartate . bhtaprve ca api sthnaabda vartate . katham . buddhy . tat yath ka cit kasmai cit upadiati prcnam grmt mr iti . tasya sarvatra mrabuddhi prasakt . tata pact aha ye kria avarohavanta prthupar te nyagrodh iti. sa tatra mrabuddhy nyagrodhabuddhim pratipadyate . sa tata payati buddhy mrn ca apakryamn nyagrodhn ca dhyamnn . nity eva ca svasmin viaye mr nity ca nyagrodh . buddhi tu asya vipariamyate . evam iha api asti asmai avieea upadia . tasya sarvatra astibuddhi prasakt . sa aste bh iti astibuddhy bhavatibuddhim pratipadyate . sa tata payati buddhy astim ca apakryamam bhavatim ca dhyamnam . nitya eva svasmin viaye asti nitya bhavati . buddhi tu asya vipariamyate . (P_1,1.56.7) KA_I,138.1-10 Ro_I,413-414 apavdaprasaga tu sthnivattvt . apavde utsargakrtam ca prpnoti . karmai a ta anupasarge ka iti ke api ai krtam prpnoti . kim kraam . sthnivattvt . uktam v . kim uktam . viayea tu nnligakarat siddham iti . atha v . siddham tu ahnirdiasya sthnivadvacant . siddham etat . katham . ahnirdiasya dea sthnivat iti vaktavyam . tat tarhi ahnirdiagrahaam kartavyam . na kartavyam . prakrtam anuvartate . kva prakrtam . ah sthneyog iti . atha v cryapravrtti jpayati na apavde utsargakrtam bhavati iti yat ayam yandnm kn cit ita karoti : yan , nam , n , a , nu iti . (P_1,1.56.8) KA_I,138.11-141.22 Ro_I,414-421 tasya doa taydee ubhayapratiedha . tasya etasya lakaasya doa : taydee ubhayapratiedha vaktavya : ubhaye devamanuy . tayapa grahaena grahat jasi vibh prpnoti . na ea doa . ayac pratyayntaram . yadi pratyayntaram ubhay iti kra na prpnoti . m bht evam . mtraca iti evam bhaviyati . katham . mtrac iti na idam pratyayagrahaam . kim tarhi . pratyhragrahaam . kva sannivinm pratyhra . mtraabdt prabhrti yaca cakrt . yadi pratyhragrahaam kati tihanti atra api prpnoti . ata iti vartate . evam api tailamtr ghrtamtr iti atra api prpnoti . sadrasya api asanniviasya na bhaviyati pratyhrea grahaam . jtyakhyym vacantidee sthnivadbhvapratiedha . jtyakhyym vacantidee sthnivadbhvasya pratiedha vaktavya . vrhibhya gata iti atra ghe iti it gua prpnoti . na ea doa . uktam etat : arthtidet siddham iti . ybgrahae adrgha . ybgrahae adrgha dea na sthnivat iti vaktavyam . kim
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (78 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prayojanam . nikaumbi , atikhava . ybgrahaena grahat sulopa m bht iti . nanu ca drght iti ucyate . tat na vaktavyam bhavati . kim puna atra jyya . sthnivatpratiedha eva jyyn . idam api siddham bhavati : atikhavya atimlya . y pa iti y na bhavati . atha idnm asati api sthnivadbhve drghatve krte pit ca asau bhtaprva iti krtv y pa iti y kasmt na bhavati . lakaapratipadoktayo pratipadoktasya eva iti . nanu ca idnm sati api sthnivadbhve etay paribhay akyam iha upasthtum . na iti ha . na hi idnm kva cit api sthnivadbhva syt . tat tarhi vaktavyam . na vaktavyam. pralianirdet siddham . pralianirdea ayam : * * krntt * p krntt iti . hibhuvo pratiedha . hibhuvo pratiedha vaktavya : ttha abht . astibrgrahaena grahat prpnoti . he tvat na vaktavya . cryapravrtti jpayati na he bhavati iti yat ayam ha tha iti jhaldiprakarae thatvam sti . na etat asti prayojanam. asti hi anyat etasya vacane prayojanam . kim . bhtaprvagati yath vijyeta : jhaldi ya bhtaprva iti . yadi evam thavacanam anarthakam syt . thim eva ayam uccrayet : bruva pacnm dita tha bruva iti . bhavate ca api na vaktavya . astisica aprkte iti dvisakraka nirdea : aste sakrntt iti . vadhydee vrddhitatvapratiedha . vadhydee vrddhitatvapratiedha vaktavya : vadhakam pukaram iti . sthnivadbhvt vrddhitatve prpnuta . na ea doa . uktam etat : na ayam vul . anya ayam akaabda kit audika rucaka iti yath . ividhi ca . ividheya : vadhia . ekca upadee anudttt iti pratiedha prpnoti . na ea doa . dyudttaniptanam kariyate . sa niptanasvara prakrtisvarasya bdhaka bhaviyati . evam api upadeivadbhva vaktavya . yath eva hi niptanasvara prakrtisvaram bdhate evam pratyayasvaram api bdheta : vadhia iti . na ea doa . rdhadhtuky smnyena bhavanti anavasthiteu pratyayeu . tatra rdhadhtukasmnye vadhibhve krte sati iatvt pratyayasvara bhaviyati . krntt nukukpratiedha . krntt nukuko pratiedha vaktavya : vilpayati bhpayate . lbhgrahaena grahat nukukau prpnuta . lbhiyo pralianirdet siddham . lbhiyo pralianirdea ayam : l* * krntasya bh* * krntasya ca iti . lodee bhvajabhvadhitvahilopaittvapratiedha . lodee em pratiedha vaktavya : it , hatt , bhintt , kurutt , stt . lodee krte bhva jabhva dhitvam hilopa ettvam iti ete vidhaya prpnuvanti . na ea doa . idam iha sampradhryam : lodea kriyatm ete vidhaya iti kim atra kartavyam . paratvt lodea . atha idnm lodee krte punaprasagavijnt kasmt ete vidhaya na bhavanti . sakrdgatau vipratiedhe yat bdhitam tat bdhitam eva iti krtv . traydee srantapratiedha . traydee srantasya pratiedha vaktavya : tisrm . tisrbhve krte tre traya iti traydea prpnoti . na ea doa . idam iha sampradhryam : tisrbhva kriyatm traydea iti kim atra kartavyam . paratvt tisrbhva . atha idnm tisrbhve krte punaprasagavijnt traydea kasmt na bhavati . sakrdgatau vipratiedhe yat bdhitam tat bdhitam eva iti . mvidhau ca . mvidhau ca srantasya pratiedha vaktavya : catasra tihanti . catasrbhve krte caturanauho m udtta iti m prpnoti . na ea doa . idam iha sampradhryam : catasrbhva kriyatm caturanauho m udtta iti m iti kim atra kartavyam . paratvt catasrbhva . atha idnm catasrbhve krte punaprasagavijnt m kasmt na bhavati . sakrdgatau vipratiedhe yat bdhitam tat bdhitam eva iti . svare vasvdee . svare vasvdee pratiedha vaktavya : vidua paya . atu anuma nadyajd antodttt iti ea svara prpnoti . na ea doa . anuma iti pratiedha bhaviyati . anuma iti ucyate na ca atra numam payma . anuma
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (79 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

iti na idam gamagrahaam . kim tarhi . pratyhragrahaam . kva sannivinm pratyhra . ukrt prabhrti numa makrt . yadi pratyhragrahaam lunata punata atra api prpnoti . anumgrahaena na atrantam vieyate . kim tarhi . at eva vieyate : at ya anumka iti . avayam ca etat evam vijeyam . gamagrahae hi sati iha prasajyeta : mucat mucata iti . go prvaittvtvasvareu . go prvaittvtvasvareu pratiedha vaktavya : citragvagram , abalagvagram . sarvatra vibh go iti vibh prvatvam prpnoti . na ea doa . ea iti vartate . tatra analvidhau iti pratiedha bhaviyati . evam api he citrago agram atra prpnoti . ittvam : citragu , citrag citragava . goto it iti ittvam prpnoti . tvam : citragum paya abalagum paya . ota iti tvam prpnoti . na ea doa . taparakarat siddham . taparakaraasmrthyt ittvtve na bhaviyata . svara : bahugumn . na govansvavara iti pratiedha prpnoti . karotipibyo pratiedha . karotipibyo pratiedha vaktavya : kuru piba iti . sthnivadbhvt laghpadhagua prpnoti . uktam v . kim uktam . karotau taparakaraanirdet siddham , pibati adanta iti . (P_1,1.57.1) KA_I,141.24-144.17 Ro_I,421-431 aca iti kimartham . prana , dytv , krm gatya . prana , vina iti atra chakrasya akra paranimittaka . tasya sthnivadbhvt che ca iti tuk prpnoti . aca iti vacant na bhavati . na etat asti prayojanam . kriyame api vai ajgrahae avayam atra tugabhve yatna kartavya . antaragatvt hi tuk prpnoti . idam tarhi : dytv . vakrasya h paranimittaka . tasya sthnivadbhvt aci iti yadea na prpnoti . aca iti vacant bhavati . etat api na asti prayojanam . svrayam atra actvam bhaviyati . atha v ya atra dea na asau ryate ya ca ryate na asau dea . idam tarhi prayojanam : krm . sica lopa paranimittaka . tasya sthnivadbhvt aho ka si iti katvam prpnoti . aca iti vacant bhavati . etat api na asti prayojanam .vakyati etat : prvatrsiddhe na sthnivat iti . idam tarhi prayojanam : gatya , abhigatya . anunsikalopa paranimittaka . tasya sthnivadbhvt hrasvasya iti tuk na prpnoti . aca iti vacant bhavati . atha parasmin iti kimartham . yuvajni , dvipadik , vaiyghrapadya , ddhye . yuvajni , vadhjni iti : jyy ni na paranimittaka . tasya sthnivadbhvt vali iti yalopa na prpnoti . parasmin iti vacant bhavati . na etat asti prayojanam . svrayam atra valtam bhaviyati . atha v ya atra dea na asau ryate ya ca ryate na asau dea . idam tarhi prayojanam : dvipadik tripadik . pdasya lopa na paranimittaka . tasya sthnivadbhvt padbhva na prpnoti . parasmin iti vacant bhavati . etat api na asti prayojanam . punarlopavacanasmarthyt sthnivadbhva na bhaviyati . idam tarhi prayojanam : vaiyghrapadya . nanu ca atra api punarvacanasmarthyt eva na bhaviyati . asti hi anyat punarlopavacane prayojanam . kim . yatra bhasaj na : vyghrapt , yenapt iti . idam ca api udharaam : ddhye , vevye . ikrasya ekra na paranimittaka . tasya sthnivadbhvt yvarayo ddhvevyo iti lopa prpnoti . parasmin iti vacant bhavati . atha prvavidhau iti kim artham . he gau , bbhravy , naidheya . he gau iti aukra paranimittaka . tasya sthnivadbhvt ehrasvt sambuddhe iti lopa prpnoti . prvavidhau iti vacant na bhavati . na etat asti prayojanam . cryapravrtti jpayati na sambuddhilope sthnivadbhva bhavati iti yat ayam ehrasvt sambuddhe iti egrahaam karoti . na etat asti jpakam . gortham etat syt . yat tarhi pratyhragrahaam karoti . itarath hi ohrasvt iti eva bryt . idam tarhi prayojanam : bbhravy , mdhavy . vntdea paranimittaka . tasya sthnivadbhvt hala taddhitasya iti yalopa na prpnoti .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (80 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prvavidhau iti vacant na bhavati . etat api na asti prayojanam . svrayam atra haltvam bhaviyati . atha v ya atra dea na asau ryate ya ca ryate na asau dea . idam tarhi prayojanam : naidheya . kralopa paranimittaka . tasya sthnivadbhvt dvyajlakaa hak na prpnoti . prvavidhau iti vacant na bhavati . atha vidhigrahaam kimartham . sarvavibhaktyanta samsa yath vijyeta : prvasya vidhi prvavidhi , prvasmt vidhi prvavidhi iti . kni puna prvasmt vidhau sthnivadbhvasya prayojanni . bebhidit , mthitika , appacan . bebhidit , cecchidit iti akralope krte ekjlakaa ipratiedha prpnoti . sthnivadbhvt na bhavati . mthitika iti akralope krte tntt ka iti kdea prpnoti . sthnivadbhvt na bhavati . appacan iti ekdee krte abhyastt jhe jus bhavati iti jusbhva prpnoti . sthnivadbhvt na bhavati . na etni santi prayojanni . kuta . prtipadikarnirdea ayam . prtipadikarnirde ca arthatantr bhavanti . na k cit prdhnyena vibhaktim rayanti . tatra prtipadikrthe nirdie ym ym vibhaktim rayitum buddhi upajyate s s rayitavy . idam tarhi prayojanam : vidhimtre sthnivat yath syt anryamym api prakrtau : vyvo , adhvaryvo . lopa vyo vali iti yalapa m bht iti . asti prayojanam etat . kim tarhi iti . aparavidhau iti tu vaktavyam . kim prayojanam . svavidhau api sthnivadbhva yath syt . kni puna svavidhau sthnivadbhvasya prayojanni . yan , san , dhinvanti krvanti dadhi atra , madhu atra cakratu , cakru . iha tvat : yan , san iti iastyo yalopayo krtayo anajditvt ajdnm iti na prpnoti . sthnivadbhvt bhavati . dhinvanti krvanti iti yadee krte valdilakaa i prpnoti . sthnivadbhvt na bhavati . dadhi atra madhu atra iti yadee krte sayogntalopa prpnoti . sthnivadbhvt na bhavati . cakratu , cakru iti yadee krte anactvt dvirvacanam na prpnoti . sthnivadbhvt bhavati . yadi tarhi svavidhau api sthnivadbhva bhavati dvbhym , deyam , lavanam atra api prpnoti . dvbhym iti atra atvasya sthnivadbhvt drghatvam na prpnoti . deyam iti ttvasya sthnivadbhvt gua na prpnoti . lavanam iti guasya sthnivadbhvt avdea na prpnoti . na ea doa . svray atra ete vidhaya bhaviyanti . tat tarhi vaktavyam aparavidhau iti . na vaktavyam . prvavidhau iti eva siddham . katham . na prvgrahaena dea abhisambadhyate : ajdea paranimittaka prvasya vidhim prati sthnivat bhavati . kuta prvasya . det iti . kim tarhi . nimittam abhisambadhyate : ajdea paranimittaka prvasya vidhim prati sthnivat bhavati . kuta prvasya . nimittt iti . atha nimitte abhisambadhyamne yat tat asya yogasya mrdhbhiiktam udharaam tat api sagrhtam bhavati . kim puna tat . pavy mrdvy iti . bham sagrhtam . nanu ca kraya vyavahitatvt na asau nimittt prva bhavati . vyavahite api prvaabda vartate . tat yath : prvam mathury paliputram iti . atha v dea eva abhisambadhyate . katham yni svavidhau sthnivadbhvasya prayojanni . na etni santi . iha tvat yan , san , dhinvanti krvanti iti . ayam vidhiabda asti eva karmasdhana : vidhyate vidhi . asti bhvasdhana : vidhnam vidhi iti . karmasdhanasya vidhiabdasya updne na sarvam iam sagrhtam iti krtv bhvasdhanasya vidhiabdasya updnam vijsyate : prvasya vidhnam prati prvasya bhvam prati prva syt iti sthnivat bhavati iti evam bhaviyati i ca na bhaviyati . dadhi atra madhu atra cakratu cakru iti parihram vakyati (P_1,1.57.2) KA_I,144.18-146.5 Ro_I,431-435 kni puna asya yogasya prayojanni . stoymi aham pdikam audavhim tata vobhte tanm ptanm ca . netrau gacchatam
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (81 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

dhraim rvaim ca tata pact srasyate dhvasyate ca . iha tvat pdikam audavhim tanm ptanm dhraim rvaim iti akralope krte padbhva h allopa ilopa iti ete vidhaya prpnuvanti . sthnivadbhvt na bhavanti . srasyate dhvasyate : ilope krte aniditm hala upadhy kiti iti nalopa prpnoti . sthnivadbhvt na bhavati . na etni santi prayojanni . asiddhavat atra bht iti anena api etni siddhni . idam tarhi prayojanam : yjyate vpyate . ilope krte yajdnm kiti iti samprasraam prpnoti . sthnivadbhvt na bhavati . etat api na asti prayojanam . yajdibhi atra kitam vieayiyma yajdnm ya kit iti . ka ca yajdnm kit . yajdibhya ya vihita iti . idam tarhi prayojanam : pavy mrdvy iti . parasya yadee krte prvasya na prpnoti kraya vyavahitatvt . sthnivadbhvt bhavati . kim puna kraam parasya tvat bhavati na puna prvasya . nityatvt . nitya parayadea . krte api prvayadee prpnoti akrte api prpnoti . nityatvt parayadee krte prvasya na prpnoti . sthnivadbhvt bhavati . etat api na asti prayojanam . asiddham bahiragalakaam antaragalakae iti asiddhatvt bahiragalakaasya parayadeasya antaragalakaa prvayadea bhaviyati . avayam ca e paribh rayitavy svarrtham kartrya hartrya iti udttayaa halprvt iti ea svara yath syt . anena api siddha svara . katham . rabhyame nitya asau . rabhyame tu asmin yoge nitya prvayadea . krte api parayadee prpnoti akrte api . parayadea api nitya . krte api prvayadee prpnoti akrte api . para ca asau vyavasth . vyavasthay ca asau para . yugapatsambhava na asti . na ca asti yaugapadyena sambhava . katham ca sidhyati . bahiragea sidhyati . asiddham bahiragalakaam antaragalakae iti anena sidhyati . evam tarhi ya atra udttaya tadraya svara bhaviyati . kraya vyavahitatvt na prpnoti . svaravidhau vyajanam avidyamnavat bhavati iti na asti vyavadhnam . s tarhi e paribh kartavy . nanu ca iyam api kartavy : asiddham bahiragalakaam antaragalakae iti . bahuprayojan e paribh . avayam e kartavy . s ca api e lokata siddh . katham . pratyagavart loka lakyate . tat yath : purua ayam prta utthya yni asya pratiarram kryi tni tvat karoti tata suhrdm tata sambandhinm . prtipadikam ca api upadiam smnyabhte arthe vartate . smanye vartamnasya vyakti upajyate . vyaktasya sata ligasakhybhym anvitasya bhyena arthena yoga bhavati . yay eva nuprvy arthnm prdurbhva tay eva abdnm api tadvat kryai api bhavitavyam . imni tarhi prayojanni : paayati , avadht , bahukhavaka . paayati laghayati iti ilope krte ata upadhy iti vrddhi prpnoti . sthnivadbhvt na bhavati . avadht iti akralope krte ata halde lagho iti vibh vrddhi prpnoti . sthnivadbhvt na bhavati . bahukhavaka it pa anyatarasym hrasvatve krte hrasvnte antyt prvam iti ea svara prpnoti . sthnivadbhvt na bhavati . (P_1,1.57.3) KA_I,146.6-16 Ro_I,435-436 iha vaiykaraa , sauvava iti yvo sthnivadbhvt yvau prpnuta . tayo pratiedha vaktavya . aca prvavijnt aico siddham . ya andit aca prva tasya vidhim prati sthnivadbhva . dit ca ea aca prva . kim vaktavyam etat . na hi . katham anucyamnam gasyate . aca iti pacam : aca prvasya . yadi evam dea avieita bhavati . dea ca vieita . katham . na brma yat ahnirdiam ajgrahaam tat pacamnirdiam kartavyam . kim tarhi anyat kartavyam . anyat ca na kartavyam . yat eva ada ahnirdiam ajgrahaam tasya dikabdai yoge pacam bhavati : ajdea paranimittaka prvasya vidhim prati
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (82 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

sthnivat bhavati . kuta prvasya . aca iti . tat yath dea prathamnirdia . tasya dikabdai yoge pacam bhavati : ajdea paranimittaka prvasya vidhim prati sthnivat bhavati . kuta prvasya . det iti . (P_1,1.57.4) KA_I,146.17-147.18 Ro_I,436-438 tatra dealakaapratiedha . tatra dealakaam kryam prpnoti . tasya pratiedha vaktavya : vyvo , adhvaryvo . lopa vyo vali iti yalopa prpnoti . asiddhavacant siddham . ajdea paranimittaka prvasya vidhim prati asiddha bhavati iti vaktavyam . asiddhavacant siddham iti cet utsargalakanm anudea . asiddhavacant siddham iti cet utsargalakanm anudea kartavya : pavy mrdvy iti . nanu ca etat api asiddhavacant siddham . asiddhavacant siddham iti cet na anyasya asiddhavacant anyasya bhva . asiddhavacant siddham iti cet tat na . kim kraam . na anyasya asiddhavacant anyasya bhva . na hi anyasya asiddhavacant anyasya prdurbhva bhavati . na hi devadattasya hantari hate devadattasya prdurbhva bhavati . tasmt sthnivadvacanam asiddhatvam ca . tasmt sthnivadbhva vaktavya asiddhatvam ca . pavy mrdvy iti atra sthnivadbhva . vyvo , adhvaryvo iti asiddhatvam . uktam v . kim uktam . sthnivadvacannarthakyam strsiddhatvt iti . viama upanysa . yuktam tatra yat ekdeastram tukstre asiddham syt : anyat anyasmin . iha puna na yuktam . katham hi tad eva nma tasmin asiddham syt . tad eva ca api tasmin asiddham bhavati . vakyati hi crya : cia luki tagrahanarthakyam saghtasya apratyayatvt talopasya ca asiddhatvt iti . cia luk cia luki eva asiddha bhavati . kmam atidiyatm v sat ca asat ca api na iha bhra asti . kalpya hi vkyaea vkyam vaktari adhnam hi . atha v vatinirdea ayam . kmacra ca vatinirdee vkyaeam samarthayitum . tat yath . unaravat madreu yav . santi na santi iti . mtrvat asy kal . santi na santi . evam iha api sthnivat bhavati sthnivat na bhavati iti vkyaeam samarthayiymahe . iha tvat pavy mrdvy iti yath sthnini yadea bhavati evam dee api . iha idnm vyvo adhvaryvo iti yath sthnini yalopa na bhavati evam dee api na bhavati . (P_1,1.57.5) KA_I,147.19-148.24 Ro_I,438-441 kim puna anantarasya vidhim prati sthnivadbhva hosvit prvamtrasya . ka ca atra viea . anantarasya cet eknanudttadvigusvaragatinighteu upasakhynam . anantarasya cet eknanudttadvigusvaragatinighteu upasakhynam kartavyam . eknanudtta : lunhi atra punhi atra . anudttam padam ekavarjam iti ea svara na prpnoti . dvigusvara : pacratnya , daratnya . igantakla iti ea svara na prpnoti . gatinighta : yat pralunhi atra , yat prapunhi atra . tii codttavati iti ea svara na prpnoti . astu tarhi prvamtrasya . prvamtrasya iti cet upadhhrasvatvam . prvamtrasya iti cet upadhhrasvatvam vaktavyam : vditavantam prayojitavn : avvadat vm parivdakena . kim puna kraam na sidhyati . ya asau au i lupyate tasya sthnivadbhvt hrasvatvam na prpnoti . gurusaj ca . gurusaj ca na sidhyati : lem3ghna pitt3ghna d3dhyava m3dhvava . hala anantar sayoga iti sayogasaj . sayoge guru iti gurusaj . guro iti pluta na prpnoti . nanu ca yasya api anantarasya vidhim prati sthnivadbhva tasya api anantaralakaa vidhi sayogasaj vidhey . na v sayogasya aprvavidhitvt . na v ea doa . kim kraam . sayogasya aprvavidhitvt . na
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (83 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prvavidhi sayoga . kim tarhi . prvaparavidhi sayoga . ekdeasya upasakhynam . ekdeasya upasakhynam kartavyam : ryasau gaumatau cturau , nauhau pde , udavhe . ekdee krte nummau padbhva h iti ete vidhaya prpnuvanti . kim puna kraam na sidhyati . ubhayanimittatvt . ajdea paranimittaka iti ucyate ubhayanimitta ca ayam . ubhaydeatvt ca . aca dea ici ucyate aco ca ayam dea . na ea doa . yat tvat ucyate ubhayanimittatvt iti : iha yasya grme nagare v anekam kryam bhavati aknoti asau tata anyatarat vyapadeum : gurunimittam vasma . adhyayananimittam vasma iti . yat api ucyate ubhaydeatvt ca iti . iha ya dvayo ahnirdiayo prasage bhavati labhate asau anyatarata vyapadeam . tat yath devadattasya putra , devadatty putra iti . (P_1,1.57.6) KA_I,149.1-19 Ro_I,441-443 atha halaco dea sthnivat bhavati utho na . ka ca atra viea . halaco dea sthnivat iti cet viate tilopa ekdea . halaco dea sthnivat iti cet viate tilope ekdea vaktavya : viaka , viam atam , via . sthldnm yadilope avdea . sthldnm yadilope krte avdea vaktavya : sthavyn , davyn . kekayimitrayvo iydee etvam . kekayimitrayvo iydee etvam na sidhyati : kaikeya , maitreya . aci iti etvam na sidhyati . uttarapadalope ca . uttarapadalope ca doa bhavati : dadhyupasikt saktava dadhisaktava . aci iti yadea prpnoti . yalope yaiyauvaa . yalope yaiyauvaa na sidhyanti : cecya , nenya , cekriya , loluva , popuva . aci iti yaiyauvaa na sidhyanti . astu tarhi na sthnivat . asthnivattve yalope guavrddhipratiedha . asthnivattve yalope guavrddhipratiedha vaktavya : loluva , popuva , sarsrpa , marmrja iti . na ea doa . na dhtulope rdhadhtuke iti pratiedha bhaviyati . (P_1,1.57.7) KA_I,149.20-151.11 Ro_I,443-447 kim puna ryamym prakrtau sthnivat bhavati hosvit avieea . ka ca atra viea . avieea sthnivat iti cet lopayadee guruvidhi . avieea sthnivat iti cet lopayadee guruvidhi na sidhyati : lem3ghna pitt3ghna d3dhyava m3dhvava . hala anantar sayoga iti sayogasaj sayoge guru iti gurusaj guro iti pluta na prpnoti . dvirvacandaya ca pratiedhe . dvirvacandaya ca pratiedhe vaktavy : dvirvacanavareyalopa iti . ksalope lugvacanam . ksalope luk vaktavya : adugdha , adugdh : luk v duhadihalihaguhm tmanepade dantye iti . hante ghatvam . hante ca ghatvam vaktavyam : ghnanti ghnantu , aghnan . astu tarhi ryamym prakrtau iti . grahaeu sthnivat iti cet jagdhydiu deapratiedha . grahaeu sthnivat iti cet jagdhydiu deasya pratiedha vaktavya : nirdya samdya . ada jagdhi lyap ti kiti iti jagdhibhva prpnoti . yadee yulopetvnunsikttvapratiedha . yadee yulopetvnunsikttvnm pratiedha vaktavya . yalopa : vyvo , adhvaryvo . lopa vyo vali iti yalopa prpnoti . ulopa : akurvi* m akurvy m . nityam karote ye ca iti ukralopa prpnoti . tva : aluni* m aluny m . hali agho iti tvam prpnoti . anunsikttva : ajaji* m ajajy m . ye vibh iti anunsikttvam prpnoti . rytvapratiedha ca . rya tvasya ca pratiedha vaktavya : ryi* m ryy m . rya hali iti tvam prpnoti . drghe yalopapratiedha . drghe yalopasya pratiedha vaktavya : saurye nma himavata rge tadvn saury himavn iti sau inraye drghatve krte ti yalopa prpnoti . ata drghe yalopavacanam . ata drghe
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (84 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

yalopa vaktavya : grgbhym , vtsbhym . drghe krte patyasya ca taddhite anti iti pratiedha prpnoti . na ea doa . ryate tatra prakrti : taddhite iti . sarvem em parihra : uktam vidhigrahaasya prayojanam vidhimtre sthnivat yath syt anryamym api prakrtau iti . atha v puna astu avieea sthnivat iti . nanu ca uktam avieea sthnivat iti cet lopayadee guruvidhi dvirvacandaya ca pratiedhe , ksalope lugvacanam , hante ghatvam iti . na ea doa . yat tvat ucyate avieea sthnivat iti cet lopayadee guruvidhi iti : uktam etat : na v sayogasya aprvavidhitvt iti . yat api ucyate dvirvacandaya ca pratiedhe vaktavy iti : ucyante nyse eva . ksalope lugvacanam iti : kriyate nyse eva . hante ghatvam iti . saptame parihram vakyati . (P_1,1.58.1) KA_I,151.14-152.15 Ro_I,447-453 padntavidhim prati na sthnivat iti ucyate . tatra vetasvn iti ru prpnoti . na ea doa . bhasaj atra bdhik bhaviyati : tasau matvarthe iti . akrntam etat bhasajm prati . padasajm prati sakrntam . nanu ca evam vijsyate : ya samprati padnta iti . karmasdhanasya vidhiabdasya updne etat evam syt . ayam ca vidhiabda asti eva karmasdhana : vidhyate vidhi . asti bhvasdhana : vidhnam vidhi iti . tatra bhvasdhanasya updne ea doa bhavati . iha ca : brahmabandhv brahmabandhvai : dhakrasya jatvam prpnoti . asti puna kim cit bhvasdhanasya vidhiabdasya updne sati iam sagrhtam hosvit dontam eva . asti iti ha . iha kni santi yni santi kau sta , yau sta iti ya asau padnta yakra vakra v ryeta sa na ryate . aika ca api siddha bhavati . vcika tu na sidhyati . astu tarhi karmasdhana . yadi karmasdhana aika na sidhyati . astu tarhi bhvasdhana . vcika na sidhyati . vcikaaikau na savadete . kartavya atra yatna . katham brahmabandhv brahmabandhvai. ubhayata raye na antdivat iti . katham vetasvn . na evam vijyate : padasya anta padnta padantavidhim prati iti . katham tarhi . pade anta padnta padntavidhim prati iti . atha v yath eva anyni api padakryi upaplavante rutvam jatvam ca evam idam api padakryam upaployate . kim. bhasaj nma . vare yalopavidhim prati na sthnivat bhavati iti ucyate . tatra te apsu yyvara pravapeta pin avaralopavidhim prati sthnivat syt . na ea doa . na evam vijyate : vare yalopavidhim prati na sthnivat bhavati iti . katham tarhi . vare ayalopavidhim prati iti . kim idam ayalopavidhim prati iti . avaralopavidhim prati yalopavidhim ca prati iti . atha v yogavibhga kariyate : vare luptam na sthnivat . tata yalopavidhim ca prati na sthnivat iti . yalope kim udharaam . kayate apratyaya ka iti . na etat asti . kvau luptam na sthnivat . idam tarhi : saur balk . na etat asti . upadhtvavidhim prati na sthnivat . idam tarhi prayojanam : ditya . na etat asti . prvatrsiddhe na sthnivat . idam tarhi : kati , valgti . na etat asti prayojanam . kay valgy iti bhavitavyam . idam tarhi : kayate ktic : brhmaakati , katriyakati . (P_1,1.58.2) KA_I,152.16-153.3 Ro_I,453-454 pratiedhe svaradrghayalopeu lopjdea na sthnivat . pratiedhe svaradrghayalopeu lopjdea na sthnivat iti vaktavyam . svara : karika , cikraka , jihraka . ya hi anya dea sthnivat eva asau bhavati : pacratnya , daratnya . svara . drgha : pratidvn pratidvne . ya hi anya dea sthnivat eva asau bhavati : kiryo , giryo . drgha . yalopa : brhmaakati , katriyakati . ya hi anya dea sthnivat eva asau bhavati : vyvo , adhvaryvo iti .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (85 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

tat tarhi vaktavyam . na vaktavyam . iha hi lopa api prakrta dea api . vidhigrahaam api prakrtam anuvartate . drghdaya api nirdiyante . kevalam atra abhisambandhamtram kartavyam : svaradrghayalopavidhiu lopjdea na sthnivat iti . nuprvyea sannivinm yatheam abhisambandha akyate kartum . na ca etani nuprvyea sannivini . annuprvyea api sannivinm yathetam abhisambandha bhavati . tat yath : anavham udahri y tvam harasi iras kumbham bhagini scnam abhidhvantam adrk iti . tasya yathetam abhisambandha bhavati : udahri bhagini y tvam kumbham harasi iras anavham scnam abhidhvantam adrk iti . (P_1,1.58.3) KA_I,153.4-154.6 Ro_I,455-459 kvilugupadhtvacaparanirhrsakutveu upasakhynam . kvilugupadhtvacaparanirhrsakutveu upasakhynam kartavyam . kvau kim udharaam . kayate apratyaya ka iti . na etat asti . yalopavidhim prati na sthnivat . idam tarhi : pipahiate apratyaya pipah . na etat asti . drghatvam prati na sthnivat . idam tarhi : lvayate lau , pvayate pau . na etat asti . akrtv vrddhyvdeau ilopa . pratyayalakaena vrddhi bhaviyati . idam tarhi : lavam cae lavayati . lavayate apratyaya lau , pau . sthnivadbhvt e h na prpnoti . kvau luptam na sthnivat iti bhavati . evam api na sidhyati . katham . kvau ilopa au akralopa . tasya sthnivadbhvt h na prpnoti . na ea doa . na evam vijyate : kvau luptam na sthnivat iti . katham tarhi . kvau vidhim prati na sthnivat . luki kim udharaam . bimbam , badaram . na etat asti . puvadbhvena api etat siddham . idam tarhi : malakam . etat api na asti . vakyati etat : phale lugvacannarthakyam prakrtyantaratvt iti . idam tarhi : pacabhi pavbhi krta pacapau , daapau iti . nanu ca etat api puvadbhvena eva siddham . katham puvadbhva . bhasya ahe taddhite puvat bhavati iti . bhasya iti ucyate . yajdau ca bham bhavati na ca atra yajdim payma . pratyayalakaena yajdi . varraye na asti pratyayalakaam . evam tarhi hakchaso ca iti evam bhaviyati . akchaso ca iti ucyate . na ca atra akchasau payma . pratyayalakaena . na lumat tasmin iti pratyayalakaasya pratiedha . na khalu api hak eva krtapratyaya krtdyarth eva v taddhit . kim tarhi . anye api taddhit ye lukam prayojayanti : pacendrya devat asya iti pacendra , daendra , pacgni , dagni . upadhtve kim udharaam . pipahiate apratyaya pipah iti . na etat asti . drghavidhim prati na sthnivat . idam tarhi: saur balk . na etat asti . yalopavidhim prati na sthnivat . idam tarhi : prikhya . caparanirhrse ca upasakhyanam kartavyam . vditavantam prayojitavn : avvadat vm parivdakena . kim puna kraam na sidhyati . ya asau au i lupyate tasya sthnivadbhvt hrasvatvam na prpnoti . nanu ca etat api upadhtvavidhim prati na sthnivat iti eva siddham . viee etat vaktavyam . kva . pratyayavidhau iti . iha m bht : paayati laghayati iti . kutve ca upasakhyanam kartavyam . arcayate arka , marcayate marka . na etat ghaantam . audika ea kaabda . tasmin amikam kutvam . etat api ic vyavahitatvt na prpnoti . (P_1,1.58.4) KA_I,154.7-155.7 Ro_I,459-461 prvatrsiddhe ca . prvatrsiddhe ca na sthnivat iti vaktavyam . kim prayojanam . prayojanam ksalopa salope ksalopa salope prayojanam : adugdha , adugdh . luk v duhadihalihaguhm tmanepade dantye iti luggrahaam na kartavyam . dadha kralope dicaturthatve . dadha kralope dicaturthatve prayojanam : dhatse dhaddhve dhaddhvam iti . dadha tatho ca iti cakra na
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (86 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

kartavya bhavati . hala yamm yami lope . hala yamm yami lope prayojanam : ditya . hala yamm yami lopa siddha bhavati . allopailopau sayogntalopaprabhrtiu . allopailopau sayogntalopaprabhrtiu prayojanam : ppacyate ppakti , yyajyate yyai , pcayate pkti , yjayate yi . dvirvacandni ca . dvirvacandni ca na pahitavyni bhavanti . prvatrsiddhena eva siddhni bhavanti . kim avieea . na iti ha . vareyalopasvaravarjam . vareyalopam svaram ca varjayitv . tasya doa sayogdilopalatvaatveu . tasya etasya lakaasya doa sayogdilopalatvaatveu . sayogdilopa : kkyartham , vsyartham . sko sayogdyo ante ca iti lopa prpnoti . latvam : nigryate niglyate . aci vibh iti latvam na prpnoti . atvam : mavapan vrhivpan . prtipadikntasya iti atvam prpnoti . (P_1,1.59.1) KA_I,155.9-18 Ro_I,461-462 dee sthnivadanudet tadvata dvirvacanam . dee sthnivadanudet tadvata . kivata . deavata dvirvacanam prpnoti . tata ka doa . tatra abhysarpam . tatra abhysarpam na sidhyati : cakratu , cakru iti . ajgrahaam tu jpakam rpasthnivadbhvasya . yat ayam ajgrahaam karoti tat jpayati crya rpam sthnivat bhavati iti . katham krtv jpakam . ajgrahaasya etat prayojanam : iha m bht : jeghryate , dedhmyate iti . yadi rpam sthnivat bhavati tata ajgrahaam arthavat bhavati . atha hi kryam na artha ajgrahaena . bhavati eva atra dvirvacanam . (P_1,1.59.2) KA_I,155.19-156.27 Ro_I,462-466 tatra gpratiedha . tatra ga pratiedha vaktavya : adhijage . ivarbhysat prpnoti . na vaktavya . g lii iti dvilakraka nirdea : lii lakrdau iti . krtyejantadivdinmadhtuu abhysarpam . krtyejantadivdinmadhtuu abhysarpam na sidhyati . krti : acikrtat . krti . ejanta : jagle mamle . ejanta . divdi : dudyati susyati . divdi . nmadhtu : bhavanam icchati bhavanyati bhavanyate san : bibhavanyiati . evam tarhi pratyaye iti vakymi . pratyaye iti cet krtyejantanamadhtuu abhysarpam . pratyaye iti cet krtyejantanamadhtuu abhysarpam na sidhyati . divdaya eke parihrt . evam tarhi dvirvacananimitte aci ajdea sthnivat iti vakymi . sa tarhi nimittaabda updeya . na hi antarea nimittaabdam nimittrtha gamyate . antarea api nimittaabdam nimittrtha gamyate . tat yath : dadhitrapusam pratyaka jvara . jvaranimittam iti gamyate . navalodakam pdaroga . pdaroganimittam iti gamyate . ayu ghrtam . yua nimittam iti gamyate . atha v akra matvarthya : dvirvacanam asmin asti sa ayam dvirvacana , dvirvacane iti . evam api na jyate kiyantam asau klam sthnivat bhavati iti . ya puna ha dvirvacane kartavye iti krte tasya dvirvacane sthnivat na bhaviyati . evam tarhi pratiedha prakrta . sa anuvartiyate . kva prakrta . na padntadvirvacana iti . dvirvacananimitte aci ajdea na bhavati iti . evam api na jyate kiyantam asau klam na bhavati iti . ya puna ha dvirvacane kartavye iti krte tasya dvirvacane ajdea bhaviyati . evam tarhi ubhayam anena kriyate : pratyaya ca vieyate dvirvacanam ca . katham puna ekena yatnena ubhayam labhyam . labhyam iti ha . katham . ekaeanirdet . ekaeanirdea ayam : dvirvacanam ca dvirvacanam ca dvirvacanam . dvirvacane ca kartavye dvirvacane aci pratyaye iti dvirvacananimitte aci sthnivat bhavati . dvirvacananimitte aci sthnivat iti cet au sthnivadvacanam . dvirvacananimitte aci sthnivat iti cet au sthnivadbhva vaktavya : avanunvayiati , avacukvayiati . na vaktavya . o puyajiu vacanam jpakam au
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (87 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

sthnivadbhvasya . yat ayam puyaji apare iti ha tat jpayati crya bhavati au sthnivat iti . yadi etat jpyate ackrtat atra api prpnoti . tulyajtyasya jpakam . ka ca tulyajtya . yathjtyak puyajaya . kathajtyak ca ete . avarapar . katham jagle mamle . anaimittikam ttvam iti tu pratiedha . (P_1,1.59.3) KA_I,157.1-11 Ro_I,466-468 kni puna asya yogasya prayojanni . papatu , papu , tasthatu , tasthu , jagmatu , jagmu , itat , iat , cakratu , cakru iti . llopopadhlopailopayadeeu krteu anackatvt dvirvacanam na prpnoti . sthnivadbhvt bhavati . na etni santi prayojanni . prvavipratiedhena api etni siddhni . katham . vakyati hi crya : dvirvacanam yaayavyvdellopopadhlopakikinoruttvebhya iti . sa prvavipratiedha na pahitavya bhavati . kim puna atra jyya . sthnivadbhva eva jyyn . prvavipratiedhe hi sati idam vaktavyam syt : odauddeasya ut bhavati cuutuarde abhysasya iti . nanu ca tvay api ittvam vaktavyam . parrtham mama bhaviyati : sani ata it bhavati iti . mama api tarhi uttvam parrtham bhaviyati : utparasya ata ti ca iti . ittvam api tvay vaktavyam yat samnrayam tadartham : utpipaviate sayiyaviati iti evamartham . tasmt sthnivat iti ea eva paka jyyn . (P_1,1.60) KA_I,158.2-159.4 Ro_I,469-471 arthasya saj kartavy abdasya m bht iti . itaretarrayam ca bhavati . k itaretarrayat . sata adaranasya sajay bhavitavyam sajaya ca adaranam bhvyate . tat etat itaretarrayam bhavati . itaretarrayi ca kryi na prakalpante . lopasajym arthasato uktam . kim uktam . arthasya tvat uktam : itikaraa arthanirdertha iti . sata api uktam : siddham tu nityaabdatvt iti . nity abd . nityeu ca abdeu sata adaranasya saj kriyate . na sajay adaranam bhvyate . sarvaprasaga tu sarvasya anyatra adratvt . sarvaprasaga tu bhavati . sarvasya adaranasya lopasaj prpnoti . kim kraam . sarvasya anyatra adratvt . sarva hi abda ya yasya prayogaviaya sa tata anyatra na dryate . trapu jatu iti atra aa adaranam . tatra adaranam lopa iti lopasaj prpnoti . tatra ka doa . tatra pratyayalakaapratiedha . tatra pratyayalakaam kryam prpnoti . tasya pratiedha vaktavya . aca iti iti vrddhi prpnoti . na ea doa . iti agasya aca vrddhi ucyate . yasmt pratyayavidhi taddi pratyaye agam bhavati . yasmt ca atra pratyayavidhi na tat pratyaye parata yat ca pratyaye parata na tasmt pratyayavidhi . kvipa tarhi adaranam . tatra adaranam lopa iti lopasaj prpnoti . tatra ka doa . tatra pratyayalakaapratiedha . tatra pratyayalakaam kryam prpnoti . tasya pratiedha vaktavya . hrasvasya piti krti tuk bhavati iti tuk prpnoti . siddham tu prasaktdaranasya lopasajitvt . siddham etat . katham . prasaktdaranam lopasajam bhavati iti vaktavyam . yadi prasaktdaranam lopasajam bhavati iti ucyate grma , senn : atra vrddhi prpnoti . prasaktdaranam lopasajam bhavati ahnirdiasya . yadi ahnirdiasya iti ucyate chalope eva iti avadhrae cdilope vibh iti atra lopasaj na prpnoti . atha prasaktdaranam lopasajam bhavati iti ucyamne katham iva etat sidhyati . ka abdasya prasaga . yatra gamyate ca artha na ca prayujyate . astu tarhi prasaktdaranam lopasajam bhavati iti eva . katham grma , senn . ya atra aa prasaga kvip asau bdhyate .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (88 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(P_1,1.61) KA_I,159.6-160.23 Ro_I,471-476 pratyayagrahaam kimartham . lumati pratyayagrahaam apratyayasajpratiedhrtham . lumati pratyayagrahaam kriyate apratyayasya et saj m bhvan iti . kim prayojanam . prayojanam taddhitaluki kasyaparaavyayo luki ca goprakrtinivrttyartham . taddhitaluki gonivrttyartham kasyaparaavyayo ca luki prakrtinivrttyartham . luk taddhitaluki iti go api luk prpnoti . pratyayagrahat na bhavati . kasyaparaavyayo yaaau luk ca iti prakrte api luk prpnoti . pratyayagrahat na bhavati . gonivrttyarthena tvat na artha . yogavibhgt siddham . yogavibhga kariyate : go upasarjanasya . gontasya prtipadikasya upasarjanasya hrasva bhavati . tata striy . strpratyayntasya prtipadikasya upasarjanasya hrasva bhavati . tata luk taddhitaluki iti . striy iti vartate . go iti nivrttam . kasyaparaavyayo viianirdet siddham . kasyaparaavyayo api viianirde kartavya : kasyaparaavyayo yaaau bhavata chayato ca luk bhavati iti . sa ca avayam viianirdea kartavya kriyame api vai pratyayagrahae ukrasaabdayo m bht iti : kame sa kasa . parn rti iti parau iti . na ea doa . udaya avyutpannni prtipadikni . sa ea ananyrtha viianirdea kartavya pratyayagrahaam v kartavyam . uktam v . kim uktam . ypprtipadikagrahaam gabhapadasajrtham yacchayo ca lugartham iti . ahnirdertham tu . ahnirdertham tarhi pratyayagrahaam kartavyam . anirdee hi ahyarthprasiddhi . akriyame hi pratyayagrahae ahyarthasya aprasiddhi syt . kasya . sthneyogatvasya . kva puna iha ahnirderthena artha pratyayagrahaena yvat sarvatra eva ah uccryate : aio tadrjasya yaao apa iti . iha na k cit ah : janapade lup iti . atra api prakrtam pratyayagrahaam anuvartate . kva prakrtam . pratyaya para ca iti . tat vai prathamnirdiam ahnirdiena ca iha artha . ypprtipadikt iti e pacam pratyaya iti prathamy ahm prakalpayiyati tasmt iti uttarasya . pratyayavidhi ayam . na ca pratyayavidhau pacamya prakalpik bhavanti . na ayam pratyayavidhi . vihita pratyaya prakrta ca anuvartate . sarvdertham v vacanaprmyt . sarvdertham tarhi pratyayagrahaam kartavyam . luklulupa sarvde yath syu . atha kriyame api pratyayagrahae katham iva luklulupa sarvde labhy . vacanaprmyt : pratyayagrahaasmrthyt . etat api na asti prayojanam . cryapravrtti jpayati luklulupa sarvde bhavanti iti yat ayam luk v duhadihalihaguhm tmanepade dantye iti lope krte lukam sti . uttarrtham tu . uttarrtham tarhi pratyayagrahaam kartavyam . na kartavyam. kriyate tatra eva : pratyayalope pratyayalakaam iti . dvityam kartavyam krtsnapratyayalope pratyayalakaam yath syt . ekadealope m bht iti : ghnta sam ryaspoea gmya iti . (P_1,1.62.1) KA_I,160.25-161.14. Ro_I,476-478 pratyayagrahaam kimartham. lope pratyayalakaam iti iyati ucyamne saurath vahat iti gurpottamalakaa ya prasajyeta . na ea doa . na evam vijyate : lope pratyayalakaam pratyayasya prdurbhva iti . katham tarhi . pratyaya lakaam yasya kryasya tat lupte api bhavati iti . idam tarhi prayojanam : sati pratyaye yat prpnoti tat pratyayalakanena yath syt . lopottaraklam yat prpnoti tat pratyayalakaena m bht iti . kim prayojanam . grmaikulam , sennikulam : auttarapadike hrasvatve krte hrasvasya piti krti tuk bhavati iti tuk prpnoti . sa m bht iti .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (89 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

yadi tarhi yat sati pratyaye prpnoti tat pratyayalakanena bhavati . lopottaraklam yat prpnoti tat na bhavati jagat , janagat iti atra tuk na prpnoti . lopottarakala hi atra tuk gama . tasmt na artha evamarthena pratyayagrahaena . kasmt na bhavati grmaikulam , sennikulam . bahiragam hrasvatvam . antaraga tuk . asiddham bahiragam antarage . idam tarhi prayojanam : krtsnapratyayalope pratyayalakaam yath syt . ekadealope m bht iti : ghnta sam ryaspoea gmya iti . prvasmin api yoge pratyayagrahaasya etat prayojanam uktam. anyatarat akyam akartum . atha dvityam pratyayagrahaam kimartham . pratyayalakaam yath syt varalakaam m bht iti : gave hitam gohitam , rya kulam raikulam iti . (P_1,1.62.2) KA_I,161.15-162.21 Ro_I,479-482 kimartham puna idam ucyate . pratyayalope pratyayalakaavacanam sadanvkhynt strasya . pratyayalope pratyayalakaam iti ucyate sadanvkhynt strasya . sat strea anvkhyyate sata v stram anvykhyakam bhavati . sadanvkhynt strasya ugidacm sarvanmasthne adhto iti iha : eva syt gomantau yavamantau . gomn yavamn iti atra na syt . iyate ca syt iti . tat ca antarea yatnam na sidhyati . ata pratyayalope pratyayalakaavacanam . evamartham idam ucyate . asti prayojanam etat . kim tarhi iti. luki upasakhynam . luki upasakhynam kartavyam : paca sapta . kim puna kraam na sidhyati . lope hi vidhnam . lope hi pratyayalakaam vidhyate . tena luki na prpnoti . na v adaranasya lopasajitvt . na v kartavyam . kim kraam . adaranasya lopasajitvt . adaranam lopasajam iti ucyate . lumatsaj ca adaranasya kriyante . tena luki api bhaviyati . yadi evam . pratyaydaranam tu lumatsajam . pratyaydaranam tu lumatsajam api prpnoti . tatra ka doa . tatra luki luvidhipratiedha . tatra luki luvidhi api prpnoti . sa pratiedhya : atti hanti . lau iti dvirvacanam prpnoti . na v prthaksajkarat . na v ea doa . kim kraam . prthaksajkarat . prthaksajkaraasmarthyt luki luvidhi na bhaviyati . tasmt adaranasmnyt lopasaj lumatsaj avaghate . yath eva tarhi adaranasmnyt lopasaj lumatsaj avaghate evam lumatsaj api lopasajm avagheran . tatra ka doa . agomat gomat sampann gomatbht : luk taddhitaluki iti pa luk prasajyeta . nanu ca atra api prthaksajkarat iti eva siddham . yath eva tarhi prthaksajkaraasmarthyt lumatsaj lopasajm na avaghante evam lopasaj api lumatsaj na avagheta . tatra sa eva doa : luki upasakhynam iti . asti anyat lopasajy prthaksajkarae prayojanam . kim. lumatsajsu yat ucyate tat lopamtre m bht iti . lumati pratiedht v . atha v yat ayam na lumat agasya iti pratedham sti tat jpayati crya bhavati luki pratyayalakaam iti . (P_1,1.62.3) KA_I,162.22-164.10 Ro_I,482-486 sata nimittbhvt padasajbhva . san pratyaya yem krym animittam : rja purua iti sa lupta api animittam syt: rjapurua iti . astu tasy animittam y svdau padam iti padasaj y tu subantam padam iti padasaj s bhaviyati . sati etatpratyaye st : anay bhaviyati anay na bhaviyati iti . lupte idnm pratyaye yvata eva avadhe svdau padam iti padasaj tvata eva avadhe subantam padam iti . asti ca pratyayalakaena yajdiparat iti krtv bhasaj prpnoti . tugdrghatvayo ca vipratiedhnupapatti ekayogalakaatvt pariv iti . tugdrghatvayo ca vipratiedha na upapadyate . kva . pariv iti . kim kraam .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (90 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

ekayogalakaatvt . ekayogalakae tugdrghatve . iha lupte pratyaye sarvi pratyayrayi kryi paryavapannni bhavanti . tni etni pratyutthpyante . anena eva tuk anena eva ca drghatvam iti . tat etat ekayogalakaam bhavati . ekayogalakani ca na prakalpante . siddham tu sthnisajnudet nyabhvyasya . siddham etat . katham . sthnisaj anyabhtasya bhavati iti vaktavyam . kim krtam bhavati . sattmtram anena kriyate . yathprpte tugdrghatve bhaviyata . tat vaktavyam bhavati . yadi api etat ucyate atha v etarhi sthnivadbhva na rabhyate . sthnisaj anyabhtasya analvidhau iti vakymi . yadi evam a yamahana tmanepadam bhavati iti hante eva syt vadhe na syt . na hi k cit hante saj asti y vadhe atidiyeta . hante api saj asti . k . hanti eva . katham . svam rpam abdasya aabdasaj iti vacant svam rpam abdasya saj bhavati iti hante api hanti saj bhaviyati . bhasajpphagortveu ca siddham . bhasajpphagortveu ca siddham bhavati . bhasaj : rja purua rjapurua . pratyayalakaena yaci bham iti bhsaj prpnoti . sthnisaj anyabhtasya analvidhau iti vacant na bhavati . p : citrym jt citr . pratyayalakaena aantt kra prpnoti . sthnisaj anyabhtasya analvidhau iti vacant na bhavati . pha : vata . pratyayalakaena yaantt iti pha prpnoti . sthnisaj anyabhtasya analvidhau iti vacant na bhavati . go tvam . gm icchati gavyati . pratyayalakaena ami ota amaso iti tvam prpnoti . sthnisaj anyabhtasya analvidhau iti vacant na bhavati . tasya doa aunakralopettvemvidhaya . tasya etasya lakaasya doa aunakralopa . rdre carman lohite carman . pratyayalakaena yaci bham iti bhasaj siddh bhavati . sthnisaj anyabhtasya analvidhau iti vacant na prpnoti . ittvam : . pratyayalakaena hali iti itvam siddham bhavati . sthnisaj anyabhtasya analvidhau iti vacant na prpnoti . im : atret . pratyayalakaena hali iti ittvam siddham bhavati . sthnisaj anyabhtasya analvidhau iti vacant na prpnoti . stram ca bhidyate . yathnysam eva astu . nanu ca uktam sata nimittbhvt padasajbhva tugdrghatvayo ca vipratiedhnupapatti ekayogalakaatvt pariv iti . na ea doa . vakyati atra parihram . iha api pariv iti straparavipratiedhena paratvt drghatvam bhaviyati . (P_1,1.62.4) KA_I,164.11-165.13 Ro_I,486-490 kni puna asya yogasya prayojanni . prayojanam aprktailope num ammau guavrddhidrghatvemanamvidhaya . aprktalope ilope ca krte num ammau guavrddh drghatvam imaau namvidhi iti prayojanni . num : agne tr te vajin tr sadhasth , ta t pinm . num . ammau : he anavan , anavn . gua : adhok , ale . vrddhi : ni amr . drghatvam : agne tr te vajin tr sadhasth , ta t pinm . im : atre . aau : adhok , ale , aiya , auna . namvidhi : abhina atra , acchina atra . aprktailopayo krtayo ete vidhaya na prpnuvanti . pratyayalakaena bhavanti . na etni santi prayojanni . sthnivadbhvena api etni siddhni . na sidhyanti . dea sthnivat iti ucyate . na ca lopa dea . lopa api dea . katham . diyate ya sa dea . lopa api diyate . doa khalu api syt yadi lopa na dea syt . iha aca parasmin prvavidhau iti etasya bhyihni lope udharani tni na syu . yatra tarhi sthnivadbhva na asti tadartham ayam yoga vaktavya . kva ca sthnivadbhva na asti . ya alvidhi . kim prayojanam . prayojanam aunakrlopettvemvidhaya . bhasajpphgortveu doa . bhasajpphgortveu
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (91 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

doa bhavati. bhasajym tvat na doa . cryapravrtti jpayati na pratyayalakaena bhasaj bhavati iti yat ayam na isambuddhyo iti au pratiedham sti . pi api : na evam vijyate : aantt akrntt . katham tarhi . a ya akra iti . phe api : na evam vijyate : yaantt akrantt iti . katham tarhi . ya ya akra iti . go tve api : na evam vijyate : ami aci iti . katham tarhi . aci ami iti . prayojanni api tarhi tni na santi . yat tvat ucyate aunakrlopa iti kriyate etat nyse eva : na isambuddhyo iti . ittvam api . vakyati etat : sa ittve sa kvau iti . imvidhi api : hali iti nivrttam . yadi hali iti nivrttam trahni atra api prpnoti . evam tarhi aci na iti api anuvartiyate . na tarhi idnm ayam yoga vaktavya . vaktavya ca . kim prayojanam . pratyayam grhtv yat ucyate tat pratyayalakaena yath syt abdam grhtv yat ucyate tat pratyayalakaena m bht iti . kim prayojanam . obhan drada asya sudrat brhmaa . so manas* alomoas* iti ea svara m bht iti . (P_1,1.63.1) KA_I,165.15-166.8 Ro_I,490-492 lumati pratiedhe ekapadasvarasya upasakhynam . lumati pratiedhe ekapadasvarasya upasakhynam kartavyam. ekapadasvare ca lumat lupte pratyayalakaam na bhavati iti vaktavyam . kim avieea . na iti ha . sarvmantritasijluksvaravarjam . sarvasvaram mantritasvaravam sijluksvaram ca varjayitv . sarvasvara : sarvastoma , sarvaprha : sarvasya supi iti dyudttatvam yath syt . mantritasvara : sarpi gaccha , sapta gacchata : mantritasya ca iti dyudttatvam yath syt . sijluksvara : ma hi datm , ma hi dhatm : di sica anyatarasym iti ea svara yath syt . kim prayojanam . prayojanam inikilluki svar . inikitsvar luki prayojayanti . garga , vatsa , bida , urva , uragrva , vmarajju : niti iti dyudttatvam m bht iti . iha ca : atraya : kita iti antodttatvam m bht iti . pathimatho sarvanmasthne . pathimatho sarvanmasthne luki prayojanam . pathipriya , mathipriya : pathimatho sarvanmasthne iti ea svara m bht iti . ahna ravidhau . ahna ravidhau lumat lupte pratyayalakaam na bhavati iti vaktavyam . aha dadati , aha bhukte : ra asupi iti pratyayalakaena pratiedha m bht iti . (P_1,1.63.2) KA_I,166.9-167.28 Ro_I,493-498 uttarapadatve ca apaddividhau . uttarapadatve ca apaddividhau lumat lupte pratyayalakaam na bhavati iti vaktavyam . paramavc paramavce paramagoduh paramagoduhe paramavalih paramavalihe : padasya iti pratyayalakaena kutvdni m bhvan iti . apaddividhau iti kimartham . dadhisecau dadhiseca : stpaddyo iti pratiedha yath syt . yadi apaddividhau iti ucyate uttarapaddhikra na prakalpeta . tatra ka doa . kara varalakat iti evamdi vidhi na sidhyati . yadi puna nalopdividhau plutyante lumat lupte pratyayalakaam na bhavati iti ucyeta . na evam akyam . iha hi : rjakumryau rjakumrya iti kalam prasajyeta . na ea doa . yat etat siti kalam na iti etat pratyaye kalam na iti vakymi . yadi pratyaye kalam na iti ucyate dadhi adhun madhu adhun : atra api na prasajyeta . pratyaye kalam na bhavati . kasmin . yasmt ya pratyaya vihita iti . iha tarhi paramadiv paramadive : diva ut iti uttvam prpnoti iti. astu tarhi avieea . nanu ca uktam uttarapaddhikra na prakalpeta iti . vacant uttarapaddhikra bhaviyati . tat tarhi vaktavyam . na vaktavyam . anuvrtti kariyate . idam asti : yasmt pratayayavidhi taddi pratyaye agam , suptiantam padam . yasmt suptividhi taddi subantam ca . na kye . nntam kye padasajam bhavati yasmt kyavidhi subantam ca . siti ca . siti ca prvam
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (92 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

padasajam bhavati yasmt sidvidhi taddi subantam ca . svdiu asarvanmasthne . svdiu asarvanmasthne prvam padasajam bhavati yasmt svdividhi taddi subantam ca . yaci bham . yajdipratyaye prvam padasajam bhavati yasmt yajdividhi taddi subantam ca . iha tarhi : paramavk : asarvanmasthne iti pratiedha prpnoti . astu tasy pratiedha y svdau padam iti padasaj y tu subantam padam iti padasaj s bhaviyati . sati etatpratyaye st anay bhaviyati anay na bhaviyati iti . lupte idnm pratyaye yvata eva avadhe svdau padam iti padasaj tvata eva avadhe subantam padam iti . asti ca pratyayalakaena sarvanmasthnaparat iti krtv pratiedh ca balysa bhavanti iti pratiedha prpnoti . na apratiedht . na ayam prasajyapratiedha : sarvanmasthne na iti . kim tarhi . paryudsa ayam : yat anyat sarvanmasthnt iti . sarvanmasthne avypra . yadi kena cit prpnoti tena bhaviyati . prvea ca prpnoti . aprpte v . atha v anantar ya prpti s pratiidhyate . kuta etat . anantarasya vidhi v bhavati pratiedha v iti . prv prpti apratiiddh tay bhaviyati . nanu ca iyam prpti prvm prptim bdhate . na utsahate pratiiddh sat bdhitum . yadi evam paramavcau paramavca iti suptiantam padam iti padasaj prpnoti . evam tarhi yogavibhga kariyate . svdiu prvam padasajam bhavati . tata sarvanmasthne ayaci prvam padasajam bhavati . tata bham . bhasajam bhavati yajdau asarvanmasthane iti . yadi tarhi sau api padam bhavati , eca plutdhikre padntagrahaam codayiyati iha m bht : bhadram karoi gau iti , tasmin kriyame api bhaviyati . vkyapadayo antyasya iti evam tat . iha tarhi : dadhisecau dadhiseca : stpaddyo iti paddilakaa pratiedha na prpnoti . m bht evam : padasya di paddi , padde na iti . katham tarhi . padt di paddi , padde na iti evam bhaviyati . na evam akyam . iha api prasajyeta : rku vku tvaku kumru kioru iti . stpratiedha jpaka svdiu padatvena yem padasaj na tebhya pratiedha bhavati iti . iha tarhi : bahusecau , bahuseca : bahuc ayam pratyaya . atra padt di paddi , padde na iti ucyamne api na sidhyati . evam tarhi uttarapadatve ca paddividhau lumat lupte pratyayalakaam bhavati iti vakymi . tat niyamrtham bhaviyati : paddividhau eva na padntavidhau iti . katham bahusecau bahuseca . bahucprvasya ca paddividhau na padntavidhau iti . dvandve antyasya . dvandve antyasyalumat lupte pratyayalakaam na bhavati iti vaktavyam . vksraktvacam . (P_1,1.63.3) KA_I,168.1-23 Ro_I,498-500 iha abhvan iti pratyayalakaena jusbhva prpnoti . sica usa aprasaga kraprakarat . sica usa aprasaga . kim kraam . kraprakarat . ta iti etat niyamrtham bhaviyati : ta eva sijlugantt na anyasmt sijlugantt iti . iha : iti yumatputra dadti , iti asmatputra dadti iti atra yumadasmado ahcaturthdvitysthayo vmnvau iti vmnvdaya prpnuvanti . yumadasmado sthagrahat . sthagrahaam tatra kriyate . tat ryamavibhaktivieaam vijsyate . asti anyat sthagrahaasya prayojanam . kim . savibhaktikasya vmnvdaya yath syu iti . na etat asti prayojanam . padasya iti vartate vibhaktyantam ca padam . tatra antarea api sthagrahaam savibhaktikasya eva grahaam bhaviyati . bhavet siddham yatra vibhaktyantam padam . yatra tu khalu vibhaktau padam tatra na sidhyati : grma vm dyate , grma nau dyate janapada vm dyate , janapada nau dyate . sarvagrahaam api prakrtam anuvartate . tena savibhaktikasya eva bhaviyati . iha : cakukmam yjaym cakra iti ti atia iti . tasya ca nighta tasmt ca anighta prpnoti . mi lilopt tasya ca
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (93 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

anighta tasmt ca nighta . mi lilopt tasya ca anighta tasmt ca nighta siddha bhaviyati . agdhikre ia vidhipratiedhau . agdhikre ia vidhipratiedhau na sidhyata : jigamia savivrtsa . agasya iti ia vidhipratiedhau na prpnuta . krame drghatvam ca . kim ca . ia ca vidhipratiedhau . na iti ha . adee ayam ca pahita . krame ca drghatvam : utkrma sakrma iti . (P_1,1.63.4) KA_I,168.24-169.14 Ro_I,500-502 iha kim cit agdhikre lumat lupte pratyayalakaena bhavati kim cit ca anyatra na bhavati . yadi puna na lumat tasmin iti ucyeta . atha na lumat tasmin iti ucyamne kim siddham etat bhavati ia vidhipratiedhau krame drghatvam ca . bham siddham . na ia ividhipratiedhau parasmaipadeu iti ucyate . katham tarhi . sakrdau iti . tadvieaam parasmaipadagrahaam . na khalu api krame drghatvam parasmaipadeu iti ucyate . katham tarhi . iti iti . tadvieaam parasmaipadagrahaam . na lumat tasmin iti cet haniide talope . na lumat tasmin iti cet haniide talope na sidhyanti : avadhi bhavat dasyu , agyi bhavat grma , adhyagyi bhavat anuvka . talope krte lui iti haniide na prpnuvanti . na ea doa . na lui iti haniide ucyante . kim tarhi . rdhadhtuke iti . tadvieaam lugrahaam . iha ca : sarvastoma , sarvaprha sarvasya supi iti dyudttatvam na prpnoti . tat ca api vaktavyam . na vaktavyam . na lumat agasya iti eva siddham . katham . na lumat lupte agdhikra pratinirdiyate . kim tarhi . ya asau lumat lupyate tasmin yat agam tasya yat kryam tat na bhavati . evam api sarvasvara na sidhyati . kartavya atra yatna . (P_1,1.65.1) KA_I,169.16-25 Ro_I,502-503 kim idam algrahaam antyavieaam . evam bhavitum arhati . upadhsajym algrahaam antyanirdea cet saghtapratiedha . upadhsajym algrahaam antyanirdea cet saghtasya pratiedha vaktavya . saghtasya upadhsaj prpnoti . tatra ka doa . sa it ahalo : iv ia : saghtasya ittvam prpnoti . yadi puna al antyt iti ucyeta . evam api antya avieita bhavati . tatra ka doa . saghtt api prvasya upadhsaj prasajyeta . tatra ka doa . sa it ahalo : ia , iavn : akrasya ittvam prasajyeta . stram ca bhidyate . yathnysam eva astu . nanu ca uktam upadhsajym algrahaam antyanirdea cet saghtapratiedha iti . na ea doa . antyavijnt siddham . siddham etat . katham . ala antyasya vidhaya bhavanti iti antyasya bhaviyati . (P_1,1.65.2) KA_I,170.1-171.9 Ro_I,503-506 antyavijnt siddham iti cet na anarthake alontyavidhi anabhysavikre . antyavijnt siddham iti cet tat na . kim kraam . na anarthake alontyavidhi anabhysavikre . anarthake alontyavidhi na iti e paribh kartavy . kim avieea . na iti ha . anabhysavikre . abhysavikrn varjayitv . bhrm it , artipipartyo ca iti . kni etasy paribhy prayojanni . prayojanam avyaktnukaraasya ata itau . antyasya prpnoti . anarthake alontyavidhi na bhavati iti na doa bhavati . na etat asti prayojanam . cryapravrtti jpayati na antyasya pararpam bhavati iti yat ayam na mreitasya antyasya tu v iti ha . ghvaso et hau abhysalopa ca . ghvaso et hau abhysalopa ca iti antyasya prpnoti . anarthake alontyavidhi na bhavati iti na doa bhavati . etat api na asti prayojanam . punarlopavacanasmarthyt sarvasya bhaviyati . atha v it lopa kariyate . sa it sarvasya iti sarvdea bhaviyati . sa tarhi
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (94 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

akra kartavya . na kartavya . kriyate nyse eva . dviakraka nirdea : ghvaso et hau abhysalopaca iti . pi lopa aka anaci . tihati stram . anyath vykhyyate : pi hali lopa iti antyasya prpnoti . anarthake alontyavidhi na bhavati iti na doa bhavati . etat api na asti prayojanam . ana eva lopam vakymi . tat ana grahaam kartavyam . na kartavyam . prakrtam anuvartate . kva prakrtam . an pi aka iti . tat vai prathamnirdiam . ahnirditena ca iha artha . hali iti e saptam an iti prathamy ahm prakalpayiyati : tasmin iti nirdie prvasya iti . atra lopa abhysasya . atra lopa abhysasya iti antyasya prpnoti . anarthake alontyavidhi na bhavati iti na doa bhavati . etat api na asti prayojanam . atragrahaasmarthyt sarvasya bhaviyati . asti anyat atragrahaasya prayojanam . kim . sanadhikra apekyate , iha m bht : dadhau dadau . antarea api atragrahaam sanadhikram apekiymahe . san tarhi sakrdi apekyate sani sakrdau iti , iha m bht : jijpayiati . antarea api atragrahaam sanam sakrdim apekiymahe . prakrtaya tarhi apekyante . etsm prakrtnm lopa yath syt , iha m bht : pipakati yiyakati . antarea api atragrahaam et prakrt apekiymahe . viaya tarhi apekyate . muca akarmakasya gua v iti iha m bht : mumukati gm iti . antarea api atragrahaam viayam apekiymahe . katham . akarmakasya iti ucyate . tena yatra eva ayam muci akarmaka tatra eva bhaviyati . tasmt na artha anay paribhay . (P_1,1.65.3) KA_I,171.10-16 Ro_I,506 ala antyt prva al upadh iti v . atha v vyaktam eva pathitavyam ala antyt prva al upadhsaja bhavati iti . tat tarhi vaktavyam . na vaktavyam . avacant lokavijnt siddham . antarea api vacanam lokavijnt siddham etat . katham . loke amm brhmanm antyt prva nyatm iti ukte yathjtyaka antya tathjtyaka antyt prva nyate . (P_1,1.66-67.1) KA_I,171.18-172.17 Ro_I,507-511 kim udharaam . iha tvat : tasmin iti nirdie prvasya iti : ika ya aci : dadhi atra madhu atra . iha : tasmt iti uttarasya iti : dvayantarupasargebhya apa t : dvpam antarpam sampam . anyathjtyakena abdena nirdea kriyate anyathjtyaka udhriyate . kim puna udharaam . iha tvat : tasmin iti nirdie prvasya iti : tasmin ai ca yumksmkau iti . tasmt iti uttarasya iti : tasmt asa na pusi iti . idam ca api udharaam : ika ya aci dvyantarupasargebhya apa t iti . katham . sarvanmn ayam nirdea kriyate sarvanma ca smnyavci . tatra smnye nirdie vie api udharani bhavanti . kim puna smnyam ka v viea . gau smnyam kra viea . na tarhi idnm kra smnyam bhavati gau viea bhavati . bhavati ca . yadi smnyam api viea viea api smnyam smnyavieau na prakalpete . prakalpete ca . katham . vivakta . yad asya gau smnyena vivakita bhavati kra vieatvena tad gau smnyam kra viea . yad kra smnyena vivakita bhavati gau vieatvena tad kra smnyam kra viea . apara ha : prakalpete ca . katham . pitputravat . tat yath sa eva kam cit prati pit bhavati kam cit prati putra bhavati evam iha api sa eva kam cit prati smnyam kam cit prati viea . ete khalu api nairdeiknm vrttatarak bhavanti ye sarvanmn nirde kriyante . etai hi bahutarakam vypyate . atha kimartham upasargea nirdea kriyate . abde saptamy nirdie prvasya kryam yath syt arthe m bht : janapade atiyane iti . kim gatam etat upasargea hosvit abddhikyt arthdhikyam . gatam iti ha . katham . ni ayam bahirbhve
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (95 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

vartate . tat yath : nikrnta det nirdea . bahirdea iti gamyate . abda ca abdt bahirbhta artha abahirbhta . atha nirdiagrahaam kimartham . nirdiagrahaam nantaryrtham . nirdiagrahaam kriyate nantaryrtham . nantaryamtre kryam yath syt . ika ya aci : dadhi atra madhu atra . iha m bht :samidhau samidha , dradau drada . (P_1,1.66-67.2) KA_I,172.19-174.5 Ro_I,511-515 kimartham puna idam ucyate . tasmin tasmt iti prvottarayo yogayo aviet niyamrtham vacanam dadhi udakam pacati odanam . tasmin tasmt iti prvottarayo yogayo aviet niyamrtha ayam rambha . grme devadatta . prva para iti sandeha . grmt devadatta . prva para iti sandeha . evam iha api : ika ya aci . dadhi udakam , pacati odanam . ubhau ikau ubhau acau . aci prvasya aci parasya iti sandeha . ti atia iti atia prvasya atia parasya iti sandeha . iyate ca atra aci prvasya syt , atia parasya iti . tat ca antarea yatnam na sidhyati iti niyamrtham vacanam . asti prayojanam etat . kim tarhi iti . atha yatra ubhayam nirdiyate kim tatra prvasya kryam bhavati hosvit parasya iti . ubhayanirdee vipratiedht pacamnirdea . ubhayanirdee vipratiedht pacamnirdea bhaviyati . kim prayojanam . prayojanam ata lasrvadhtukanudttatve . vakyati tsydibhya anudttatve saptamnirdea abhyastasijartha iti . tasmin kriyame tsydibhya parasya lasrvadhtukasya lasrvadhtuke parata tsydnm iti sandeha . tsydibhya parasya lasrvadhtukasya . baho ihdnm dilopa . baho uttarem ihemeyasm ihemayasu parata baho iti sandeha . baho uttarem ihemeyasm . gota it . gota parasya sarvanmasthnasya sarvanmasthne parata gota iti sandeha . gota parasya sarvanmasthnasya . ruddibhya srvadhtuke . ruddibhya parasya srvadhtukasya srvadhtuke parata ruddnm iti sandeha . ruddibhya parasya srvadhtukasya . ne muk t sa . sa uttarasya nasya , ne parata sa iti sandeha . sa uttarasya nasya . mi sarvanmna su . sarvanmna uttarasya ma mi parata sarvanmna iti sandeha . sarvanmna uttarasya . ghe iti nady . nady uttarem itm itsu parata nady iti sandeha . nady uttarem itm . y pa . pa uttarasya ita iti parata pa iti sandeha . pa uttarasya ita . ama hrasvt aci amu nityam . ama uttarasya aca aci parata ama iti sandeha . ama uttarasya aca . vibhaktivieanirdenavakatvt avipratiedha . vibhaktivieanirdeasya anavakatvt ayukta ayam vipratiedha . sarvatra eva atra krtasmarthy saptam akrtasmrthy pacam iti krtv pacamnirdea bhaviyati . (P_1,1.66-67.3) KA_I,174.6-175.18 Ro_I,515-518 yathrtham v ahnirdea . yathrtham v ahnirdea kartavya . yatra prvasya kryam iyate tatra prvasya ah kartavy . yatra parasya kryam iyate tatra parasya ah kartavy . sa tarhi tath nirdea kartavya . na kartavya . anena eva praklpti bhaviyati : tasmin iti nirdie prvasya ah . tasmt iti nirdie parasya ah . tat tarhi ahgrahaam kartavyam . na kartavyam . prakrtam anuvartate . kva prakrtam . ah sthneyog iti . prakalpakam iti cet niyambhva . prakalpakam iti cet niyamasya abhva . uktam ca etat : niyamrtha ayam rambha iti . pratyayavidhau khalu api pacamy prakalpik syu . tatra ka doa . guptijkibhya san iti e pacam san iti prathamy ahm prakalpayet tasmt iti uttarasya iti . astu . na ka cit
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (96 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

dea pratinirdiyate . tatra ntaryata sana san eva bhaviyati . na evam akyam . itsaj na prakalpeta . upadee iti itsaj ucyate . prakrtivikrvyavasth ca . prakrtivikrayo ca vyavasth na prakalpeta . ika ya aci : aci iti e saptam ya iti prathamy ahm prakalpayet tasmin iti nirdie prvasya iti . saptampacamyo ca bhvt ubhayatra ahpraklpti tatra ubhayakryaprasaga . saptampacamyo ca bhvt ubhayatra eva ah prpnoti . tsydibhya iti e pacam lasrvadhtuke iti asy saptamy ahm prakalpayet tasmt iti uttarasya iti . tath lasrvadhtuke iti e saptam tsydibhya iti pacamy ahm prakalpayet tasmin iti nirdie prvasya iti . tatra ka doa . ubhayo kryam tatra prpnoti . na ea doa . yat tvat ucyate : prakalpakam iti cet niyambhva iti . m bht niyama . saptamnirdie prvasya ah prakalpyate pacamnirdie parasya . yvat saptamnirdie prvasya ah prakalpyate evam pacamnirdie parasya . na utsahate saptamnirdie parasya kryam bhavitum na api pacamnirdie prvasya . yat api ucyate : pratyayavidhau khalu api pacamy prakalpik syu iti . santu prakalpik . nanu ca uktam guptijkibhya san iti e pacam san iti prathamy ahm prakalpayet tasmt iti uttarasya iti . parihrtam etat : na ka cit dea pratinirdiyate . tatra ntaryata sana san eva bhaviyati iti . nanu ca uktam : na evam akyam . itsaj na prakalpeta . upadee iti itsaj ucyate iti . syt ea doa yadi itsaj deam pratketa . tatra khalu krtym itsajym lope ca krte dea bhaviyati . upadee iti hi itsaj ucyate . atha v na anutpanne sani praklpty bhavitavyam . yad ca utpanna san tad krtasmarthy pacam iti krtv praklpti na bhaviyati . yat api ucyate : prakrtivikrvyavasth ca iti . tatra api krt prakrtau ah ika iti vikrtau pratham ya iti . yatra ca nma sautr ah na asti tatra praklpty bhavitavyam . atha v astu tvat ika ya aci iti yatra nma sautr ah . yadi ca idnm aci iti e saptam ya iti prathamy ahm prakalpayet tasmin iti nirdie prvasya iti astu . na ka cit anya dea pratinirdiyate . tatra ntaryata yaa ya eva bhaviyati . yat api ucyate : saptampacamyo ca bhvt ubhayatra ahpraklpti tatra ubhayakryaprasaga iti . cryapravrtti jpayati na ubhe yugapat prakalpike bhavata iti yat ayam eka prvaparayo iti prvagrahaam karoti . (P_1,1.68.1) KA_I,175.20-23 Ro_I,519-520 rpagrahaam kim artham na svam abdasya aabdasaj bhavati iti eva rpam abasya saj bhaviyati . na hi anyat svam abdasya asti anyat ata rpt . evam tarhi siddhe sati yat rpagrahaam karoti tat jpayati crya asti anyat rpt svam abdasya iti . kim puna tat . artha . kim etasya jpane prayojanam . arthavadgrahae na anarthakasya iti e paribh na kartavy bhavati . (P_1,1.68.2) KA_I,175.24-176.24 Ro_I,520-523 kimartham puna idam ucyate . abdena arthagate arthasya asambhavt tadvcina sajpratiedhrtham svarpavacanam . abdena uccritena artha gamyate . gm naya dadhi ana iti artha nyate artha ca bhujyate . arthasya asambhavt . iha vykarae arthe kryasya asambhava . agne ak iti : na akyate agrebhya para hak kartum . abdena arthagate arthasya asambhavt yvanta tadvcina abd tvadbhya sarvebhya utpatti prpnoti . iyate ca tasmt eva syt iti . tat ca antarea yatnam na sidhyati iti tadvcina sajpratiedhrtham svarpavacanam . evamartham idam ucyate . na v abdaprvaka hi arthe sampratyaya tasmt arthanivrtti . na v etat prayojanam asti . kim kraam . abdaprvaka hi arthe
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (97 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

sampratyaya . abdaprvaka hi arthasya sampratyaya . ta ca abdaprvaka : ya api hi asau hyate nmn nma yad anena na upalabdham bhavati tada prcchati kim bhavn ha iti . abdaprvaka ca arthasya sampratyaya iha ca vykarae abde kryasya sambhava arthe asambhava . tasmt arthanivrtti bhaviyati . idam tarhi prayojanam aabdasaj iti vakymi iti . iha m bht : ddh ghu adp taraptamapau gha iti . sajpratiedhnarthakyam vacanaprmyt . sajpratiedha ca anarthaka . abdasajym svarpavidhi kasmt na bhavati . vacanaprmyt . abdasajvacanasmarthyt . nanu ca vacanaprmyt sajinm sampratyaya syt svarpagrahat ca sajy . etat api na asti prayojanam . cryapravrtti jpayati abdasajym na svarpavidhi bhavati iti yat ayam nt a iti akrnty sakhyy asajm sti . itarath hi vacanaprmyt nakrnty sakhyy sampratyaya syt svarpagrahat ca akrnty . na etat asti prayojanam . na hi akrnt saj . k tarhi . akrnt . asiddham jatvam . tasya asiddhatvt akrnt . mantrdyartham tarhi idam vaktavyam . mantre , rci yajui iti yat ucyate tat mantraabde rkabde ca yajuabde ca m bht . mantrdyartham iti cet strasmarthyt arthagate siddham . mantrdyartham iti cet na . kim kraam . strasmarthyt arthasya gati bhaviyati . mantre , rci yajui iti yat ucyate tat mantraabde rkabde ca yajuabde ca tasya kryasya sambhava na asti iti krtv mantrdisahacarita ya artha tasya gati bhaviyati shacaryt . (P_1,1.68.3) KA_I,176.25-177.16 Ro_I,523-525 sit tadviem vrkdyartham . sinnirdea kartavya . tata vaktavyam : tadviem grahaam bhavati iti . kim prayojanam . vrkdyartham . vibh vrkamrga iti : plakanyagrodham , plakanyagrodh . pit paryyavacanasya ca svdyartham . pinnirdea kartavya . tata vaktavyam : paryyavacanasya tadviem ca grahaam bhavati svasya ca rpasya iti . kim prayojanam . svdyartham . sve pua : svapoam puyati raipoam , vidypoam , gopoam avapoam . jit paryyavacanasya eva rjdyartham . jinnirdea kartavya . tata vaktavyam paryyavacanasya eva grahaam bhavati . kim prayojanam . rjdyartham . sabh rjmanuyaprv : inasabham varasabham . tasya eva na bhavati : rjasabh . tadviem ca na bhavati : puyamitrasabh candraguptasabh . jhit tasya ca tadviem ca matsydyartham . jhinnirdea kartavya . tata vaktavyam : tasya ca grahaam bhavati tadviem ca iti . kim prayojanam . matsydyartham . pakimatsyamrgn hanti : mtsyika . tadviem : pharika , kulika . paryyavacannm na bhavati : ajihmn hanti iti . asya ekasya paryyavacanasya iyate : mnn hanti mainika . (P_1,1.69.1) KA_I,177.18-178.7 Ro_I,525-527 apratyaya iti kimartham . sanasabhika u , a smpratike . atyalpam idam ucyate : apratyaya iti . apratyaydeaitkinmita iti vaktavyam . pratyaye udhrtam . dee : idama i : iha , ita . iti . lavit lavitum . kiti . babhva . miti . he anavan . ita parihra . cryapravrtti jpayati na ita savarnm grahaam bhavati iti yat ayam graha alii drghatvam sti . na etat asti jpakam . niyamrtham etat syt : graha alii drgha eva iti . yat tarhi vrta v iti vibhm sti . sarvem eva parihra : bhvyamnena savarnm grahaam na iti evam bhaviyati . pratyaye bhyn parihra : anabhidhnt pratyaya savarn na grahyati . yn hi pratyaya
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (98 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

savaragrahaena grhyt na tai arthasya abhidhnam syt . anabhidhnt na bhaviyati . idam tarhi prayojanam : iha ke cit pratyante ke cit pratyyyante . hrasv pratyante rgh pratyyyante . yvat bryt pratyyyamnena savarnam grahaam na iti tvat apratyaya iti . kam puna drgha savaragrahaena grhyt . hrasvam . yatndhikyt na grahyati . plutam tarhi grhyt . anatvt na grahyati . evam tarhi siddhe sati yat apratyaya iti pratiedham sti tat jpayati crya bhavati e paribh : bhvyamnena savarnm grahaam na iti . (P_1,1.69.2) KA_I,178.8-179.12 Ro_I,528-531 kimartham puna idam ucyate . a savarasya iti svarnunsikyaklabhedt . a savarasya iti ucyate . svarabhedt nunsikyabhedt klabhedt ca a savarn na grhyt . iyate ca savaragrahaam syt iti . tat ca antarea yatnam na sidhyati iti evamartham idam ucyate . asti prayojanam etat . kim tarhi iti . tatra pratyhragrahae savargrahaam anupadet . tatra pratyhragrahae savarnm grahaam na prpnoti : aka savare drgha iti . kim kraam . anupadet . yathjtyaknm saj krt tathjtyaknm sampratyyik syt . hrasvnm ca kriyate . hrasvnm eva sampratyyik syt drghnm na syt . nanu ca hrasv pratyamn drghn sampratyyayiyanti . hrasvasampratyayt iti cet uccryamasampratyyakatvt abdasya avacanam . hrasvasampratyayt iti cet uccryama abda sampratyyaka bhavati na sampratyamana . tat yath rk iti ukte samphamtram gamyate na asy artha gamyate . evam tarhi varaphe eva upadea kariyate . varaphe upadea iti cet avarklatvt paribhy anupadea . varaphe upadea iti cet avarklatvt paribhy anupadea . kim par strt kriyate iti ata avarakl . na iti ha . sarvath avarakl eva . varnm upadea tvat . upadeottarakla di antyena saha it iti pratyhra . pratyhrottarakl savarasaj . savarasajottaraklam audit savarasya ca apratyaya iti . s e upadeottarakl avarakl sat varnm utpattau nimittatvya kalpayiyate iti tat na . tasmt upadea . tasmt upadea kartavya . tatra anuvrttinirdee savargrahaam anatvt . tatra anuvrttinirdee savarnm grahaam na prpnoti : asya cvau yasya ti ca . kim kraam . anatvt . na hi ete aa ye anuvrttinirdee . ke tarhi . ye akarasammnye upadiyante . evam tarhi anatvt anuvrttau na anupadet ca pratyhre na . ucyate ca idam a savarn grhti iti . tatra vacant bhaviyati . vacant yatra tat na asti . na idam vacant labhyam . asti hi anyat etasya vacane prayojanam . kim . ye ete pratyhrm dita var tai savarnm grahaam yath syt . (P_1,1.69.3) KA_I,179.12-180.12 Ro_I,531-535 evam tarhi savare agrahaam aparibhyam krtigrahat . savare agrahaam aparibhyam . kuta . krtigrahat . avarkrti upadi s sarvam avarakulam grahyati . tath ivarakulkrti . tath uvarakulkrti . nanu ca any krti akrasya krasya ca . ananyatvt ca . ananykrti akrasya krasya ca . aneknta hi ananyatvakara . ya hi anekntena bheda na asau anyatvam karoti . tat yath : na ya go ca go ca bheda sa anyatvam karoti . ya tu khalu go ca avasya ca bheda sa anyatvam karoti . apara ha : savare agrahaam aparibhyam . krtigrahat ananyatvam . savare agrahaam aparibhyam . krtigrahat ananyatvam bhaviyati . ananykrti akrasya krasya ca . aneknta hi ananyatvakara . ya hi anekntena bheda na asau anyatvam karoti . tat yath : na ya go
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (99 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

ca go ca bheda sa anyatvam karoti . ya tu khalu go ca avasya ca bheda sa anyatvam karoti . tadvat ca halgrahaeu . evam ca krtv ca halgrahaeu siddham bhavati . jhala jhali : avttm avttam avtta yatra etat na asti a savarn grhti iti . aneknta hi ananyatvakara iti uktrtham . drutavilambitayo ca anupadet . drutavilambitayo ca anupadet manymahe krtigrahat siddham iti . yat ayam kasym cit vrttau varn upadiya sarvatra krt bhavati . asti prayojanam etat . kim tarhi iti . vrttiprthaktvam tu na upapadyate . vrtte tu prthaktvam na upapadyate . tasmt tatra taparanirdet siddham . tasmt tatra taparanirdea kartavya . na kartavya . kriyate etat nyse eva : ata bhisa ais iti . (P_1,1.70.1) KA_I,180.14-20 Ro_I,535-536 ayukta ayam nirdea . tat iti anena kla pratinirdiyate tat iti ayam ca vara . tatra ayuktam varasya klena saha smandhikarayam . katham tarhi nirdea kartavya . tatklaklasya iti . kim idam tatklaklasya iti . tasya kla tatkla , tatkla kla yasya sa ayam tatklakla , tatklaklasya iti . sa tarhi tath nirdea kartavya . na kartavya . uttarapadalopa atra draavya . tat yath uramukham iva mukham asya uramukha , kharamukha . evam tatklakla tatkla , tatklasya iti . atha v shacaryt tcchabdyam bhaviyati . klasahacarita vara api kla eva. (P_1,1.70.2) KA_I,180.21-181.24 Ro_I,537-540 kim puna idam niyamrtham hosvit prpakam . katham ca niyamrtham syt katham v prpakam . yadi atra agrahaam anuvartate tata niyamrtham . atha nivrttam tata prpakam . ka ca atra viea . tapara tatklasya iti niyamrtham iti cet drghagrahae svarabhinngrahaam . tapara tatklasya iti niyamrtham iti cet drghagrahae svarabhinnnm grahaam na prpnoti . kem . udttnudttasvaritnm . astu tarhi prpakam . prpakam iti cet hrasvagrahae drghaplutapratiedha . prpakam iti cet hrasvagrahae drghaplutayo tu pratiedha vaktavya . vipratiedht siddham . a savarn grhti iti etat astu tapara tatklasya iti v . tapara tatklasya iti etat bhavati vipratiedhena . a savarn grhti iti asya avaka hrasv atapar aa . tapara tatklasya iti asya avaka drgh tapar . hrasveu tapareu ubhayam prpnoti . tapara tatklasya iti etat bhavati vipratiedhena . yadi evam drutym taparakarae madhyamavilambitayo upasakhynam klabhedt . drutym taparakarae madhyamavilambitayo upasakhynam kartavyam tath madhyamym drutavilambitayo tath vilambitym drutamadhyamayo . kim puna kraam na sidhyati . klabhedt . ye hi drutym vrttau var tribhgdhik te madhyamym . ye madhyamym var tribhgdhik te vilambitym . siddham tu avasthit var vaktu circiravacant vrttaya viiyante . siddham etat . katham . avasthit var drutamadhyamavilambitsu . kikrta tu vrttiviea . vaktu circiravacant vrttaya viiyante . vakt ka cit vabhidhy bhavati , u varn abhidhatte . ka cit cirea ka cit ciratarea . tat yath : tam eva adhvnam ka cit u gacchati ka cit cirea gacchati ka cit ciratarea gacchati . rathika u gacchati vika cirea padti ciratarea . viama upanysa . adhikaraam atra adhv vrajikriyy . tatra ayuktam yat adhikaraasya vrddhihrsau sytm . evam tarhi sphoa abda dhvani abdagua . katham . bheryghtavat . tat yath bheryghta bherm hatya ka cit viati padni gacchati ka cit
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (100 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

triat ka cit catvriat . sphoa ca tvn eva bhavati . dhvanikrt vrddhi . dhvani sphoa ca abdnm dhvani tu khalu lakyate | alpa mahn ca kem cit ubhayam tat svabhvata . (P_1,1.71) KA_I,182.2-13 Ro_I,541-542 di antyena saha iti asampratyaya sajina anirdet . di antyena saha iti asampratyaya . kim kraam . sajina anirdet . na hi sajina nirdiyante . siddham tu di it saha tanmadhyasya iti vacant . siddham etat . katham . di antyena saha it grhyama svasya ca rpasya grhaka tanmadhynm ca iti vaktavyam . sambandhiabdai v tulyam . sambandhiabdai v tulyam etat . tat yath sambandhiabd : mtari vartitavyam , pitari uritavyam iti . na ca ucyate svasym mtari svasmin pitari iti sambandht ca gamyate y yasya mt ya ca yasya pit iti . evam iha api di antya iti sambandhiabdau etau . tatra sambandht etat gantavyam : yam prati di antya iti ca bhavati tasya grahaam bhavati svasya ca rpasya iti . (P_1,1.72.1) KA_I,182.15-183.2 Ro_I,542-544 iha kasmt na bhavati : ika ya aci : dadhi atra madhu atra . astu . ala antyasya vidhaya bhavanti iti antyasya bhaviyati . na evam akyam . ye anekla de teu doa syt : eca ayavyva iti . na ea doa . yath eva prakrtita tadantavidhi bhavati evam deata api bhaviyati . tatra ejantasya aydyant de bhaviyanti . yadi ca evam kva cit vairpyam tatra doa syt . api ca antaragabahirage na prakalpyeytm . tatra ka doa . syona , syon : antaragalakaasya yadeasya bahiragalakaa gua bdhaka prasajyeta . naabdam hi ritya yadea naabdam ritya gua . alvidhi ca na prakalpeta : dyau , panth , sa iti . tasmt prakrte tadantavidhi iti vaktavyam . na vaktavyam . yena iti karae e trty anyena ca anyasya vidhi bhavati . tat yath : devadattasya samam arvai odanena ca yajadatta pratividhatte , tath sagrmam hastyavarathapadtibhi . evam iha api ac dhto yatam vidhatte . akrea prtipadikasya iam vidhatte . (P_1,1.72.2) KA_I,183.3-16 Ro_I,544-546 yena vidhi tadantasya iti cet grahaopdhnm tadantopdhiprasaga . yena vidhi tadantasya iti cet grahaopdhnm tadantopdhitprasaga . ye grahaopdhaya te api tadantopdhaya syu . tatra ka doa . uta ca pratyayt asayogaprvt iti asayogaprvagrahaam ukrntvieaam syt . tatra ka doa . asayogaprvagrahaena iha eva paryudsa syt:: akuhi takuhi iti . iha na syt : pnuhi aknuhi iti . tath ut othyaprvasya iti ohyaprvagrahaam rkrntavieaam syt . tatra ka doa . ohyaprvagrahaena iha ca prasajyeta : sakram iti . iha ca na syt : niprt pi iti . siddham tu vieaavieyayo yatheatvt . siddham etat . katham . yatheam vieaavieyayo yoga bhavati . yvat yatheam iha tvat : uta ca pratyayt asayogaprvt iti na asayogaprvagrahaena ukrntam vieyate . kim tarhi . ukra eva vieyate : ukra ya asayogaprva tadantt pratyayt iti . tath ut othyaprvasya iti na ohaprvagrahaena rkrntam vieyate . kim tarhi . rkra eva vieyate : rkra ya ohyaprva tadantasya dhto iti . (P_1,1.72.3) KA_I,183.17-184.25 Ro_I,546-550 samsapratyayavidhau pratiedha . samsavidhau pratyayavidhau ca pratiedha vaktavya . samsavidhau tvat : dvity ritdibhi samasyate : kaarita , narakarita . kaam paramarita iti atra m bht .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (101 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

pratyayavidhau : naasya apatyam nyana . iha na bhavati : stranaasya apatyam sautrani . kim avieea . na iti ha . ugidvaragrahaavarjam . ugidgrahaam varagrahaam ca varjayitv . ugidgrahaam : bhavat , atibhavat mahat , atimahat . varagrahaam : ata i : dki , plki . asti ca idnm ka cit kevala akra prtipadikam yadartha vidhi syt . asti iti ha . atate a : a , tasya apatyam : ata i i . akacnamvata sarvanmvyayadhtuvidhau upasakhynam . akacvata sarvanmvyayavidhau namvata dhtuvidhau upasakhynam kartavyam . akacvata : sarvake vivake . avyayavidhau : uccakai ncakai . namvata : bhinatti chinatti . kim puna kraam na sidhyati . iha tasya v grahaam bhavati tadantasya v . na ca idam tat na api tadantam . siddham tu tadantntavacant . siddham etat . katham . tadantntavacant . tadantntasya iti vaktavyam . kim idam tadantntasya iti . tasya anta tadanta , tadanta anta yasya tat idam tadantntam , tadantntasya iti . sa tarhi tath nirdea kartavya . na kartavya . uttarapadalopa atra draavya . tat yath : uramukham iva mukham asya : uramukha , kharamukha . evam iha api tadanta anta yasya tadantasya iti . tadekadeavijnt v siddham . tadekadeavijnt v puna siddham etat . tadekadeabhta tadgrahaena grhyate . tat yath gag yamun devadatt iti . anek nad gagm yamunm ca pravi gagyamungrahaena grhyate . tath devadattstha garbha devadattgrahaena grhyate . viama upanysa . iha ke cit abd aktaparimnm arthnm vcak bhavanti ye ete sakhyabd parimaabd ca . paca sapta iti : ekena api apye na bhavanti . droa khr hakam iti : na eva adhike bhavanti na nyne . ke cit yvat eva tat bhavati tvat eva hu ye ete jtiabd guaabd ca . tailam ghrtam iti : khrym api bhavanti droe api . ukla nla kra iti : himavati api bhavati vaakaikmtre api dravye . im ca api saj aktaparimnm arthnm kriyante . t kena adhikasya syu . evam tarhi cryapravrtti jpayati tadekadeabhtam tadgrahaena grhyate iti yat ayam na idamadaso ako iti sakakrayo idamadaso pratiedham sti . katham krtv jpakam . idamadaso kryam ucyamnam ka prasaga yat sakakrayo syt . payati tu crya tadekadeabhtam tadgrahaena grhyate iti . tata sakakrayo pratiedham sti . (P_1,1.72.4) KA_I,184.26-186.24 Ro_I,550-554 kni puna asya yogasya prayojanni . prayojanam sarvanmvyayasajym . sarvanmvyayasajym prayojanam : sarve paramasarve vive paramavive , uccai , paramoccai , ncai , paramancai iti . upapadavidhau bhayhydigrahaam . upapadavidhau bhayhydigrahaam prayojanam : bhayakara , abhayakara , hyakaraam , khyakaraam . bvidhau ugidgrahaam . bvidhau ugidgrahaam prayojanam : bhavat , atibhavat mahat , atimahat . pratiedhe svasrdigrahaam . pratiedhe svasrdigrahaam prayojanam : svas paramasvas duhit paramaduhit . aparimabistdigrahaam ca pratiedhe . aparimabistdigrahaam ca pratiedhe prayojanam . aparimabistcitakambalebhya na taddhitaluki : dvibist dviparamabist tribist triparamabist dvycit dviparamcit . diti . ditigrahaam ca prayojanam . dite apatyam daitya , adite apatyam ditya . dityadityditya iti aditigrahaam na kartavyam bhavati . roy a . roy agrahaam ca prayojanam : jakaroa , saihakaroa . tasya ca . tasya ca iti vaktavyam : raua . kim puna kraam na sidhyati . tadantt ca tadantavidhin siddham kevalt ca vyapdeivadbhvena . vyapdeivadbhva
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (102 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

aprtipadikena . kim puna kraam vyapdeivadbhva aprtipadikena . iha : strntt hak bhavati dantt a bhavati iti : kevalt utpatti m bht iti . na etat asti prayojanam . siddham atra tadantt ca tadantavidhin kevalt ca vyapdeivadbhvena . sa ayam evam siddhe sati yat antagrahaam karoti tat jpayati crya strntt eva dantt eva iti . na atra tadantt utpatti prpnoti . idnm eva hi uktam : samsapratyayavidhau pratiedha iti . s tarhi e paribh kartavy . na kartavy . cryapravrtti jpayati vyapdeivadbhva aprtipadikena iti yat ayam prvt ini saprvt ca iti ha . na etat asti prayojanam . asti hi anyat etasya vacane prayojanam . kim . saprvt prvt inim vakymi iti . yat tarhi yogavibhgam karoti . itarath hi prvt saprvt iti eva bryt . kim puna ayam asya eva ea : tasya ca iti . na iti ha . yat ca anukrntam yat ca anukrasayte sarvasya eva ea tasya ca iti . rathasthalebhya yadvidhau . rathasthalebhya yadvidhau prayojanam : rathya , paramarathya , styam , paramastyam , haly paramahaly . susarvrdhadikabdebhya janapadasya . susarvrdhadikabdebhya janapadasya prayojanam : supclaka , sumgadhaka . su . sarva : sarvapclaka , sarvamgadhaka . sarva . ardha : ardhapclaka , ardhamgadhaka . ardha . dikabda : prvapclaka , prvamgadhaka . rto vrddhimadvidhau avayavnm . rto vrddhimadvidhau avayavnm prayojanam : prvaradam , apararadam , prvanaidgham , aparanaidgham . havidhau sakhyy . havidhau sakhyy prayojanam : dviikam , pacaikam . dharmt naa . dharmt naa prayojanam : dharmam carati dhrmika , adharmam carati dharmika . adharmt ca iti na vaktavyam bhavati . (P_1,1.72.5) KA_I,187.1-188.23 Ro_I,555-561 padgdhikre tasya ca taduttarapadasya ca . padgdhikre tasya ca taduttarapadasya ca iti vaktavyam . paddhikre kim prayojanam . prayojanam iikekmlnm citatlabhriu : iakacitam cinvta , pakveikcitam cinvta , ikatlena mujekatlena mlabhri kany , utpalamlabhri kany . agdhikre kim prayojanam . mahadapsvasrtrm drghavidhau . mahadapsvasrtrm drghavidhau prayojanam : mahn , paramamahn . mahat . ap : pa tihanti , svpa tihanti . ap . svasr : svas svasrau svasra , paramasvas paramasvasrau paramasvasra . svasr . naptr : napt naptrau naptra . evam paramanapt paramanaptrau paramanaptra . padyumadasmadasthydyanuha num . padbhva prayojanam : divpada paya . asti ca idnm ka cit kevala pcchabhda yadartha vidhi syt . na asti iti ha . evam tarhi agdhikre prayojanam na asti iti krtv paddhikrasya idam prayojanam uktam : himakihatiu ca : yath patkiau patkia evam paramapatkiau paramapatkia . yadi tarhi paddhikre pdasya tadantavidhi bhavati pdasya pada jyatigopahateu : yath iha bhavati : pdena upahatam padopahatam atra api syt : digdhapdena upahatam digdhapdopahatam . evam tarhi agdhikre eva prayojanam . nanu ca uktam na asti kevala pcchabda iti . ayam asti pdayate apratyaya pt : pad pade . pad . yumat asmat : yyam , vayam atiyyam ativayam . asthydi : asthn dadhn sakthn parmsthn paramadadhn paramasakthn . anauha num : anavn , paramnavn . dyupathimathipugosakhicaturanauttrigrahaam . dyupathimathipugosakhicaturanauttrigrahaam prayojanam : dyau , sudyau , panth , supanth , manth , sumanth , paramamanth , pumn paramapumn , gau , sugau ,
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (103 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

sakh sakhyau sakhya , susakh susakhyau susakhya , paramasakh paramasakhyau paramasakhya , catvra paramacatvra , anavha , parmnavha , traym , paramatraym . tyaddividhibhastrdistrgrahaam ca . tyaddividhibhastrdistrgrahaam ca prayojanam : sa , atisa , bhastrak bhastrik nirbhastrak nirbhastrik bahubhastrak bahubhastrik . strgrahaam ca prayojanam . striyau striya rjastriyau rjastriya . varagrahaam ca sarvatra . varagrahaam ca sarvatra prayojanam . kva sarvatra . agdhikre ca anyatra ca . anyatra udhrtam . ngdhikre : ata drgha yai supi ca : iha eva syt : bhym . ghabhym iti atra na syt . pratyayagrahaam ca apacamy . pratyayagrahaam ca apacamy prayojanam : yaio phak bhavati . grgyyaa vtsyyana paramagrgyyaa paramavtsyyana . apacamy iti kimartham . drattr pariattr . al eva anarthakena na anyena anarthakena iti vaktavyam . kim prayojanam . hangrahae plhangrahaam m bht . udgrahae garmudgrahaam . strgrahae astrgrahaam . sagrahae pyasam karoti iti m bht . kimartham idam ucyate na padgdhikre tasya ca taduttarapadasya ca iti eva siddham . na ca idam tat na api taduttarapadam . tat na vaktavyam bhavati . kim puna atra jyya . tadantavidhi eva jyyn . idam api siddham bhavati : paramtimahn . etat hi na eva tat na api taduttarapadam . aninasmangrahani ca arthavat ca anarthakena ca tadantavidhim prayojayanti . an : rj iti arthavat smn iti anarthakena . an . in : da* iti arthavat vgm* iti anarthakena . in . as : supay iti arthavat susrot iti anarthakena . as . man : suarm iti arthavat suprathim iti anarthakena . (P_1,1.72.6) KA_I,188.24-189.2 Ro_I,561 yasmin vidhi taddau algrahae . algrahaeu yasmin vidhi taddau iti vaktavyam . kim prayojanam . aci nudhtubhruvm yvo iyauvaau iti iha eva syt : riyau bhruvau . riya , bhruva iti atra na syt . (P_1,1.73.1) KA_I,189.4-22 Ro_I,562-565 vrddhigrahaam kimartham. yasya acm di tat vrddham iti iyati ucyamne dtt , rkit atra api prasajyeta . vrddhigrahae puna kriyame na doa bhavati . atha yasyagrahaam kimartham . yasya iti vyapadeya . atha ajgrahaam kimartham . vrddhi yasya di tat vrddham iti iyati ucyamne iha eva syt : aitikyany , aupagavy . iha na syt : grgy , vtsy iti . ajgrahae puna kriyame na doa bhavati . atha digrahaam kimartham . vrddhi yasya acm tat vrddham iti iyati ucyamne sabhsannayane bhava sbhasannayana iti atra prasajyeta . digrahae puna kriyame na doa bhavati . vrddhasajym ajasannivet anditvam . vrddhasajym ajasannivet di iti etat na upapadyate . na hi acm sannivea asti . nanu ca evam vijyate : ac eva di ajdi . na evam akyam . iha eva prasajyeta : aupagavy . iha na syt : grgy iti . ekntditvam tarhi vijyate . ekntditve ca sarvaprasaga . iha api prasajyeta : sabhsannayane bhava sbhasannayana iti . siddham ajkrtinirdet . siddham etat . katham . ajkrti nirdiyate . evam api vyajanai vyavahitatvt na prpnoti . vyajanasya avidyamnatvam yath anyatra . vyajanasya avidyamnavadbhva vaktavya yath anyatra api bhavati vyajanasya avidyamnavadbhva . kva anyatra . svare . (P_1,1.73.2) KA_I,189.23-190.10 Ro_I,565-566 v nmadheyasya . v nmadheyasya vrddhasaj vaktavy : devadatty , daivadatt , yajadatty , yjadatt . gotrottarapadasya ca . gotrottarapadasya ca vrddhasaj vaktavy : kambalacryay ,
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (104 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

odanapiny , ghrtarauhy . gotrntt v asamastavat . gotrntt v asamastavat pratyaya bhavati iti vaktavyam : etni eva udharani . kim avieea . na iti ha . jihvktyaharitaktyavarjam . jihvktyam haritaktyam ca varjayitv : jaihavkt , hritakt . kim puna atra jyya . gotrntt v asamastavat iti eva jyya . idam api siddham bhavati : pigalakvasya chttr paigalakv . (P_1,1.74) KA_I,190.12-18 Ro_I,566-567 yasycmdigrahaam anuvartate utho na . kim ca ata . yadi anuvartate iha ca prasajyeta : tvatputrasya chttr tvtputr , mtputr iha ca na syt : tvadya , madya iti . atha nivrttam e prcm dee yasycmdigrahaam kartavyam . evam tarhi anuvartate . katham tvputr , mtputr iti . sambandham anuvartiyate . vrddhi yasya acm di tat vrddham . tyaddni ca vrddhasajni bhavanti . vrddhi yasya acm di tat vrddham . e prcm dee . yasycmdigrahaam anuvartate . vrddhigrahaam nivrttam . tat yath ka cit kntre samupasthite srtham updatte . sa yad nikntrbhta bhavati tad srtham jahti (P_1,1.75) KA_I,190.20-21 Ro_I,567-568 saipurik skaunagarik skaunagarik iti . e prcm dee aiikeu iti vaktavyam : saipurik

(P_1,2.1.1) KA_I,191.2-192.12 Ro_II,3-7 itkidvacane tayo abhvt aprasiddhi . itkidvacane tayo abhvt , akrakakrayo abhvt , ittvakittvayo aprasiddhi . sat hi abhisambandha akyate kartum na ca atra akrakakrau itau payma . tat yath citragu devadatta iti : yasya t gva santi sa eva tbhym abdbhym akyate abhisambandhum . bhvyete tarhi anena . gkudibhya ait it bhavati iti . asayogt li kit bhavati iti . bhavati iti cet deapratiedha . bhavati iti cet deasya pratiedha vaktavya . akrakakrau itau deau prpnuta . katham puna itsaja nma dea syt . kim hi vacant na bhavati . evam tarhi ahnirdiasya de ucyante na ca atra ahm payma . gkudibhya iti e pacam ait iti prathamy ahm prakalpayiyati tasmt iti uttarasya iti . sajkaraam tarhi idam . gkudibhya ait itsaja bhavati iti . asayogt li kitsaja bhavati iti . sajkarae kidgrahae asampratyaya abdabhedt . sajkarae kidgrahae asampratyaya syt . kim kraam . abdabhedt . anya hi abda kiti iti anya kiti iti iti iti ca . tath kidgrahaeu idgrahaeu ca anayo eva sampratyaya syt . tadvadatidea tarhi ayam : gkudibhya ait idvat bhavati iti . asayogt li kidvat bhavati iti . sa tarhi vatinirdea kartavya . na hi antarea vatim atidea gamyate . antarea api vatim atidea gamyate . tat yath : ea brahmadatta . abrahmadattam brahmadatta iti ha . te manymahe brahmadattavat ayam bhavati iti . evam iha api aitam it iti ha . idvat iti gamyate . akitam kit iti ha . kidvat iti gamyate . tadvadatidee akidvidhiprasaga . tadvadatidee akidvidhi api prpnoti . srjidro jhali am akiti : sisrkati didrkate : akillakaa amgama prpnoti . siddham tu prasajyapratiedht . siddham etat . katham . prasajya ayam pratiedha kriyate : kiti na iti . sarvatra sanantt tmanepadapratiedha . sarveu pakeu sanantt tmanepadam prpnoti . uccukuiati nicukuiati : iti iti tmanepadam prpnoti . tasya pratiedha vaktavya . siddham tu prvasya krytidet . siddham etat . katham . prvasya yat kryam tat atidiyate . kim vaktavyam etat . na hi . katham anucyamnam gasyate . saptamyarthe api vati bhavati . tat yath : mathurym iva mathurvat paliputre iva paliputravat evam
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (105 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

iti iva idvat . (P_1,2.1.2) KA_I,192.13-193.13 Ro_II,7-10 atha kimartham prthak itkitau kriyete na sarvam kit eva v syt it eva v . prthaganubandhatve prayojanam vacisvapiyajdnm asamprasraam srvadhtukacadiu . prthaganubandhatve prayojanam vacisvapiyajdnm asamprasraam srvadhtuke cadiu ca. srvadhtuke prayojanam : yath iha bhavati supta , suptavn iti evam svapita , svapitha : atra api prpnoti . cadiu prayojanam . ke puna cadaya . caanajivanibathanaa . ca : yath iha bhavati na , navn iti evam aiviyat : atra api prpnoti . a : yath iha bhavati na , ukta iti evam avat , avocat : atra api prpnoti . naji : yath iha bhavati supta iti evam svapnak : atra api prpnoti . vanip : yath iha bhavati ia iti evam yajv : atra api prpnoti . atha : yath iha bhavati uita iti evam vasatha : atra api prpnoti . na : yath iha bhavati iam evam yaja : atra api prpnoti . jgra aguavidhi . jgarte aguavidhi prayojanam . yath iha bhavati jgrta , jgrtha iti aiti iti paryudsa evam jgarita, jgaritavn iti atra api prpnoti . apara ha : jgra guavidhi . jgarte guavidhi prayojanam . yath iha bhavati jgarita , jgaritavn evam jgrta jgrtha iti atra api prpnoti . kudnm ipratiedha . kudnm ipratiedha prayojanam . yath iha bhavati ltv ptv ryuka kiti iti ipratiedha evam nuvit dhuvit : atra api prpnoti . ktvym kitpratiedha ca . ktvym kitpratiedha ca prayojanam . kim ca . ipratiedha ca . na iti ha . adee ayam ca pahita . ktvym ca kitpratiedha iti . yath iha bhavati devitv sevitv na ktv se iti pratiedha evam kuitv puitv : atra api prpnoti . atha v dee eva ayam ca pahita . ktvym kitpratiedha ca ipratiedha ca . ipratiedha : yath iha bhavati ltv ptv ryuka kiti iti ipratiedha evam nuvitv dhuvitv : atra api prpnoti . syt etat prayojanam yadi atra niyogata tideikena ittvena aupadeikam kittvam bdhyeta . sati api tu ittve kit eva ea . tasmt ntv dhtv iti eva bhavitavyam . (P_1,2.4.1) KA_I,193.15-22 Ro_II,10-11 srvadhtukagrahaam kimartham . apit iti iyati ucyamne rdhadhtukasya api apita ittvam prasajyeta : kart hart . na ea doa . cryapravrtti jpayati na anena rdhadhtukasya ittvam bhavati iti yat ayam rdhadhtukyn kn cit ita karoti : caanajivanibathanaa . srvadhtuke api etat jpakam syt . na iti ha . tulyajtyasya jpakam . ka ca tulyajtya . yathjtyak caanajivanibathanaa . kathajtyak ca ete . rdhadhtuk . yadi etat asti tulyajtyasya jpakam iti caaau luvikaranam jpakau sytm naji vartamnaklnm vanip bhtaklnm athaabda audiknm naabda ghaarthnm . tasmt srvadhtukagrahaam kartavyam . (P_1,2.4.2) KA_I,193.23-194.7 Ro_II,11-12 kim puna ayam paryudsa : yat anyat pita , hosvit prasajya ayam pratiedha : pit na iti . ka ca atra viea . apit it iti cet abdekdeapratiedha divattvt . apit it iti cet abdekdee pratiedha vaktavya : cyavante plavante . kim kraam . divattvt . pidapito ekdea apita divat syt . asti anyat pita iti krtv ittvam prpnoti . astu tarhi prasajyapratiedha : pit na iti . na pit it iti cet uttamaikdeapratiedha . pit na iti cet uttamaikdee pratiedha prpnoti : tudni likhni . kim kraam . divattvt eva . pidapito ekdea pita divat syt . tatra pit na iti pratiedha prpnoti . yath icchasi tath astu . nanu ca uktam ubhayath api doa iti . ubhayath api na
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (106 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

doa . ekdea prvavidhau sthnivat iti sthnivadbhvt vyavadhnam . (P_1,2.5) KA_I,194.9-16 Ro_II,12-13 rdupadhebhya lia kittvam gut vipratiedhena . rdupadhebhya lia kittvam gut bhavati vipratiedhena : vavrte vavrdhe . uktam v . kim uktam . na v ksasya anavakatvt apavda guasya iti . viama upanysa . yuktam tatra yat anavakam kitkaraam guam bdhate . iha puna ubhayam svakam . kitkaraasya avaka: jatu ju . guasya avaka : vartitv vardhitv . iha ubhayam prpnoti : vavrte vavrdhe . paratvt gua prpnoti . idam tarhi uktam : iavc paraabda . vipratiedhe param yat iam tat bhavati itI . (P_1,2.6) KA_I,194.18-195.2 Ro_II,14 kimartham idam ucyate . indhe samyogrtham vacanam bhavate pidartham . ayam yoga akya avaktum . katham . indhe chandoviayatvt bhuva vuka nityatvt tbhym kidvacannarthakyam . indhe chandoviaya li . na hi antarea chanda indhe anantara li labhya . m bhym bhavitavyam . bhuva vuka nityatvt . bhavate api nitya vuk . krte api prpnoti akrte api . tbhym kidvacannarthakyam . tbhym indhibhavitibhym kidvacanam anarthakam . (P_1,2.7) KA_I,195.4-12 Ro_II,15 kimartham mrdibhya parasya ktva kittvam ucyate . kit eva hi ktv . na ktv se iti pratiedha prpnoti tadbdhanrtham . yadi tarhi mrdibhya parasya ktva kittvam ucyate na artha na ktv se iti anena kittvapratiedhena . idam niyamrtham bhaviyati : mrdibhya eva parasya ktva kittvam bhavati na anyebhya iti . yadi niyama kriyate iha api tarhi niyamn na prpnoti : ltv ptv . atra api akittvam prpnoti . tulyajtyasya niyama . ka ca tulyajtya . yathjtyaka mrdibhya para ktv . kathajtyaka mrdibhya para ktv . se . evam api asti atra ka cit vibhite . sa anim niymaka syt . astu tvat ye sea tem grahaam niyamrtham . ya idnm vibhite tasya grahaam vidhyartham bhaviyati . (P_1,2.8) KA_I,195.14 Ro_II,16 svapipracchyo sanartham grahaam kit eva hi ktv .

(P_1,2.9) KA_I,195.16-197.11 Ro_II,16-21 kimartham ika parasya sana kittvam ucyate . ika kittvam gua m bht . ika kittvam ucyate gua m bht iti : cicati tuati . na etat asti prayojanam . drghrambht . drghatvam atra bdhakam bhaviyati . krte bhavet . krte khalu drghatve gua prpnoti . anarthakam tu . anarthakam evam sati drghatvam syt . na anarthakam . hrasvrtham . hrasvnm drghavacanasmarthyt gua na bhaviyati . bhavet hrasvnm drghavacanasmarthyt gua na syt . drghm tu prasajyate . drghm tu khalu gua prpnoti . nanu ca drghm api drghavacanasmarthyt gua na bhaviyati . na drghm drgh prpnuvanti . kim kraam . na hi bhuktavn puna bhukte na ca krtamaru puna marni krayati . nanu ca puna pravrtti api dr . bhuktavn ca puna bhukte krtamaru ca puna marni krayati . smarthyt hi puna bhvyam . smarthyt tatra puna pravrtti bhavati bhojanaviet ilpiviet v . drghm puna drghatvavacane na kim cit prayojanam asti . akrtakri khalu api stram agnivat . tat yath agni yad adagdham tat dahati . drghm api drghavacane etat prayojanam gua m bht iti . krtakri khalu api stram parjanyavat . tat yath parjanya yvat nam pram ca sarvam abhivarati . yath eva tarhi drghavacanasmarthyt gua na bhavati evam rdittvam api na
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (107 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prpnoti : cikrati jihrati iti. rdittvam drghasarayam . na akrte drghe rdittvam prpnoti . kim kraam . rta iti ucyate . bhavet hrasvnm na akrte drghe rdittvam syt drghm tu khalu akrte api drghatve rdittvam prpnoti . drghm na akrte drghe . drghm api na akrte drghe rdittvam prpnoti . yad drghatvena gua bdhita tata uttaraklam rdittvam bhavati . ilopa tu prayojanam . idam tarhi prayojanam : ilopa yath syt iti : jpsati . kva ast kva nipatit kva kittvam kva ilopa . ka v abhisambandha yat sati kittve ilopa syt asati na syt . ea abhisambandha yat sati kittve svakam drghatvam paratvt ilopa bdhate . asati puna kittve anavakam drghatvam yath eva guam bdhate evam ilopam api bdheta . tatra ilopasya avaka : kra hra . drghatvasya avaka : cicati tuati . iha ubhayam prpnoti : jpsati . paratvt ilopa . asati api kittve svakam drghatvam . ka avaka . isbhva . nimitsati pramitsati . mntiminotyo drghatve krte mgrahaena grahaam yath syt . yath eva tarhi asati kittve svakam drghatvam paratvt ilopa bdhate evam gua api bdheta . tasmt kittvam vaktavyam . ika kittvam gua m bht drghrambht krte bhavet | anarthakam tu hrasvrtham drghm tu prasajyate || smarthyt hi puna bhvyam rdittvam drghasarayam drghm na akrte drghe ilopa tu prayojanam . (P_1,2.10) KA_I,197.13-22 Ro_II,22-23 ayukta ayam nirdea . katham hi ika nma hal anta syt anyasya anya . katham tarhi nirdea kartavya . igvata hala iti . yadi evam yiyakati atra api prpnoti . evam tarhi igupadht halantt iti vakymi . evam api dambhe na prpnoti . stram ca bhidyate . yathnysam eva astu . nanu ca uktam ayukta ayam nirdea iti . na ayukta . antaabda ayam asti eva avayavavc . tat yath vastrnta , vasannta : vastrvayava , vasanvayava iti gamyate . asti smpye vartate . tat yath udakntam gata iti . udakasampam gata iti gamyate . tat ya smpye vartate tasya idam grahaam . evam api dambhe na sidhyati . ya atra iksampe hal na tasmt uttara san . yasmt uttara san na asau iksampe hal . evam tarhi dambhe halgrahaasya jtivcakatvt siddham . haljti nirdiyate : ika uttar y haljti iti . (P_1,2.11) KA_I,197.24-198.16 Ro_II,24-25 katham idam vijyate : tmanepadam yau lisicau iti hosvit tmanepadeu parata yau lisicau iti . kim ca ata. yadi vijyate tmanepadam yau lisicau iti li vieita sic avieita . atha vijyate tmanepadeu parata yau lisicau iti sic vieita li avieita . yath icchasi tath astu . astu tvat tmanepadam yau lisicau iti . nanu ca uktam . li vieita sic avieita iti . sic ca vieita . katham . tmanepadam sic na asti iti krtv tmanepadapare sici kryam vijsyate . atha v puna astu tmanepadeu parata yau lisicau iti . nanu ca uktam sic vieita li avieita iti . li ca vieita . katham . tmanepadeu parata li na asti iti krtv tmanepade lii kryam vijsyate . na eva v puna artha livieaena tmanepadagrahaena . kim kraam . jhal iti vartate . tmanepadeu ca eva li jhaldi na parasmaipadeu . tat etat sijvieaam tmanepadagrahaam . atha sijvieae tmanepadagrahae sati kim prayojanam . iha m bht : aykt , avtst . na etat asti . ika iti vartate . evam api anait , acait : atra api prpnoti . etat api na asti prayojanam . halantt iti vartate . evam api akot , amot : atra api prpnoti . na etat asti prayojanam . jhal iti vartate . evam api abhaitst , acchaitst : atra api prpnoti . na etat asti . iglakaayo guavrddhyo pratiedha na ca e
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (108 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

iglaka vrddhi . idam tarhi prayojanam : iha m bht : adrkt , asrkt . kim ca syt . akillakaa amgama na syt . (P_1,2.17) KA_I,198.18-199.4 Ro_II,25-27 it ca kasya takrettvam . kasya heto ikra tapara kriyate . drgha m bht . drgha m bht iti . rte api sa . antarea api rambham siddha atra drgha : ghumsthgpjahti iti . anantare pluta m bht . idam tarhi prayojanam : anantare pluta m bht iti . kuta nu khalu etat anantarrthe rambhe hrasva bhaviyati na puna pluta iti . pluta ca viaye smrta . viaye khalu pluta ucyate . yad ca sa viaya bhavitavyam eva tad plutena . it ca kasya takrettvam drgha m bht rte api sa | anantare pluta m bht pluta ca viaye smrta (P_1,2.18) KA_I,199.6-200.24 Ro_II,27-31 na se iti krte akittve . na se iti eva siddham . na artha ktvgrahaena . nihyam api tarhi prpnoti : gudhita gudhitavn iti . nihym avadhrat . nihym avadhrat na bhaviyati . kim avadhraam . nih svidimidikvididhra iti . parokym tarhi prpnoti . kim ca syt . papiva papima : kiti iti kralopa na syt . m bht evam . ii iti evam bhaviyati . idam tarhi : jagmiva jaghniva . kiti iti upadhlopa na syt . jpakt na parokym . jpakt parokym na bhaviyati . kim jpakam . sani jhalgrahaam vidu . yat ayam ika jhal iti jhalgrahaam karoti tat jpayati crya aupadeikasya kittvasya pratiedha na tideikasya iti . katham krtv jpakam . jhalgrahaasya etat prayojanam : iha m bht : iayiate iti . yadi ca atra tideikasya kittvasya pratiedha syt jhalgrahaam anarthakam syt . astu atra kittvam . na se iti pratiedha bhaviyati . payati tu crya aupadeikasya kittvasya pratiedha na tideikasya iti . tata jhalgrahaam karoti . na etat asti prayojanam . uttarrtham etat syt . sthghvo it ca jhaldau yath syt . iha m bht : upsthyitm upsthyiata . ittvam kitsanniyogena . kitsanniyogena ittvam ucyate . tena asati kittve ittvam na bhaviyati . rea tulyam sudhvani . tat yath sudhv supv : psanniyogena ra ucyamna asati pi na bhavati . atha v astu atra ittvam . k rpasiddhi . vrddhau krtym ydea bhaviyati . vasvartham . vasvartham tarhi ktvgrahaam kartavyam . vasau hi aupadeikam kittvam . kim ca syt . papivn papimn : kiti iti kralopa na syt . m bht evam . ii iti evam bhaviyati . idam tarhi : jagmivn , jaghnivn : kiti iti upadhlopa na syt . kidatdet . astu atra aupadeikasya kittvasya pratiedha . tideikasya kittvam bhaviyati . yatra tarhi tat pratiidhyate : aje jivn iti . evam tarhi chndas kvasu li ca chandasi srvadhtukam api bhavati . tatra srvadhtukam apit it bhavati iti iti upadhlopa bhaviyati . nigrhti . nigrhti prayojanam . idam tarhi prayojanam : iha m bht : nigrhti , upasannihiti , nikuciti . tat tarhi ktvgrahaam kartavyam . na kartavyam . ktv ca vigraht . uparit yogavibhga kariyate : na se nih svidimidikvididhra . mra titikym . udupadht bhvdikarmao anyatarasym . tata pa . pa nih se na kit bhavati . tata ktv . ktv ca se na kit bhavati . p iti nivrttam . na se iti krte akittve nihym avadhrat | jpakt na parokym sani jhalgrahaam vidu || ittvam kitsanniyogena rea tulyam sudhvani | vasvartham kidatdet nigrhti ktv ca vigraht || (P_1,2.21) KA_I,201.2-4 Ro_II,31 iha kasmt na bhavati . gudhita gudhitavn iti . udupadht apa . abvikaraebhya iyate .

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (109 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(P_1,2.22) KA_I,201.6-19 Ro_II,31-32 pa ktvnihayo ii vprasaga seprakarat . pa ktvnihayo ii vibh prpnoti . kim kraam . seprakarat . se iti vartate . na v setvasya akidrayatvt anii v kittvam . na v ea doa . kim kraam . setvasya akidrayatvt . akidrayam setvam . yad akittvam tad i bhavitavyam . setvasya akidrayatvt anii eva vibh kittvam bhaviyati . ividhau pa grahaam kriyate . tena vacant i seprakarat ca ii eva vibh kittvam prpnoti . ividhau hi agrahaam . ividhau hi pa grahaam na kartavyam bhavati . bhradvjy pahanti : nityam akittvam idyo . ktvgrahaam uttarrtham . nityam akittvam idyo siddham . katham. vibhmadhye ayam yoga kriyate . vibhmadhye ca ye vidhaya te nity bhavanti . kimartham tarhi ktvgrahaam . ktvgrahaam uttarrtham . uttarrtham ktvgrahaam kriyate : nopadht thapntt v vacilucyrta ca iti . (P_1,2.25) KA_I,201.21 Ro_II,33 pjrtham . v iti eva hi vartate . kyapagrahaam kimartham. kyapagrahaam

(P_1,2.26) KA_I,202.2-7 Ro_II,33 kim idam rala ktvsano kittvam vidhyate hosvit pratiidhyate . kim ca ata . yadi vidhyate ktvgrahaam anarthakam . kit eva hi ktv . atha pratiidhyate sangrahaam anarthakam . akit eva hi san . ata uttaram pahati : rala ktvsano kittvam . rala ktvsano kittvam vidhyate . nanu ca uktam : ktvgrahaam anarthakam . kit eva hi ktv iti . na anarthakam . na ktv se iti pratiedha prpnoti . tadbdhanrtham . (P_1,2.27.1) KA_I,202.9-15 Ro_II,34 ayukta ayam nirdea . iti anena kla pratinirdiyate iti ayam ca vara . tatra ayuktam varasya klena saha smandhikarayam . katham tarhi nirdea kartavya . klaklasya iti . kim idam klaklasya iti . iti etasya kla kla . kla kla asya klakla iti . sa tarhi tath nirdea kartavya . na kartavya . uttarapadalopa atra draavya . tat yath uramukham mukham asya uramukha , kharamukha evam klakla kla iti . atha v shacaryt tcchabdyam bhaviyati . klasahacarita vara api kla eva . (P_1,2.27.2) KA_I,202.16-204.24 Ro_II,34-40 hrasvdiu samasakhyprasiddhi nirdeavaiamyt . hrasvdiu samasakhyatvasya aprasiddhi . kim kraam . nirdeavaiamyt . tisra saj ek saj . vaiamyt sakhytnudea na prpnoti . siddham tu samaskhyatvt . siddham etat . katham . samasakhyatvt . katham samasakhyatvam . traym hi vikranirdea . traym ayam pralianirdea . katham puna jyate traym ayam pralianirdea iti . tisrm sajnm karaasmarthyt . yadi api tvat tisrm sajnm karaasmarthyt jyate traym ayam pralianirdea iti kuta tu etat : etena nuprvyea sannivinm saj bhaviyanti iti . dau mtrika tata dvimtra tata trimtra iti . na puna mtrika madhye v ante v syt tath dvimtra dau v ante v syt tath trimtra dau v madhye v syt . ayam tvat trimtra aakya dau v madhye v kartum . kuta . plutraya hi prakrtibhva prasajyeta . mtrikadvimtrikayo api ghyantam prvam nipatati iti mtrikasya prvanipta bhaviyati . yat tvat ucyate ayam tvat trimtra aakya dau v madhye v kartum . plutraya hi prakrtibhva prasajyeta iti . plutraya prakrtibhva plutasaj ca anena eva . yadi ca
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (110 of 190) [3/8/2008 12:51:11 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

trimtra dau v madhye v syt plutasaj eva asya na syt kuta pratkrtibhva . yat api ucyate mtrikadvimtrikayo api ghyantam prvam nipatati iti mtrikasya prvanipta bhaviyati iti . hrasvray hi ghisaj hrasvasaj ca anena eva. yadi ca mtrika madhye v ante v syt hrasvasaj eva asya na syt kuta ghisaj kuta prvanipta . evam e vyavasth na prakalpate . evam tarhi cryapravrtti jpayati na mtrika ante bhavati iti yat ayam vibh praprativacane he iti mtrikasya plutam sti . katham krtv jpakam . ya ante sa plutasajaka . yadi ca mtrika ante syt plutasaj asya syt. tatra mtrklasya mtrklavacanam anarthakam syt . madhye tarhi syt iti . atra api cryapravrtti jpayati na mtrika madhye bhavati iti yat ayam ata drgha yai supi ca it drghatvam sti . katham krtv jpakam . ya madhye sa drghasajaka . yadi ca mtrika madhye syt drghasaj asya syt . tatra mtrklasya mtrklavacanam anarthakam syt . dvimtra tarhi ante syt . atra api cryapravrtti jpayati na dvimtra ante bhavati iti yat ayam om abhydne iti dvimtrikasya plutam sti . katham krtv jpakam . ya ante sa plutasajaka . yadi ca dvimtrika ante syt plutasaj asya syt . tatra dvimtraklasya dvimtraklavacanam anarthakam syt . mtrikea ca asya prvanipta bdhita iti krtv kva anyatra utsahate bhavitum anyat ata madhyt . evam e vyavasth praklpt . bhavet vyavasth praklpt . drghaplutayo tu prvasajprasaga . drghaplutayo api prvasaj prpnoti . k . hrasvasaj . kim kraam . a savarn grhti iti . siddham tu taparanirdet . siddham etat . katham . taparanirdea kartavya : udkla iti . yadi evam drutym taparakarae madhyamavilambitayo upasakhynam klabhedt . drutdiu ca uktam . kim utktam . siddham tu . avasthit var vaktu circiravacant vrttaya viiyante iti . sa tarhi taparanirdea kartavya . na kartavya . iha klagrahaam kriyate . yvat ca taparakaraam tvat klagrahaam . pratyekam ca klaabda parisampyate : ukla kla 3kla iti . atha v ekasajdhikre ayam yoga kartavya . tatra ek saj bhavati y par anavak ca iti evam hi drghaplutayo prvasaj na bhaviyati . atha v svam rpam abdasya aabdasaj iti ayam yoga pratykhyyate . tatra yat etat aabdasaj iti etat yay vibhakty nirdiyamnam arthavat bhavati tay nirdiam anuvartiyate : audit savarasya ca apratyaya aabdasajym iti . atha v hrasvasajvacanasmarthyt drghaplutayo prvasaj na bhaviyati . nanu ca idam prayojanam syt : sajay vidhne niyamam vakymi iti . hrasvasajay yat ucyate tat aca sthne yath syt iti . syt etat prayojanam yadi kicitkari hrasvasanni syu . yata tu khalu yvat ajgrahaam tvat hrasvagrahaam ata akicitkari hrasvasanni . idam tarhi prayojanam : eca ik hrasvdee iti vakymi iti . anucyamne hi etasmin hrasvapradeeu eca ik bhavati iti vaktavyam syt . hrasva napusake prtipadikasya eca ik bhavati iti . au cai upadhy hrasva eca ik bhavati iti . hrasva haldi ea eca ik bhavati iti . saj ca nma yata na laghya . kuta etat . laghvartham hi sajkaraam . laghya ca tri hrasvapradeeu eca ik bhavati iti na puna sajkaraam . tri hrasvapradeeu eca ik bhavati iti a grahani . sajkarae puna aau . hrasvasaj vaktavy . tri hrasvapradeeu hrasvagrahaam kartavyam hrasva hrasva hrasva iti . eca ik hrasvdee iti . sa ayam laghyas nysena siddhe sati yat garysam yatnam rabhate tasya etat prayojanam drghaplutayo tu prvasaj m bht iti . (P_1,2.28.1) KA_I,204.26-206.2 Ro_II,40-41 kim ayam alontyaea hosvit

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (111 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

alontypavda . katham ca ayam tacchea syt katham v tadapavda . yadi ekam vkyam tat ca idam ca : ala antyasya vidhaya bhavanti aca hrasvadrghaplut antyasya iti tata ayam tacchea . atha nn vkyam : ala antyasya vidhaya bhavanti , aca hrasvadrghaplut antyasya anantyasya ca iti tata ayam tadapavda . ka ca atra viea . hrasvdividhi ala antyasya iti cet vacipracchiamdiprabhrtihanigamidrgheu ajgrahaam . hrasvdividhi ala antyasya iti cet vacipracchiamdiprabhrtihanigamidrgheu ajgrahaam kartavyam . vacipracchyo drgha aca iti vaktavyam . anantyatvt na prpnoti . amdnm drgha aca iti vaktavyam . anantyatvt na prpnoti . hanigamyo drgha aca iti vaktavyam . anantyatvt na prpnoti . astu tarhi tadapavda . aca cet napusakahrasvkrtsrvadhtukanmidrgheu anantyapratiedha . aca cet napusakahrasvkrtsrvadhtukanmidrgheu anantyapratiedha vaktavya . hrasva napusake prtipadikasya : yath iha bhavati : rai : atiri nau : atinau evam suvk brhmaakulam iti atra api prpnoti . akrtsrvadhtukayo drgha : yath iha bhavati : cyate styate evam bhidyate atra api prpnoti . nmi drgha : yath iha bhavati : agnnm , vynm evam atra api prpnoti : am . na ea doa . nopadhyy iti etat niyamrtham bhaviyati . prakrtasya ea niyama syt. kim ca prakrtam . nmi iti . tena bhavet iha niyamt na syt : am . anyate tanyate atra api prpnoti . atha api evam niyama syt : nopadhy nmi eva iti evam api bhavet iha niyamt na syt : anyate tanyate . am iti atra prpnoti . atha api ubhayata niyama syt : nopadhy eva nmi nmi eva nopadadhyy iti evam api bhidyate suvk brhmaakulam ita atra api prpnoti . evam tarhi hrasva drgha pluta iti yatra bryt aca iti etat tatra upasthitam draavyam . kim krtam bhavati . dvity ah prdu bhvyate . tatra kmacra : grhyamena v acam vieayitum ac v grhyama . yvat kmacra iha tvat vacipracchiamdiprabhrtihanigamidrgheu grhyamena acam vieayiyma : em aca drgha bhavati iti . iha idnm napusakahrasvkrtsrvadhtukanmidrgheu ac grhyamam vieayiyma : napusakasya hrasva bhavati aca . ajantasya iti . akrtsrvadhtukayo drgha aca . ajantasya iti . nmi drgha bhavati aca . ajantasya iti . (P_1,2.28.2) KA_I,206.3-12 Ro_II,41-43 iha kasmt na bhavati : dyau , panth , sa iti . sajay vidhne niyama . sajay ye vidhyante teu niyama . kim vaktavyam etat . na hi . katham anucyamnam gasyate . ac iti vartate . tatra evam abhisambandha kariyate : aca ac bhavati hrasva drgha pluta iti evam bhvyamana iti . atha prvasmin yoge ajgrahae sati kim prayojanam . ajgrahaam sayogcsamudyanivrttyartham . ajgrahaam kriyate sayognivrttyartham acsamudyanivrttyartham ca . sayognivrttyartham tvat : pratakya prarakya . hrasvasya piti krti tuk iti tuk m bht iti . acsamudyanivrttyartham : titaucchatram , titaucchy . drght padntt v iti vibh m bht . (P_1,2.29-30.1) KA_I,206.14-25 Ro_II,43-45 kim ahnirdiam ajgrahaam anuvartate utho na . kim ca ata . yadi anuvartate halsvaraprptau vyajanam avidyamnavat iti paribh na prakalpate . katham hala nma svaraprpti syt . evam tarhi nivrttam . bahni etasy paribhy prayojanni . atha prathamnirdiam ajgrahaam anuvartate utho na . kim ca artha anuvrtty . bham artha yadi ete vyajanasya api gu lakyante . nanu ca pratyakam upalabhyante : ie tv rje tv . na ete vyajanasya gu . aca ete gu .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (112 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

tatsmpyt tu vyajanam api tadguam upalabhyate . tat yath . dvayo raktayo vastrayo madhye uklam vastram tadguam upalabhyate badarapiake riktaka lohakasa tadgua upalabhyate . kuta nu khalu etat aca ete gu . tatsmpyt tu vyajanam api tadguam upalabhyate iti . na puna vyajanasya ete gu syu . tatsmpyt tu ac api tadgua upalabhyate iti . antarea api vyajanam aca eva ete gu lakyante . na puna antarea acam vyajanasya uccraam api bhavati . anvartham khalu api nirvacanam : svayam rjante svar . anvak bhavati vyajanam iti . (P_1,2.29-30.2) KA_I,207.1-17 Ro_II,45-46 uccancasya anavasthitatvt sajprasiddhi . idam uccancam anavasthitapadarthakam . tat eva hi kam cit prati uccai bhavati kam cit prati ncai . evam kam cit ka cit adhynam ha : kim uccai roryase . atha ncai vartatm iti . tam eva tath adhynam apara ha : kim antardantakena adhe . uccai vartatm iti . evam uccancam anavasthitapadarthakam . tasya anavasthnt sajy aprasiddhi . evam tarhi lakaam kariyate : yma druyam aut khasya iti uccaikari abdasya . yma gtrm nigraha . druyam svarasya druat rkat . aut khasya kahasya savrtat . uccaikari abdasya . atha ncaikari abdasya . anvavasarga mrdavam urut khasya iti ncaikari abdasya . anvavasarga gtrm ithilat . mrdavam svarasya mrdut snigdhat . urut khasya mahatt kahasya . iti ncaikari abdasya . etat api anaikntikam . yat alpaprasya sarvoccai tat mahprasya sarvancai . siddham tu samnaprakramavacant . siddham etat . katham . samne prakrame iti vaktavyam . ka puna prakrama . ura kaha ira iti . (P_1,2.31) KA_I,207.16-208.9 Ro_II,46-48 samhra svarita iti ucyate . kasya samhra svaritasaja bhavati . aco iti ha . samhra aco cet na abhvt . samhra aco cet tat na . kim kraam . abhvt . na hi aco samhra asti . nanu ayam asti ggenpe iti . na ea aco samhra . anya ayam udttnudttayo sthne eka diyate . evam tarhi guayo . guayo cet na acprakarat . guayo samahra iti cet tat na . kim kraam . acprakarat . ac iti vartate . siddham tu acsamudyasya abhvt tadgue sampratyaya . siddham etat . katham . acsamudya na asti iti krtv tadguasya aca samhraguasya sampratyaya bhaviyati . katham puna samhra iti anena ac akya pratinirdeum . matublopa atra draavya . tat yath pupak em te pupak , klak em te klak iti evam samhravn samhra . atha v akra matvarthya . tat yath tunda , gha iti . yadi evam traisvaryam na prakalpate . tatra ka doa . traisvaryam adhmahe iti etat na upapadyate . na etat gupekam . kim tarhi . ajapekam . traisvaryam adhmahe : triprakrai ajbhi adhmahe kai cit udttaguai kai cit anudttaguai kai cit ubhayaguai . tat yath : uklagua ukla kragua kra . ya idnm ubhayagua sa trtym khym labhate kalma iti v sraga iti v . evam iha api udttagua udtta anudttagua anudtta . ya idnm ubhayavn sa trtym khym labhate svarita iti . (P_1,2.32.1) KA_I,208.11-209.4 Ro_II,48-50 ardhahrasvam iti ucyate . tatra drghaplutayo na prpnoti . kany aktike3 aktike . na ea doa . mtraca atra lopa draavya . ardhahrasvamtram ardhahrasvam iti . kimartham idam ucyate . mirbhtam iva idam bhavati . tat yath : krodake samprkte* mirbhtatvt na jyate : kiyat kram kiyat udakam kasmin avake kram kasmin avake udakam iti . evam iha api mirbhtatvt na
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (113 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

jyate : kiyat udttam kiyat anudttam kasmin avake udttam kasmin avake anudttam iti . tat crya suhrt bhtv anvcae : iyat udttam iyat anudttam asmin avake udttam asmin avake anudttam iti . yadi ayam evam suhrt kim anyni api evajtyakni na upadiati . kni puna tni . sthnakaranupradnni . vykaraam nma iyam uttar vidy . sa asau chandastreu abhivinta upalabdhy avagantum utsahate . yadi evam na artha anena . idam api upalabdhy gamiyati . sajkaraam tarhi idam : tasya svaritasya dita ardhahrasvam udttasajam iti . kim krtam bhavati . tri udttapradeeu svaritagrahaam na kartavyam bhavati : udttasvaritaparasya sannatara , udttasvaritayo yaa svarita anudttasya na udttasvaritodayam iti . sajkaraam hi nma yata na laghya . kuta etat . laghvartham hi sajkaraam . laghya ca tri udttapradeeu svaritagrahaam na puna sajkaraam . tri udttapradeeu svaritagrahae nava akari sajkarae puna ekdaa . evam tarhi ubhayam anena kriyate anvkhynam ca saj ca . katham puna ekena yatnena ubhayam labhyam . labhyam iti ha . katham . anvarthagrahaam vijsyate : tasya svaritasya dita ardhahrasvram udttasajam bhavati iti . rdhvam ttam iti ca ata udttam . yadi tarhi sajkaraam udttde yat ucyate tat svaritde api prpnoti . anvkhynam eva tarhi idam mandabuddhe . (P_1,2.32.2) KA_I,209.5-25 Ro_II,50-52 svaritasyrdhahrasvodttt udttasvaritaparasyasannatart rdhvam udttdanudttasyasvaritt kryam svaritt iti siddhyartham . svaritasyrdhahrasvodttt udttasvaritaparasyasannatara iti etasmt strt idam strakam rdhvam udttt anudttasya svarita iti ata kryam . kim prayojanam . svaritt iti siddhyartham . svaritt iti siddhi yath syt . svaritt sahitym anudttnm iti : imam me gage yamune sarasvati utudri . kva tarhi syt . ya siddha svarita : kryam devadattayajadattau . svaritodttrtham ca . svaritodttrtham ca tatra eva kartavyam . na subrahmayym svaritasya tu udtta : indra agaccha . kva tarhi syt . ya siddha svarita : subrahmayom indra agaccha . svaritodttt ca asvaritrtham . svaritodttt ca asvaritrtham tatra eva kartavyam . indra agaccha hariva agaccha . svaritaparasannatarrtham ca . svaritaparasannatarrtham ca tatra eva kartavyam . udttasvaritaparasya sannatara : maavaka jailakdhypaka nya . kva tarhi syt . ya siddha svarita : maavaka jailakbhirpaka kva . tat tarhi vaktavyam . na vaktavyam . devabrahmao anudttavacanam jpakam svaritt iti siddhatvasya . devabrahmao anudttavacanam jpakam siddha iha svarita iti . yadi etat jpyate svaritodttaparasya anudttasya svaritatvam prpnoti . na brma devabrahmao anudttavacanam jpakam siddha iha svarita iti . kim tarhi . param etat kam iti . (P_1,2.33.1) KA_I,210.2-4 Ro_II,53 kim idam pribhiky sambuddhe grahaam : ekavacanam sambuddhi hosvit anvarthagrahaam : sambodhanam sambuddhi iti . kim ca ata . yadi pribhiky dev brahma iti atra na prpnoti . atha anvarthagrahaam na doa . yath na doa tath astu . (P_1,2.33.2) KA_I,210.5-17 Ro_II,53-54 kim puna iyam ekaruti udtt hosvit anudtt . na udtt . katham jyate . yat ayam uccaistarm v vaakra iti ha . katham krtv jpakam . atantram taranirdea . yvat uccai tvat uccaistarm iti . yadi tarhi na udtt anudtt . anudtt ca na . katham jyate . yat ayam udttasvaritaparasya sannatara iti
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (114 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

ha . katham krtv jpakam . atantram taranirdea . yvat sanna tvat sannatara iti . s e jpakbhym udttnudttayo madhyam ekaruti antarlam hriyate . apara ha : kim puna iyam ekaruti udtt uta anudtt . udtt . katham jyate . yat ayam uccaistarm v vaakra iti ha . katham krtv jpakam . tantram taranirdea . uccai drv uccaistarm iti etat bhavati . yadi tarhi udtt na anudtt . anudtt ca . katham jyate . yat ayam udttasvaritaparasya sannatara iti ha . katham krtv jpakam . tantram taranirdea . sannam drv sannatara iti etat bhavati . te ete tantre taranirdee sapta svar bhavanti : udtta , udttatara , anudtta , anudttara , svarita , svarite ya udtta sa anyena viita , ekaruti saptama . (P_1,2.37) KA_I,210.19-211.14 Ro_II,55-56 subrahmayyam okra udtta . subrahmayyam okra udtta bhavati : subrahmayom . kra khyte pardi ca . kra khyte pardi ca udtta bhavati : indra agaccha . hariva agaccha . vkydau ca dve dve . vkydau ca dve dve udtte bhavata : indra agaccha . hariva agaccha . maghavanvarjam . agaccha maghavan . sutyparm anta . sutyparm anta udtta bhavati : dvyahe sutyam . tryahe sutyam . asau iti anta . asau iti anta udtta bhavati : grgya yajate . vtsya yajate . amuya iti anta . amuya iti anta : dke pita yajate . syntasya upottamam ca . syntasya upottamam udttam bhavati anta ca . grgyasya pita yajate . vtsyasya pita yajate . v nmadheyasya . v nmadheyasya syntasya upottamam udttam bhavati : devadattasya pita yajate . devadattasya pita yajate . (P_1,2.38) KA_I,211.16-17 Ro_II,56-57 devabrahmao anudttatvam eke . devabrahmao anudttatvam eke icchanti : dev brahma . dev brahma . (P_1,2.39) KA_I,211.19-212.17 Ro_II,57-59 svaritt sahitym anudttnm iti cet dvyekayo aikarutyavacanam . svaritt sahitym anudttnm iti cet dvyekayo aikarutyam vaktavyam : agniveya pacati . kim puna kraam na sidhyati . bahuvacanena nirdea kriyate . tena bahnm aikarutyam syt dvyekayo na syt . na ea doa . na atra nirdea tantram . katham puna tena eva nirdea kriyate tat ca atantram syt . tatkr ca bhavn taddve ca . nntaryakatvt atra bahuvacanena nirdea kriyate : avayam kay cit vibhakty kena cit vacanena nirdea kartavya iti . tat yath : ka cit annrth likalpam sapallam satuam harati nntayyakatvt . sa yvat deyam tvat dya tuapallni utsrjati . tath ka cit msrth matsyn sakaakn saakaln harati nntayyakatvt . sa yvat deyam tvat dya akalakaakn utsrjati . evam iha api nntaryakatvt bahuvacanena nirdea kriyate . avieea aikarutyam . avieea aikarutyam iti cet vyavahitnm aprasiddhi . avieea aikarutyam iti cet vyavahitnm aikarutyam na prpnoti : imam me gage yamune sarasvati utudri . anekam api iti tu vacant siddham . anekam api ekam api svaritt param sahitym ekaruti bhavati iti vaktavyam . sidhyati . stram tarhi bhidyate . yathnysam eva astu . nanu ca uktam : svaritt sahitym anudttnm iti cet dvyekayo aikarutyavacanam . avieea aikarutyam vyavahitnm aprasiddhi iti . na ea doa . katham . ekaeanirdea ayam anudttasya ca : anudttayo ca anudttnm ca anudttnm iti . evam api aprabhrtnm eva prpnoti . aprabhrtiu ekaea parisampyate . pratyekam vkyaparisampti dr iti dvyekayo api bhaviyati .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (115 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(P_1,2.41) KA_I,212.19-213.24 Ro_II,59-62 aprktasajym halgrahaam svdilope hala agrahartham . aprktasajym halgrahaam kartavyam . ekahal pratyaya aprktasaja bhavati iti vaktavyam . kim prayojanam . svdilope hala agrahartham . svdilope hala grahaam na kartavyam bhavati : halybbhya drght sutisi aprktam hal iti aprktasya iti eva siddham . aio lugartham algrahaam . aio lugartham algrahaam kartavyam . kim prayojanam . aio luki grahaam na kartavyam bhavati : yakatriyraita yni luk aio iti aprktasya iti eva siddham . aio lugartham iti cet e atiprasaga . aio lugartham iti cet e atiprasaga bhavati . iha api prpnoti : phhrte apatyam mavaka phrta iti . avacanasmrthyt na bhaviyati . vacanaprmyt iti cet phagnivrttyartham vacanam . vacanaprmyt iti cet phagnivrttyartham etat syt : phak ata m bht iti . paildiu vacant siddham . yadi etvat prayojanam syt paildiu eva pham kurvta . tatra pht anyem api phaka nivrtti bhavati . evam siddhe sati yat ayam am sti tat jpayati crya na asya luk bhavati iti . tni etni tri grahani bhavanti . aprktasajym halgrahaam kartavyam . svdilope hala grahaam na kartavyam . aio luki grahaam kartavyam . algrahae api vai kriyame tni eva tri grahani bhavanti . aprktasajym algrahaam kartavyam . svdilope hala grahaam kartavyam . aio luki grahaam na kartavyam bhavati . aprktagrahaam kartavyam . tatra na asti lghavakrta viea . ayam asti viea : algrahae kriyame ekagrahaam na kariyate . kasmt na bhavati darvi , jgrvi . al eva ya pratyaya . kim vaktavyam etat . na hi . katham anucyamnam gasyate . algrahaasmarthyt . yadi ya al ca anya ca tatra syt algrahaam anarthakam syt . halgrahae api kriyame ekagrahaam na kariyate . kasmt na bhavati darvi jgrvi . hal eva ya pratyaya . kim vaktavyam etat . na hi . katham anucyamnam gasyate . halgrahaasmarthyt . yadi ya hal ca anya ca tatra syt halgrahaam anarthakam syt . asti anyat halgrahaasya prayojanam . kim . halantasya yath syt alantasya m bht iti . evam tarhi siddhe sati yat algrahae kriyame ekagrahaam karoti tat jpayati crya anyatra varagrahae jtigrahaam bhavati iti . kim etasya jpane prayojanam . dambhe halgrahaasya jtivcakatvt siddham iti uktam . tat upapannam bhavati . (P_1,2.42) KA_I,214.2-11 Ro_II,62-63 tatpurua samndhikaraa karmadhraya iti cet samsaikrthatvt aprasiddhi . tatpurua samndhikaraa karmadhraya iti cet samsasya ekrthatvt sajy aprasiddhi . eka ayam artha tatpurua nma anekrthrayam ca smndhikarayam . siddham tu padasmndhikarayt . siddham etat . katham . tatpurua samndhikaraapada karmadhrayasaja bhavati iti vaktavyam . sidhyati . stram tarhi bhidyate . yathnysam eva astu . nanu ca uktam tatpurua samndhikaraa karmadhraya iti cet samsaikrthatvt aprasiddhi iti . na ea doa . ayam tatpurua asti prthamakalpika yasmin aikapadyam aikasvaryam ekavibhaktikatvam ca . asti tdarthyt tcchabdyam ; tatpururthni padni tatpurua iti . tat ya tdarthyt tcchabdyam tasya iha grahaam . (P_1,2.43.1) KA_I,214.13-22 Ro_II,63-64 prathamnirdiam samse upasajanam iti cet anirdet prathamy samse sajprasiddhi .prathamnirdiam samse upasajanam iti cet anirdet prathamy samse sajy aprasiddhi . na hi kadnm samse
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (116 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prathamm payma . siddham tu samsavidhne vacant . siddham etat . katham . samsavidhne prathamnirdiam upasarjanasajam bhavati iti vaktavyam . tat tarhi vaktavyam . na v tdarthyt tcchabdyam . na v vaktavyam . kim kraam . tdarthyt tcchabdyam bhavati. samsrtham stram samsa iti . (P_1,2.43.2) KA_I,215.1-21 Ro_II,64-67 yasya vidhau prathamnirdea tata anyatra api upasarjanasajprasaga . yasya vidhau prathamnirdea kriyate tata anyatra api tasya upasarjanasaj prpnoti : raja kumrm rjakumrm rita . ritdisamse dvityntam prathamnirdiam . tasya ahsamse api upasarjanasaj prpnoti . siddham tu yasya vidhau tam prati iti vacant . siddham etat . katham . yasya vidhau yat prathamnirdiam tam prati tat upasarjanasajam bhavati iti vaktavyam . tat tarhi vaktavyam . na vaktavyam . upasarjanam iti mahat saj kriyate . saj ca nma yata na laghya . kuta etat . laghvartham hi sajkaraam . tatra mahaty sajy karae etat prayojanam anvarthasaj yath vijyeta . apradhnam upasarjanam iti . pradhnam upasarjanam iti ca sambandhiabdau etau . tatra sambandht etat gantavyam : yam prati yat apradhnam tam prati tat upasarjanasjam bhavati iti . atha yatra dve ahyante kasmt tatra pradhnasya upasarjanasaj na bhavati : rja puruasya rjapuruasya iti . ahyantayo upasarjanatve uktam . kim uktam . ahyantayo samse arthbhedt pradhnasya aprvanipta iti . evam na ca idam akrtam bhavet upsarjanam prvam iti artha ca abhinna iti krtv pradhnasya prvanipta na bhaviyati . yadi api tvat etat upasarjanakryam parihrtam idam aparam prpnoti . rja kumry rjakumry . gostriyo upasarjanasya iti hrasvatvam prpnoti . uktam v . kim uktam . paravat ligam iti abdaabdrthau iti . tatra aupadeikasya hrasvatvam . tideikasya ravaam bhaviyati . (P_1,2.44.1) KA_I,215 23-216.5 Ro_II,67-68 dvitydnm api anena upasarjanasaj prpnoti . tatra ka doa . tatra aprvanipte iti pratiedha prasajyeta . na apratiedht . na ayam prasajyapratiedha : prvanipte na iti . kim tarhi . paryudsa ayam : yat anyat prvaniptt iti . prvanipte avypra . yadi kena cit prpnoti tena bhaviyati . prvea ca prpnoti . tena bhaviyati . aprpte v . atha v anantar y prpti s pratiidhyate . kuta etat . anantarasya vidhi v bhavati pratiedha v iti . (P_1,2.44.2) KA_I,216.6-11 Ro_II,68 ekavibhaktau aahyantavacanam . ekavibhaktau aahyantnm iti vaktavyam . iha m bht : ardham pippaly ardhapippal iti . uktam v . kim uktam . paravat ligam iti abdaardrthau iti . tatra aupadeikasya hrasvatvam . tideikasya ravaam bhaviyati . (P_1,2.44.3) KA_I,216.12-16 Ro_II,68 kni puna asya yogasya prayojanni . prayojanam dviguprptpannlamprvopasarg ktrthe . dvigu : pacabhi gobhi krta pacagu . prptpanna : prpta jivikm prptajvika . panna jvikm pannajvika . alamprva : alam kumryai alakumri . upasarg ktrthe : nikaumbi nirvrasi . (P_1,2.45.1) KA_I,217.2-10 Ro_II,69-71 arthavat iti vyapadeya : varnm ca m bht iti . kim ca syt . vanam , dhanam iti nalopa prtipadikntasya iti nalopa prasajyeta . adhtu iti kimartham . ahan vrtram iti . adhtu iti akyam akartum . kasmt na bhavati ahan vrtram iti .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (117 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

cryapravrtti jpayati na dhto prtipadikasaj bhavati iti yat ayam supa dhtuprtipadikayo iti dhtugrahaam karoti . na etat asti jpakam . pratiiddhrtham etat syt : api kka yenyate iti . apratyaya iti kimartham . ke kuye . apratyaya iti akyam akartum . kasmt na bhavati ke kuye* iti . krttaddhitagrahaam niyamrtham bhaviyati : krttaddhitntasya eva pratyayntasya prtipadikasaj bhavati na anyasya iti . (P_1,2.45.2) KA_I,217.11-219.9 Ro_II,71-77 arthavati anekapadaprasaga . arthavati prtipadikasajym anekasya api padasya prtipadikasaj prpnoti : daa dimni a app kuam ajjinam palalapia adhorukam etat kumry sphaiyakrtasya pit pratina iti . samudya anarthaka . samudya anarthaka iti cet avayavrthavattvt samudyrthavattvam yath loke . samudya anarthaka iti cet avayavai arthavadbhi samudy api arthavanta bhavanti yath loke . tat yath loke hyam idam nagaram , gomat idam nagaram iti ucyate na ca tatra sarve hy bhavanti sarve v gomanta . yath loke iti ucyate loke ca avayav eva arthavanta na samudya . ta ca avayav eva arthavanta na samudya . yasya hi tat dravyam bhavati sa tena kryam karoti yasya ca gva santi sa tsm kram ghrtam ca upabhukte . anyai etat draum api aakyam . k tarhi iyam vcoyukti : hyam idam nagaram , gomat idam iti . e e vcoyukti : iha tvat hyam idam nagaram iti akra matvarthya : hy asmin santi iti tat idam hyam iti . gomat idam iti matvantt matvarthya lupyate . evam api vkyapratiedha arthavattvt . vkyasya prtipadikasjy pratiedha vaktavya : devadatta gm abhyja uklm . devadatta gm abhyja krm iti . kim kraam . arthavattvt . arthavat hi etat vkyam bhavati . na vai padrtht anyasya arthasya upalabdhi bhavati vkye . padrtht anyasya anupalabdhi iti cet padrthbhisambandhasya upalabdhi . padrtht anyasya anupalabdhi iti cet evam ucyate : padrthbhisambandhasya upalabdhi bhavati vkye . iha devadatta iti ukte kart nirdia karma kriyguau ca anirdiau . gm iti ukte karma nirdiam kart kriyguau ca anirdiau . abhyja iti ukte kriy nirdi kartrkarma gua ca anirdia . uklm iti ukte gua nirdia kartrkarma kriy ca anirdi . iha idnm devadatta gm abhyja uklm iti ukte sarvam nirdiam bhavati : devadatta eva kart na anya . gau eva karma na anyat . abhyji eva kriy na any . uklm eva na krm iti . etem padnm smnye vartamnnm yadviee avasthnam sa vkyrtha . tasmt pratiedha . tasmt pratiedha vaktavya . na vaktavya . arthavatsamudynm samsagrahaam niyamrtham . arthavatsamudynm samsagrahaam niyamrtham bhaviyati : samsa eva arthavatm samudyynm prtipadikasaja bhavati na anya iti . yadi niyama kriyate prakrtipratyayasamudyasya prtipadikasaj na prpnoti : bahupaava , uccakai iti . kim puna atra prtipadikasajay prrthyate . prtipadikt iti svdyutpatti yath syt . na ea doa . yath eva atra aprtipadikatvt svdyutpatti na bhavati evam luk api na bhaviyati . tatra y eva antarvartin vibhakti tasy eva ravaam bhaviyati . na evam akyam . svare hi doa syt . bahupaava iti evam svara prasajyeta bahupaava iti ca iyate . pahiyati hi crya : cita saprakrte bahvakajartham iti . tasym puna luptyam y any vibhakti utpadyate tasy prakrtyanekadeatvt antodttatvam na bhaviyati . evam tarhi cryapravrtti jpayati bhavati prakrtipratyayasamudyasya prtipadikasaj iti yat ayam aprayaya iti pratiedham sti . sa ca tadantapratiedha . sa tarhi jpakrtha pratyayapratiedha vaktavya . nanu ca ayam prptyartha api vaktavya . na artha
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (118 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prptyarthena . krttaddhitagrahaam niyamrtham bhaviyati : krttaddhitntasya eva pratyayntasya prtipadikasaj bhaviyati na anyasya pratyayntasya iti . sa ea ananyrtha pratyayapratiedha vaktavya prakrtipratyayasamudyasya v prtipadikasaj vaktavy . ubhayam na vaktavyam . tulyajtyasya niyama . ka ca tulyajtya . yathjtyaknm samsa . kathajtyaknm samsa . subantnm . suptisamudyasya tarhi prtipadikasaj prpnoti . suptisamudyasya prtipadikasaj rabhyate : jahi karma bahulam bhkye kartram ca abhidadhti iti . tat niyamrtham bhaviyati : etasya eva suptisamudyasya prtipadikasaj bhavati na anyasya iti . tisamudyasya tarhi prtipadikasaj prpnoti . tisamudyasya api prtipadikasaj rabhyate : khytam khytena kriystatye iti . tat niyamrtham bhaviyati : etasya eva tisamudyasya prtipadikasaj bhavati na anyasya iti . (P_1,2.45.3) KA_I,219.10-220.8 Ro_II,77-79 arthavatt na upapadyate kevalena avacant . arthavatt na upapadyate vrkaabdasya . kim kraam . kevalena avacant . na kevalena vrkaabdena artha gamyate . kena tarhi . sapratyayakena . na v pratyayena nityasambandht kevalasya aprayoga . na v ea doa . kim kraam . pratyayena nityasambandht . nityasambandhau etau arthau prakrti pratyaya iti . pratyayena nityasambandht kevalasya aprayoga na bhaviyati . anyat bhavn pra anyat cae . mrn pra kovidrn cae . arthavatt na upapadyate kevalena avacant iti bhavn asmbhi codita kevalasya aprayoge hetum ha . evam ca kila nma krtv codyate : samudyasya arthe prayogt avayavnm aprasiddhi iti . siddham tu anvayavyatirekbhym . siddham etat . katham . anvayt vyatirekt ca . ka asau anvaya vyatireka v . iha vrka iti ukte ka cit abda ryate : vrkaabda akrnta sakrnta ca pratyaya . artha api ka cit gamyate : mlaskandhaphalapalavn ekatvam ca . vrkau iti ukte ka cit abda hyate ka cit upajyate ka cit anvay : sakra hyate , aukra upajyate vrkaabda akrnta anvay . artha api ka cit hyate ka cit upajyate ka cit anvay : ekatvam hyate dvitvam upajyate mlaskandhaphalapalavn anvay . te manymahe : ya abda hyate tasya asau artha ya artha hyate . ya abda upajyate tasya asau artha ya artha upajyate . ya abda anvay tasya asau artha ya artha anvay. viama upanysa . bahava hi abd ekrth bhavanti . tat yath : indra akra puruhta purandara , kandu koha kula iti . eka ca abda bahvartha . tat yath : ak pd m iti . ata kim na sdhya arthavatt siddh bhavati . na brma arthavatt na sidhyati iti .varit arthavatt anvayavyatirekbhym eva . tatra kuta etat : ayam prakrtyartha ayam pratyayrtha iti na puna prakrti eva ubhau arthau bryt pratyaya eva v . smnyaabd ete evam syu . smnyaabd ca na antarea vieam prakaraam v vieeu avatihante . yata tu niyogata vrka iti ukte svabhvata kasmin cid arthe pratti upajyate ata manymahe na ime smnyaabd iti . na cet smnyaabd prakrti prakrtyarthe vartate pratyaya pratyayrthe . (P_1,2.45.4) KA_I,220.9-24 Ro_II,79-80 kim puna ime var arthavanta hosvit anarthak . varasya arthavadanarthakatve uktam . kim uktam . arthavanta var dhtuprtipadikapratyayaniptnm ekavarnm arthadarant . varavyatyaye ca arthntaragamant . varnupalabdhau ca anarthagate . saghtrthavattvt ca .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (119 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

saghtasya aikrthyt subabhva vart . anarthak tu prativaram arthnupalabdhe . varavyatyaypyopajanavikreu arthadarant iti . tatra idam aparihrtam : saghtrthavattvt ca iti . tasya parihra . saghtrthavattvt ca iti cet dra hiatadarthena guena guina arthabhva . saghtrthavattvt ca iti cet dryate hi puna atadarthena guena guina arthabhva . tat yath . eka tantu tvaktre asamartha tatsamudya ca kambala samartha . eka taula kutpratighte asamartha tatsamudya ca vardhatikam samartha . eka ca balvaja bandhane asamartha tatsamudya ca rajju samarth bhavati . viama upanysa . bhavati hi tatra y ca yvat ca arthamtr . bhavati hi kim cit prati eka tantu tvaktre samartha eka ca taula kutpratighte samartha eka ca balvaja bandhane samartha . ime puna var atyantya eva anarthak . yath tarhi rathgni vihrtni pratyekam vrajikriym prati asamarthni bhavanti tatsamudya ca ratha samartha evam em varnm samudy arthavanta avayav anarthak iti . (P_1,2.45.5) KA_I,220.25-221.10 Ro_II,81-82 niptasya anarthakasya prtipadikatvam . niptasya anarthakasya prtipadikasaj vaktavy . khajati nikhajati lambate pralambate . kim puna atra prtipadikasajay prrthyate . prtipadikt iti svdyutpatti , subantam padam iti padasaj , padasya padt iti nighta yath syt . na etat asti prayojanam . satym api prtipadikasajym svdyutpatti na prpnoti . kim kraam . na hi prtipadikasajym eva svdyutpatti pratibaddh . kim tarhi . ekatvdiu artheu svdaya vidhyante na ca em ekatvdaya santi . na ea doa . avieea utpadyante . utpannnm niyama kriyate . atha v prakrtrthn apekya niyama . ke ca prakrt . ekatvdaya . ekasmin eva arthe ekavacanam na dvayo na bahuu . dvayo eva dvivacanam na ekasmin na bahuu . bahuu eva artheu bahuvacanam na ekasmin na dvayo iti . atha v cryapravrtti jpayati anarthaknm api etem bhavati arthavatkrtam iti yat ayam adhipar* anarthakau iti anarthakayo gatyupasargasajbdhikm karmapravacanyasajm sti . (P_1,2.45.6) KA_I,221.11-222.7 Ro_II,82-85 kim puna ayam paryudsa : yat anyat pratyayt hosvit prasajya ayam pratiedha : pratyaya na iti . ka ca atra viea . apratyaya iti cet tibekdee pratiedha antavattvt . apratyaya iti cet tibekdee pratiedha vaktavya : ke kuye . kim kraam . antavattvt . tibatipo ekdea atipa antavat syt . asti anyat tipa iti krtv prtipadikasaj prpnoti . astu tarhi prasajyapratiedha : pratyaya na iti . na pratyaya iti cet ekdee pratiedha divattvt . na pratyaya iti cet ekdee pratiedha prpnoti : brahmabandh . kim kraam . divattvt . pratyaypratyayayo pratyayasya divat syt . tatra pratyaya na iti pratiedha prpnoti . na ea doa . cryapravrtti jpayati utpadyante antt svdaya iti yat ayam na dhtvo iti vibhaktisvarasya pratiedham ti . atha v dve hi atra prtipadikasaje : avayavasya api samudyasya api . tatra avayavasya y prtipadikasaj tay antavadbhvt svdyutpatti bhaviyati . sublope ca pratyayalakaatvt . sublope ca pratyayalakaena pratiedha prpnoti : rj tak . pratyayalakaena pratyaya na iti pratiedha prpnoti . na ea doa . cryapravrtti jpayati na pratyayalakaena pratiedha bhavati iti yat ayam na isambuddhyo iti pratiedham sti . atha v puna astu paryudsa . nanu ca uktam : apratyaya iti cet tibekdee pratiedha antavattvt iti . prasajyapratiedhe api ea doa .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (120 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

dve hi atra prtipadikasaje : avayavasya api samudyasya api . grhyate ca prtipadikprtipadikayo ekdea prtipadikagrahaena . tasmt ubhbhym api vaktavyam syt : hrasva napusake yat tasya iti . kim ca napusake . napusakam yasya gua . kasya ca napusakam gua . prtipadikasya . (P_1,2.46) KA_I,222.9-11 Ro_II,85 samsagrahaam kimartham . samsagrahae uktam . kim uktam . arthavatsamudynm samsagrahaam niyamrtham iti . (P_1,2.47.1) KA_I,222.13-223.11 Ro_II,85-88 prtipadikagrahaam kimartham . napusakahrasvatve prtipadikagrahaam tibnivrttyartham . napusakahrasvatve prtipadikagrahaam kriyate tibnivrttyartham . tibantasya hrasvatvam m bht : ke kuye . ramate brhmaakulam . avyayapratiedha . avyaynm pratiedha vaktavya : do brhmaakulam div brhmaakulam iti . sa tarhi vaktavya . na vaktavya . na atra avyayam napusake vartate . kim tarhi . adhikaraam atra avyayam napusakasya . iha tarhi prpnoti : kbhtam vralakulam , kuybhtam vralakulam iti . na v ligbhvt . na v vaktavyam . kim kraam . ligbhvt . aligam avyayam . kim puna ayam avyayasya eva parihra hosvit tibantasya api . tibantasya api iti ha . katham . avyayam hi kim cit vibhaktyarthapradhnam kim cit kriypradhnam . uccai, ncai iti vibhaktyarthapradhnam , hiruk prthak iti kriypradhnam . tibantam ca api kim cit vibhaktyarthapradhnam kim cit kriypradhnam . ke kuye* iti vibhaktarthyapradhnam , ramate brhmaakulam iti kriypradhnam . na ca etayo arthayo ligasakhybhym yoga asti . avayam ca etat evam vijeyam . kriyame api hi prtipadikagrahae iha prasajyeta : ke kuye . dve hi atra prtipadikasaje avayavasya api samudyasya api . grhyate ca prtipadikprtipadikayo ekdea prtipadikagrahaena . tasmt ubhbhym api vaktavyam syt : hrasva napusake yat tasya iti . kim ca napusake . napusakam yasya gua . kasya ca napusakam gua . prtipadikasya . (P_1,2.47.2) KA_I,223.12-16 Ro_II,88 yaekdeadrghaittveu pratiedha . yaekdeadrghaittveu pratiedha vaktavya : yugavaratrya yugavaratrrtham , yugavaratrebhya . yaekdeadrghaittveu bahiragalakaatvt siddham . bahirag ete vidhaya . antaragam hrasvatvam . asiddham bahiragam antarage . (P_1,2.48.1) KA_I,223.18-21 Ro_II,88-89 upasarjanahrasvatve ca . upasarjanahrasvatve ca . kim . yaekdeadrghaittveu pratiedha vaktavya : atikhavya atikhavrtham atikhavebhya . upasarjanahrasvatve ca . kim . bahiragalakaatvt siddham iti eva . bahirag ete vidhaya . antaragam hrasvatvam . asiddham bahiragam antarage . (P_1,2.48.2) KA_I,223.22-225.14 Ro_II,89-94 gograhaam krnnivrttyartham . gograhaam kartavyam . kim idam iti . pratyhragrahaam . kva sannivinm pratyhra . pa prabhrti yaa akrt . kim prayojanam . krnnivrttyartham . krtstriy dhtustriy ca hrasvatvam m bht iti : atitantr , atir , atilakm iti . tat tarhi vaktavyam . na vaktavyam . strgrahaam svaryate . tatra svaritena adhikragati bhavati . striym iti evam prakrtya ye vihit tem grahaam vijsyate . svaritena adhikragati bhavati iti na doa bhavati . yadi evam pratyayagrahaam idam bhavati . tatra pratyayagrahae yasmt sa
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (121 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

tadde grahaam bhavati iti iha na prpnoti : atirjakumri , atisennkumri iti . astrpratyayena iti evam tat . yasa bahuvrhau puvadvacanam . yasa bahuvrhau puvadbhva vaktavya . bahvya reyasya asya bahureyas vidyamnareyas . prvapadasya ca pratiedha gosamsanivrttyartham . prvapadasya ca pratiedha vaktavya . kim prayojanam . gosamsanivrttyartham . gonivrttyartham samsanivrttyartham ca . gonivrttyartham tvat : gokulam , gokram , goplaka iti . samsanivrttyartham : rjakumrputra , sennkumrputra iti . kim ucyate samsanivrttyartham iti na puna asamsa api kim cit prvapadam yadartha pratiedha syt . stryantasya prtipadikasya upasarjanasya hrasva bhavati iti ucyate na ca antarea samsam stryantam prtipadikam upasarjanam asti . nanu ca idam asti : khavpda , mlpda iti . ekdee krte antdivadbhvt prpnoti . ubhayata raye na antdivat . gonivrttyarthena tvat na artha . gontasya prtipadikasya upasarjanasya hrasva bhavati iti ucyate na ca etat gontam . nanu ca etat api vyapadeivadbhvena gontam . vyapadeivadbhva aprtipadikena . samsanivrttyarthena ca api na artha . stryantasya prtipadikasya upasarjanasya hrasva bhavati iti ucyate . pradhnam upasarjanam iti ca sambandhiabdau etau . tatra sambandht etat gantavyam : yam prati yat apradhnam tasya cet sa anta bhavati iti . avayam ca etat evam vijeyam . ucyamne api hi pratiedhe iha prasajyeta : paca kumrya priy asya pacakumrpriya , daakumrpriya iti . kapi ca . kapi ca pratiedha vaktavya : bahukumrka , bahuvralka . dvandve ca . dvandve ca pratiedha vaktavya : kukkuamayryau . uktam v . kim uktam . kapi tvat uktam : na kapi iti pratiedha iti . na etat asti uktam . ke aa iti y hrasvaprpti tasy pratiedha . kuta etat . anantarasya vidhi v bhavati pratiedha v iti . avayam ca etat evam vijeyam . ya hi manyate y ca yvatca hrasvaprpti tasy sarvasy pratiedha iti iha api tasya pratiedha prasajyeta : priyam grmai brhmaakulam asya priyagrmaika . idam tarhi uktam : kapi krte anantyatvt hrasvatvam na bhaviyati . idam iha sampradhryam : kap kriyatm hrasvatvam iti . kim atra kartavyam . paratvt kap . antaragam hrasvatvam . antaragatara kap . nanu ca ayam kap samsnta ici ucyate . tdarthyt tcchabdyam bhaviyati . yem padnm samsa na tvat tem anyat bhavati . kapam tvat pratkate . dvandve api uktam . kim uktam . paravat ligam iti abdaabdrthau iti . tatra aupadeikasya hrasvatvam tideikasya ravaam bhaviyati . (P_1,2.49) KA_I,225.16-23 Ro_II,95 taddhitaluki avantydnm pratiedha . taddhitaluki avantydnm pratiedha vaktavya : avant kunt kur . taddhitaluki avantydnm apratiedha alukparatvt . taddhitaluki avantydnm apratiedha . anarthaka pratiedha apratiedha . luk kasmt na bhavati . alukparatvt . luki iti ucyate . na ca atra lukam payma . luki iti na e parasaptam aky vijtum . na hi luk paurvparyam asti . k tarhi . satsaptam : luki sati iti . satsaptam cet prpnoti . evam tarhi idam iha vyapadeyam sat crya na vyapadiati . kim . upasarjanasya iti vartate . na ca jti upasarjanam . (P_1,2.50) KA_I,226.2-18 Ro_II,96-98 it goy na iti vaktavyam . goy na iti eva vaktavyam . na artha ittvena . k rpasiddhi : pacagoi , daagoi . hrasvat hi vidhyate . hrasvatvam atra vidhyate : gostriyo upasarjanasya iti . iti v vacane tvat . it iti v ucyeta na iti v ka nu atra viea . mtrrtham v krtam bhavet . atha v mtrrtham idam
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (122 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

vaktavyam : gomtram idam goi . apara ha : goy ittvam prakarat . aiyam goy ittvam . kim kraam . prakarat . prakrtam hrasvatvam . hrasva iti vartate . nanu scy . scydyartham atha api v . scydyartham idam draavyam : pacasci , daasc . it goy na iti vaktavyam hrasvat hi vidhyate | iti v vacane tvat . mtrrtham v krtam bhavet || goy ittvam prakarat . scydyartham atha api v . (P_1,2.51.1) KA_I,226.20-227.10 Ro_II,98-100 vyaktivacane iti kimartham . irm adrabhava grma ir . tasya grmasya vanam iravanam . kim ca syt . vibh oadhivanaspatibhya iti atvam prasajyeta . apara ha : kaubadary adrabhava grma kaubadar . ah yuktavadbhvena m bht iti . atha vyaktivacane iti api ucyamne kasmt eva atra na bhavati . ah api hi vacanam . na idam pribhikasya vacanasya grahaam . kim tarhi . anvarthagrahaam : ucyate vacanam iti . evam api ah prpnoti . ah api hi ucyate . lup uktatvt tasya arthasya dvityasya prayogea na bhavitavyam uktrthnm aprayoga iti . tideik tarhi prpnoti . evam tarhi prk api vrtte yuktam vrttam ca api . iha yvat yuktam vaktu ca kmacra prk vrtte ligasakhye ye . prk api vrtte yuktam vanaspatibhi nagaram vrttam ca api yuktam vanaspatibhi nagaram . vrtte ca yuktavadbhva vidhyate . kmacra ca prayoktu prk vrtte ye ligasakhye te* atideum vrttasya v ye ligasakhye . yvat krmacra vrttasya ye ligasakhye te* atidiyete na prk vrtte ye . (P_1,2.51.2) KA_I,227.11-26 Ro_II,100-102 kimartham puna idam ucyate . anyatra abhidheyavyaktivacanabhvt lupi yuktavadanudea . anyatra abhidheyavat ligavacanni bhavanti . kva anyatra . luki : lavaa supa , lava yavgu , lavaam kam iti . anyatra abhidheyavat ligavacanni bhavanti luki. iha api anyatra abhidheyavat ligavacanni prpnuvanti . iyante ca abhidhnavat syu iti . tat ca antarea yatnam na sidhyati iti lupi yuktavadanudea . evamartham idam ucyate . asti prayojanam etat . kim tarhi iti . lupa adaranasajitvt arthagati na upapadyate . lup nma iyam adaranasya saj kriyate . na ca adaranasya ligasakhye akyete* atideum . lupa adaranasajitvt arthagati na upapadyate . na v adaranasya aakyatvt arthagati shacaryt . na v ea doa . kim kraam . adaranasya aakyatvt . adaranasya ligasakhye* aakye* atideum iti krtv adaranasahacarita ya artha tasya gati bhaviyati shacaryt . yogbhvt ca anyasya . adaranena ca yoga na asti iti krtv adaranasahacarita ya artha tasya gati bhaviyati shacaryt . (P_1,2.51.3) KA_I,228.1-3 Ro_II,102 samse uttarapadasya bahuvacanasya lupa . samse uttarapadasya bahuvacanasya lupa yuktavadbhva vaktavya : madhurpacl . kim prayojanam . niyamrtham . samse uttarapadasya eva . kva m bht . paclamadhure* iti . (P_1,2.52.1) KA_I,228.5-10 Ro_II,102-103 katham idam vijyate : jti yat vieaam iti hosvit jte yni vieani iti . kim ca ata . yadi vijyate jti yat vieaam iti siddham pacl janapada iti . subhika sampannapnya bahumlyaphala iti na sidhyati . atha vijyate jte yni vieani iti siddham subhika sampannapnya bahumlyaphala iti . pacl janapada iti na sidhyati . evam tarhi na evam vijyate jti yat vieaam iti na api jte yni vieani iti . katham tarhi . vieanm yuktavadbhva bhavati jtiprayogt .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (123 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(P_1,2.52.2) KA_I,228.11-21 Ro_II,103-104 kimartham puna idam ucyate . vieanm vacanam jtinivrttyartham . jtinivrttyartha ayam rambha . kim ucyate jtinivrttyartha iti na puna vieanm api yuktavadbhva yath syt iti . samndhikaraatvt siddham . samndhikaraatvt vieanm yuktavadbhva bhaviyati . yadi evam na artha anena . lupa anyatra api jte yuktavadbhva na bhavati . kva anyatra . badar skmakaak madhur vrka iti . kim puna kraam anyatra api jte yuktavadbhva na bhavati . vialig jti yat ligam updya pravartate utpattiprabhrti vint na tat ligam jahti . na tarhi idnm ayam yoga vaktavya . vaktavya ca . kim prayojanam . idam tatra tatra ucyate guavacannm abdnm rayata ligavacanni bhavanti iti . tat anena kriyate . (P_1,2.52.3) KA_I,228.22-229.5 Ro_II,104-105 hartakydiu vyakti . hartakydiu vyakti bhavati yuktavadbhvena : hartaky phalni hartakya phalni . khalatikdiu vacanam . khalatikdiu vacanam bhavati yuktavadbhvena : khalatikasya parvatasya adrabhavni vanni khalatikam vanni . manuyalupi pratiedha . manuyalupi pratiedha vaktavya : cac abhirpa , vadhrik daranya . (P_1,2.53) KA_I,229.7-8 Ro_II,106 kim y et krtrim ighubhdisaj tatprmyt aiyam . na iti ha . sajnam saj . (P_1,2.58) KA_I,229.10-230.21 Ro_II,106-109 idam ayuktam vartate . kim atra ayuktam . bahava te arth . tatra yuktam bahuvacanam . tat yat ekavacane sitavye bahuvacanam iyate etat ayuktam . bahuu ekavacanam iti nma vaktavyam . ata uttaram pahati : jtykhyym smnybhidhnt aikrthyam . jtykhyym smnybhidhnt aikrthyam bhaviyati . yat tat vrhau vrhitvam yave yavatvam grgye grgyatvam tat ekam tac ca vivakitam . tasya ekatvt ekavacanam eva prpnoti . iyate ca bahuvacanam syt iti . tat ca antarea yatnam na sidhyati iti jtykhyyam ekasmin bahuvacanam . evamartham idam ucyate . asti prayojanam etat . kim tarhi iti . tatra ekavacandee uktam . kim uktam . vrhibhya gata iti atra ghe iti iti gua prpnoti iti . na ea doa . arthtidet siddham . arthtidea ayam . na idam pribhikasya vacanasya grahaam . kim tarhi . anvarthagrahaam : ucyate vacanam . bahnm arthnm vacanam bahuvacanam iti . yvat bryt eka artha bahuvat bhavati iti tvat ekasmin bahuvacanam iti . sakhyprayoge pratiedha . sakhyprayoge pratiedha vaktavya . eka vrhi sampanna subhikam karoti . asmada nmayuvapratyayayo ca . asmada nmaprayoge yuvapratyayaprayoge ca pratiedha vaktavya . nmaprayoge : aham devadatta bravmi . aham yajadatta bravmi . yuvapratyayaprayoge : aha grgyyaa bravmi . aham vtsyyana bravmi . yuvagrahaena nrtha . asmada nmapratyayaprayoge na iti eva . idam api siddham bhavati : aham grgya bravmi . aham vtsya bravmi . apara ha : asmada savieaasya prayoge na iti eva . idam api siddham bhavati : aham pau bravmi . aham paita bravmi . aiyam v bahuvat prthakttvbhidhnt . aiya v bahuvadbhva . kim kraam . prthaktvbhidhnt . prthaktvena hi dravyi abhidhyante . bahava te arth . tatra yuktam bahuvacanam . kim ucyate prthaktvbhidhnt iti yvat idnm eva uktam : jtykhyym smnybhidhnt aikrthyam iti . jtiabdena hi dravybhidhnam . jtiabdena hi dravyam api abhidhyate jti api . katham puna jyate jtiabdena dravyam
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (124 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

api abhidhyate iti . evam hi ka cit mahati gomaale goplakam snam prcchati : asti atra km cid gm payasi iti . sa payati : payati ca ayam g prcchati ca km cid atra gm payasi iti . nnam asya dravyam vivakitam iti . tat yad dravybhidhnam tad bahuvacanam bhaviyati . yad smnybhidhnam tad ekavacanam bhaviyati . (P_1,2.59) KA_I,230.23-231.2 Ro_II,109-110 ayam api yoga akya avaktum . katham aham bravmi , vm brva , vayam brma . imni indriyi kad cit svtantryea vivakitni bhavanti . tat yath : idam me aki suhu payati . ayam me kara suhu roti iti . kad cit pratantryea anena ak suhu paymi . anena karena suhu romi iti . tat yad svtantryea vivak tad bahuvacanam bhaviyati . yad pratantryea tad ekavacanadvivacane bhaviyata . (P_1,2.60) KA_I,231.4-7 Ro_II,110 ayam api yoga akya avaktum . katham udite prve phalgunyau , udit prv phalgunya , udite prve prohapade , udit prv prohapad . phalgunsamppagate candramasi phalgunabda vartate . bahava te arth . tatra yuktam bahuvacanam . yad tayo eva abhidhnam tad dvivacanam bhaviyati . (P_1,2.61-62) KA_I,231.10-12 Ro_II,110 imau api yogau akyau avaktum . katham . punarvasuvikhayo supm sulukprvasavara iti siddham . punarvasuvikhayo supm sulukprvasavara iti eva siddham . (P_1,2.63) KA_I,231.14-232.7 Ro_110-113 tiyapunarvasvo iti kimartham . krttikrohiya . nakatra iti kimartham . tiya ca mavaka punarvas maavakau tiyapunarvasava . atha nakatre iti vartamne puna nakatragrahaam kimartham . ayam tiyapunarvasuabda asti eva jyotii vartate . asti ca klavc . tat yath : bahava tiyapunarvasava atikrnt . katarea tiyea gata iti . tat ya jyotii vartate tasya idam grahaam . atha v nakatre iti vartamne puna nakatragrahaasya etat prayojanam : videastham api tiyapunarvasvo kryam tat api nakatrasya eva yath syt : tiyapuyayo nakatri yalopa vaktavya iti nakatragrahaam na kartavyam bhavati . atha v atha v nakatre iti vartamne puna nakatra grahaasya etat prayojanam : tiyapunarvasuparyyavcinm api yath syt : puyapunarvas sidhyapunarvas . atha dvandve iti kimartham . ya tiya tau punarvas yem te ime tiyapunarvasava unmugdh . bahuvacanasya iti kimartham . uditam tiyapunarvas . katham ca atra ekavacanam . jtidvandva ekavat bhavati iti . aprinm iti pratiedha prpnoti . evam tarhi siddhe sati yat bahuvacanagrahaam karoti tat jpayati crya : sarva dvandva vibh ekavat bhavati iti . kim etasya jpane prayojanam . bbhravalakyanam bbhravalakyan iti etat siddham bhavati . atha v na atra bhavanta prin . pr eva atra bhavanta . (P_1,2.64.1) KA_I,233.2-14 Ro_II,114-116 rpagrahaam kimartham . samnnm ekaea ekavibhaktau iti iyati ucyamne yatra eva sarvam samnam abda artha ca tatra eva syt : vrk , plak iti . iha na syt : ak ,. pd , m iti . rpagrahae puna kriyame na doa bhavati . rpam nimittatvena ryate rutau ca rpagrahaam . atha ekagrahaam kimartham . sarpm ea ekavibhaktau iti iyati ucyamne dvibahvo api ea prasajyeta . ekagrahae puna kriyame na doa bhavati . atha eagrahaam kimartham .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (125 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

sarpm eka ekavibhaktau iti iyati ucyamne dea ayam vijyeta . tatra ka doa . ava ca asva ca avau : ntaryata dvyudttavata sthnina dvyudttavn dea prasajyeta . lopyalopit ca na prakalpeta . tatra ka doa . garg , vats , bid , urv . a ya bahuu ya ya bahuu iti ucyamna luk na prpnoti . m bht evam . aantam yat bahuu yaantam yat bahuu iti evam bhaviyati . na evam akyam . iha hi doa syt. : kyapapratikrtaya kyap iti . ekavibhaktau iti kimartham . paya paya jarayati . vsa vsa chdayati . brhmabhym ca krtam brhmabhym ca dehi iti . (P_1,2.64.2) KA_I,233.15-234.5 Ro_II,117-119 kimartham puna idam ucyate . pratyartham abdanivet na ekena anekasya abhidhnam . pratyartham abd abhiniviante . kim idam pratyartham iti . artham artham prati pratyartham . pratyartham bdanivet etasmt krat na ekena abdena anekasya arthasya abhidhnam prpnoti . tatra ka doa . tatra anekrthbhidhne anekaabdatvam . tatra anekrthbhidhne anekaabdatvam prpnoti . iyate ca ekena api anekasya abhidhnam syt iti . tat ca antarea yatnam na sidhyati . tasmt ekaea . evamartham idam ucyate . asti prayojanam etat . kim tarhi iti . kim idam pratyartham abd abhiniveante iti etam drntam sthya sarpm ekaea rabhyate na puna apratyartham abd abhiniviante iti etam drntam sthya virpm anekaea rabhyate . tatra etat syt : laghyas sarpanivrttir garyas virpapratipatti iti . tat ca na . laghyas virpapratipatti . kim kraam . yatra hi bahnm sarpm eka iyate tatra avarata dvayo sarpayo nivrtti vaktavy syt . evam api etasmin sati kim cit crya sukaratarakam manyate . sukaratarakam ca ekaerambham manyate . (P_1,2.64.3) KA_I,234.6-238.17 Ro_II,119-133 kim puna ayam ekavibhaktau ekaea bhavati . evam bhavitum arhati . ekavibhaktau iti cet na abhvd vibhakte . ekavibhaktau iti cet tat na . kim kraam . abhvt vibhakte . na hi samudyt par vibhakti asti . kim kraam . aprtipadikatvt . nanu ca arthavat prtipadikam iti prtipadikasaj bhaviyati . niyamt na prpnoti . arthavatsamudaynm samsagrahaam niyamrtham iti . yadi puna prthak sarvem vibhaktiparm ekaea ucyeta . prthak sarvem iti cet ekaee prthak vibhaktyupalabdhi tadrayatvt . prthak sarvem iti cet ekaee prthak vibhaktyupalabdhi prpnoti . kim ucyate ekaee prthak vibhaktyupalabdhi iti yvat samaya krta : na keval prakrti prayoktavy na kevala pratyaya iti . tadrayatvt prpnoti . yatra hi prakrtinimitt pratyayanivrtti tatra apratyayiky prakrte prayoga bhavati agnicit somasut iti yath . yatra ca pratyayanimitt prakrtinivrtti tatra aprakrtikasya pratyayasya prayoga bhavati adhun , iyn iti yath . astu sayogntalopena siddham . kuta nu khalu etat parayo vrkaabdayo nivrtti bhaviyati na puna prvayo iti . tatra etat syt : prvanivrttav api satym sayogdilopena siddham iti . na sidhyati . tatra avarata dvayo sakrayo ravaam prasajyeta. yatra ca sayogntalopa na asti tatra ca na sidhyati . kva ca sayogntalopa na asti . dvivacanabahuvacanayo . yadi puna samse ekaea ucyeta . kim krtam bhavati . ka cit vacanalopa parihrta bhavati . tat tarhi samsagrahaam kartavyam . na kartavyam . prakrtam anuvartate . kva prakrtam . tiyapunarvasvo nakatradvandve bahuvacanasya dvivacanam nityam iti . samse iti cet svarasamsnteu doa . samse iti cet svarasamsnteu doa bhavati . svara : ava ca ava ca avau. samsntodttatve krte ekaea prpnoti . idam iha sampradhryam : samsntodttattvam kriyatm ekaea iti .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (126 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

kim atra kartavyam . paratvt samsntodttatvam . samsntodttatve ca doa bhavati . svara . samsnta : rk ca rk ca rcau . samsnte krte asrpyt ekaea na prpnoti . idam iha sampradhryam : samsnta kriyatm ekaea iti . kim atra kartavyam . paratvt samsnta . samsnte ca doa bhavati . agraye ca ekaeavacanam . agraye ca krye ekaea vaktavya . svas ca svasrau ca svasra . agraye krte asrpyt ekaea na prpnoti . idam iha sampradhryam : agrayam kriyatm ekaea iti . kim atra kartavyam . paratvt agrayam . tisamse tisamsavacanam . tisamse tisamsa vaktavya . ekam tigrahaam anarthakam . samse tisamsa iti eva siddham . na anarthakam . tisamse prakrte tisamsa vaktavya . tividhipratiedha ca . ti ca ka cit vidheya ka cit pratiedhya . pacati ca pacati ca pacata : taabda vidheya tiabda pratiedhya . yadi puna asamse ekaea ucyeta . asamse vacanalopa . yadi asamse vacanalopa vaktavya . nanu ca utpatat eva vacanalopam codit sma . dvivacanabahuvacanavidhim dvandvapratiedham ca vakyati tadartham puna codyate . dvivacanabahuvacanavidhi . dvivacanabahuvacanni vidheyni : vrka ca vrka ca vrkau , vrka ca vrka ca vrka ca vrk iti . dvandvapratiedha ca . dvandvasya ca pratiedha vaktavya : vrka ca vrka ca vrkau , vrka ca vrka ca vrka ca vrk iti . crthe dvandva iti dvandva prpnoti . na ea doa . anavaka ekaea dvandvam bdhiyate . svaka ekaea . ka avaka . tiantni avaka . yadi puna prthak sarvem vibhaktyantnm ekaea ucyeta . kim krtam bhavati . ka cit vacanalopa parihrta bhavati . vibhaktyantnm ekaee vibhaktyantnm ekaee vibhaktyantnm eva tu nivrtti bhavati . ekavibhaktyantnm iti tu prthagvibhaktipratiedhrtham . ekavibhaktyantnm iti tu vaktavyam . kim prayojanam . prthagvibhaktipratiedhrtham . prthagvibhaktyantnm m bht : brhmabhym ca krtam brhmabhym ca dehi . na v arthavipratiedht yugapadvacanbhva . na v ea doa . kim kraam . arthavipratiedht . vipratiiddhau etau arthau kart sapradnam iti aakyau yugapat nirdeum . tayo vipratiiddhatvt yugapadvacanam na bhaviyati . anekrthraya ca puna ekaea . anekam artham sampratyyayiymi iti ekaea rabhyate . tasmt na ekaabdatvam . tasmt ekaabdatvam na bhaviyati . ayam tarhi doa : ka cit vacanalopa dvivacanabahuvacanavidhi dvandvapratiedha ca iti . yadi puna prtipadiknm ekaea ucyeta . kim krtam bhavati . vacanalopa parihrta bhavati . prtipadiknm ekaee mtrmtro pratiedha sarpatvt . prtipadiknm ekaee mtrmtro pratiedha vaktavya : mt ca janayitr mtrau ca dhnyasya mtrmtra . kim kraam . sarpatvt . sarpi hi etni prtipadikni . kim ucyate prtipadiknm ekaee mtrmtro pratiedha vaktavya iti na puna yasya api vibhaktyantnm ekaea tena api mtrmtro pratiedha vaktavya syt . tasya api hi etni kva cit vibhaktyantni sarpi : mtrbhym ca mtrbhy ca iti . atha matam etat vibhaktyantnm srpye bhavitavyam eva ekaeea iti prtipadiknm eva ekaee doa bhavati . evam ca krtv codyate . haritahariayetayenarohitarohinm striym upasakhynam . haritahariayetayenarohitarohinm striym upasakhynam kartavyam . haritasya str hari hariasya api hari , hari ca hari ca hariyau . yetasya str yen yenasya api yen , yen ca yen ca yenyau . rohitasya str rohi rohiasya api rohi , rohi ca rohi ca rohiyau . na v padasya arthe prayogt . na v ea doa . kim kraam . padasya arthe prayogt . padam arthe prayujyate vibhaktyantam ca padam . rpam ca iha ryate .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (127 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

rpanirgraha ca abdasya na antarea laukikam prayogam . tasmin ca laukike prayoge sarpi etni . apara ha : na v padasya arthe prayogt . na v ea paka eva asti prtipadiknm ekaea iti . kim kram . padasya arthe prayogt . padam arthe prayujyate vibhaktyantam ca padam . rpam ca iha ryate rpanirgraha ca abdasya na antarea laukikam prayogam . tasmin ca laukike prayoge prtipadiknm prayoga na asti . atha anena pakea artha syt : prtipadiknm ekaea iti . bham artha . kim vaktavyam etat . na hi . katham anucyamnam gasyate . etena eva abhihitam strea sarpm ekaea ekavibhaktau iti . katham . vibhakti srpyea ryate . anaimittika ekaea . ekavibhaktau yni sarpi tem ekaea bhavati . kva . yatra v tatra v iti . atha anena pakea artha syt : vibhaktyantnm ekaea iti . bham artha . kim vaktavyam etat . na hi . katham anucyamnam gasyate . etat api etena eva abhihitam strea sarpm ekaea ekavibhaktau iti . katham . na idam pribhiky vibhakte grahaam . kim tarhi . anvarthagrahaam : vibhga vibhakti iti . ekavibhge yni sarpi tem ekaea bhavati iti . nanu ca ukta : ka cit vacanalopa dvivacanabahuvacanavidhi dvandvapratiedha ca iti . na ea doa . yat tvat ucyate ka cit vacanalopa dvivacanabahuvacanavidhiiti . sahavivakym ekaea . yugapadvivakym ekaeea bhavitavyam . na tarhi idnm idam bhavati : vrka ca vrka ca vrkau , vrka ca vrka ca vrka ca vrk iti . na etat sahavivakym bhavati . atha api nidarayitum buddhi evam nidarayitavyam : vrkau ca vrkau ca vrkau , vrk ca vrk ca vrk ca vrk iti . yat api ucyate dvandvapratiedha ca vaktavya iti . na ea doa . anavaka ekae dvandvam bdhiyate . nanu ca uktam svaka ekaea . ka avaka . tiantni avaka iti . na tiantni ekaerambham prayojayanti . kim kraam . yathjtyaknm dvityasya padasya prayoge smarthyam asti tathjtyaknm ekaea . na ca tiantnm dvityasya padasya prayoge smarthyam asti . kim kraam . ek hi kriy . ekena uktatvt tasya arthasya dvityasya prayogea na bhavitavyam uktrthnm aprayoga iti . yadi tarhi ek kriy dvivacanabahuvacanni na sidhyanti : pacata pacanti . na etni kriypeki . kim tarhi . sdhanpeki . atha v puna astu ekavibhaktau iti . nanu ca uktam ekavibhaktau iti cet na abhvt vibhakte iti . na ea doa . parihrtam etat : arthavat prtipadikam iti prtipadikasaj bhaviyati iti . nanu ca uktam niyamt na prpnoti arthavatsamudynm samsagrahaam niyamrtham iti . na ea doa . tulyajtyasya niyama . ka ca tulyajtya . yathjtyaknm samsa . kathajtyaknm samsa . subantnm . (P_1,2.64.4) KA_I,238.18-239.11 Ro_II,133-136 sarvatra apatydiu upasakhynam . sarveu pakeu apatydiu upasakhynam kartavyam : bhikm samha bhaikam iti . sarvatra iti ucyate prtipadikm ca ekaee siddham . apatydiu iti ucyate bahava ca apatydaya : gargasya apatyam bahava garg . ek prakrti bahava ca yaa . asrpyt ekaea na prpnoti . nanu ca yath eva bahava yaa evam prakrtaya api bahvya syu . na evam akyam . iha hi doa syt : garg , vats , bid , urv iti . a ya bahuu ya ya bahuu iti ucyamna luk na prpnoti . m bht evam . aantam yat bahuu yaantam yat bahuu iti evam bhaviyati . nanu ca uktam : na evam akyam . iha hi doa syt : kyapapratikrtaya kyap iti . na ea doa . laukikasya tatra gotrasya grahaam na ca etat laukikam gotram . atha v puna astu ek prakrti bahava ca yaa . nanu ca uktam : asrpyt ekaea na prpnoti iti . siddham tu samnrthnm
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (128 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

ekaeavacant . siddham etat . katham . samnrthnm ekaea bhavati iti vaktavyam . yadi samnrthnm ekaea ucyate katham ak , pd , m iti . nnrthnm api sarpm . nnrthnm api sarpm ekae vaktavya . ekrthnm api virpm . ekrthnm api virpm ekaea vaktavya : vakradaa ca kuiladaa ca vakradaau kuiladau iti v . svarabhinnnm yasya uttarasvaravidhi . svarabhinnnm yasya uttarasvaravidhi tasya ekaea vaktavya . aka ca aka ca akau , mmasaka ca mmsaka ca mmasakau . (P_1,2.64.5) KA_I,239.12-240.11 Ro_II,136-139 iha kasmt na bhavati : eka ca eka ca , dvau ca dvau ca iti . sakhyy arthsampratyayt anyapadrthatvt ca anekaea . sakhyy arthsampratyayt ekaea na bhaviyati . na hi ekau iti anena artha gamyate . anyapadrthatvt ca sakhyy ekaea na bhaviyati . eka ca eka ca iti asya dvau iti artha . dvau ca dvau ca iti asya catvra iti artha . na etau sta parihrau . yat tvat ucyate sakhyy arthsampratyayt iti . arthsampratyaye api ekaea bhavati . tat yath . grgya ca grgyyaa ca grgyau . na ca ucyate vrddhayuvnau iti bhavati ca ekaea . yat api ucyate : anyapadrthatvt ca iti . anyapadrthe api ekaea bhavati . tat yath : viati ca viati ca viat iti . tayo catvriat iti artha . evam tarhi na imau prthak parihrau . ekaparihra ayam : sakhyy arthsampratyayt anyapadrthatvt ca iti . yatra hi arthsampratyaya eva v anyapadrthat eva v bhavati tatra ekaea grgyau viat iti yath . atha v na ime ekaeaabd . yadi tarhi na ime ekaeaabd samudyaabd tarhi bhavanti . tatra ka doa . ekavacanam prpnoti . ekrth hi samudy bhavanti . tat yath ytham , atam , vanam iti . santu tarhi ekaeaabd . kikrtam srpyam . anyonyakrtam srpyam . santi puna ke cit anye api abd yem anyonyakrta bhva . santi iti ha . tad yath mt pit bhrt iti . viama upanysa . sakrt ete abd pravrtt apyeu api vartante . iha puna ekena api apye na bhavati catvra iti . anyat idnm etat ucyate sakrt ete abd pravrtt apyeu api vartante iti . yat tu bhavn asmn codayati santi puna ke cit anye api abd yem anyonyakrt bhva iti tatra ete asmbhi upanyast . tatra etat bhavn ha sakrt ete abd pravrtt apyeu api vartante iti . etat ca vrttam . ekaika na udyantum bhram aknoti yat katham tatra | ekaika kart syt sarve v syu katham yuktam || kraam udyamanam cet na udyacchati ca antarea tat tulyam | tasmt prthak prthak te kartra savyapek tu || (P_1,2.64.6) KA_I,240.12-15 Ro_II,140 prathamamadhyamottamnm ekaea sarpatvt . prathamamadhyamottamnm ekaea vaktavya : pacati ca pacasi ca pacatha , pacasi ca pacmi ca pacva , pacati ca pacasi ca pacmi ca pacma . kim puna kraam na sidhyati . asarpatvt . (P_1,2.64.7) KA_I,240.16-242.9 Ro_II,140-144 dvivacanabahuvacanprasiddhi ca ekrthatvt . dvivacanabahuvacanayo ca aprasiddhi . kim kraam . ekrthatvt . eka ayam avaiyate . tena anena tadarthena bhavitavyam . kimarthena . yadartha eka . kimartha ca eka . eka ekrtha . na aikrthyam . na ayam ekrtha . kim tarhi . dvyartha bahvartha ca . na aikrthyam iti cet rambhnarthakyam . na aikrthyam iti cet ekaerambha anarthaka syt . iha hi abdasya svbhvik v anekrthat syt vcanik v . tat yadi tvat svbhvik aiya ekaea ekena uktatvt . aiya ekaea . kim
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (129 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

kraam . ekena uktatvt tasya arthasya dvityasya prayogea na bhavitavyam uktrthnm aprayoga iti . atha vcanik tat vaktavyam : eka ayam aviiyate sa ca dvyartha bhavati bahvartha ca iti . na vaktavyam . siddham ekaea iti eva . katham puna eka ayam aviiyate iti anena dvyarthat bahvarthat v aky labdhum . tat ca ekaeakrtam . na hi antarea tadvcina abdasya prayogam tasya arthasya gati bhavati . payma ca puna antarea api tadvcina abdasya prayogam tasya arthasya gati bhavati iti agnicit somasut iti yath . te manymahe : lopakrtam etat yena atra antarea api tadvcina abdasya prayogam tasya arthasya gati bhavatiti . evam iha api ekaeakrtam etat yena atra eka ayam avaiyate iti anena dvyarthat bahvarthat v bhavati . ucyeta tarhi na tu gamyeta . ya hi gm ava iti bryt avam v gau iti na jtu cit sampratyaya syt . tena anekrthbhidhne yatnam kurvat avayam loka prhata anugantavya : keu artheu laukik kn abdn prayujate iti . loke ca ekasmin vrka iti prayujate dvayo vrkau iti bahuu vrk iti . yadi tarhi loka avayam abdeu pramam kimartham ekaea rabhyate . atha kimartham lopa rabhyate . pratyayalakaam crya prrthayamna lopam rabhate . ekaerambhe puna asya na kim cit prayojanam asti . nanu ca uktam : pratyartham abdanivet na ekena anekasya abhidhnam iti . yadi ca ekena abdena anekasya arthasya abhidhnam syt na pratyartham abdanivea krta syt . pratyartham abdanivet ekena anekasya abhidhnt apratyartham iti cet tat api pratyartham eva . pratyartham abdanivet ekena anekasybhidhnt apratyartham iti cet evam ucyate : yat api ekena anekasya abhidhnam bhavati tat api pratyartham eva . yat api hi arthau arthau prati tat api pratyartham eva . yat api hi arthn arthn prati tat api pratyartham eva . yvatm abhidhnam tvatm prayoga nyyya . yvatm arthnm abhidhnam bhavati tvatm abdnm prayoga iti ea paka nyyya . yvatm abhidhnam tvatm prayoga nyyya iti cet ekena api anekasya abhidhnam . yvatm abhidhnam tvatm prayoga nyyya iti cet evam ucyate : ea api nyyya eva yat api ekena api anekasya abhidhnam bhavati . yadi tarhi ekena anekasya abhidhnam bhavati plakanyagrodhau : ekena uktatvt aparasya prayoga anupapanna . ekena uktatvt tasya arthasya aparasya prayogea na bhavitavyam . kim kraam . uktrthnm aprayoga iti . ekena uktatvt aparasya prayoga anupapanna iti cet anuktatvt plakea nyagrodhasya nyagrodhaprayoga . ekena uktatvt aparasya prayoga anupapanna iti cet anukta plakea nyagrodhrtha iti krtv nyagrodhaabda prayujyate . katham anukta yvat idnm eva uktam ekena api anekasya abhidhnam bhavati iti . sarpm ekena api anekasya abhidhnam bhavati na virpm . kim puna kraam sarpm ekena api anekasya abhidhnam bhavati na puna virpm . abhidhnam puna svbhvikam . svbhvikam abhidhnam . ubhayadarant ca . ubhayam khalu api dryate : virpm api ekena anekasya abhidhnam bhavati . tat yath : dyav ha kam . dyav cit asmai prthiv namete iti . virpm kila nma ekena anekasya abhidhnam syt kim puna sarpm . (P_1,2.64.8) KA_I,242.10-244.7 Ro_II,144-150 krtyabhidhnt v ekam vibhaktau vjapyyana . krtyabhidhnt v ekam abdam vibhaktau vjapyyana crya nyyyam manyate : ek krti s ca abhidhyate iti . katham puna jyate ek krti s ca abhidhyate iti . prakhyviet . na hi gau iti ukte viea prakhyyate ukl nl kapil kapotik iti . yadi api tvat prakhyviet jyate ek krti iti kuta tu etat s abhidhyate iti .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (130 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

avyapavargagate ca . avyapavargagate ca manymahe krti abhidhyate iti . na hi gau iti ukte vyapavarga gamyate ukl nl kapil kapotik iti . jyate ca ekopadiam . jyate khalu api ekopadiam . gau asya kad cit upadia bhavati . sa tam anyasmin dee anyasmin kle anyasym ca vayovasthym drv jnti ayam gau iti . ka puna asya viea prakhyviet iti ata . tasya eva upodbalakam etat : prakhyviet jyate ca ekopadiam iti . dharmastram ca tath . evam ca krtv dharmastram pravrttam : brhmaa na hantavya . sur na pey iti . brhmaamtram na hanyate surmtram ca na pyate . yadi dravyam padrtha syt ekam brhmaam ahatv ekm ca surm aptv anyatra kmacra syt . ka puna asya viea avyapavargagate ca iti ata . tasya eva upodbalakam etat : avyapavargagate ca dharmastram ca tath iti . asti ca ekam anekdhikaraastham yugapat . asti khalu api ekam anekdhikaraastham yugapat upalabhyate . kim . ditya . tad yath eka ditya anekdhikaraastha yugapat upalabhyate . viama upanysa . na eka dra dityam anekdhikaraastham yugapat upalabhate . evam tarhi itndravat viaya . tat yath eka indra anekasmin kratuate hta yugapat sarvatra bhavati evam krti api yugapat sarvatra bhaviyati . avayam ca etat evam vijeyam ekam anekdhikaraastham yugapat upalabhyate iti. na ekam anekdhikaraastham yugapat iti cet tath ekaee . ya hi manyate na ekam anekdhikaraastham yugapad upalabhyate iti ekaee tasya doa syt . ekaee api na eka vrkaabda anekam artham yugapat abhidadhta . avayam ca etat evam vijeyam krti abhidhyate iti . dravybhidhne hi krtyasampratyaya . dravybhidhne sati krte asampratyaya syt . tatra ka doa . tatra asarvadravyagati . tatra asarvadravyagati prpnoti . asarvadravyagatau ka doa . gau anubandhya aja agnomya iti : eka stroktam kurvta apara astroktam . astrokte ca kriyame viguam karma bhavati . vigue ca karmai phalnavpti . nanu ca yasya api krti padrtha tasya api yadi anavayavena codyate na ca anubadhyate viguam karma bhavati . vigue ca karmai phalnavpti . ek krti iti ca pratij hyeta . yat ca asya pakasya updne prayojanam ekaea na vaktavya iti sa ca idnm vaktavya bhavati . evam tarhi anavayavena codyate pratyekam ca parisampyate yath ditya . nanu ca yasya api dravyam padrtha tasya api anavayavena codyate pratyekam ca parisampyate . ekaea tvay vaktavya . tvay api tarhi dvivacanabahuvacanni sdhyni . codanym ca ekasya updhivrtte . codanym ca ekasya updhivrtte manymahe krti abhidhyate iti . gneyam akaplam nirvapet : ekam nirupya dvityas trtya ca nirupyate . yadi ca dravyam padrtha syt ekam nirupya dvityasya trtyasya ca nirvapaam na prakalpeta . ka puna etayo jticodanayo viea . ek nirvrttena apar nirvartyena . (P_1,2.64.9) KA_I,244.8-245.5 Ro_II,150-152 dravybhidhnam vyi . dravybhidhnam vyi crya nyyyam manyate : dravyam abhidhyate iti . tath ca ligavacanasiddhi . evam ca krtv ligavacanni siddhni bhavanti : brhma brhmaa , brhmaau brhma iti . codansu ca tasya rambht . codansu ca tasya rambht manymahe dravyam abhidhyate iti . gau anubandhya aja agnomya iti : krtau coditym dravye rambhalambhanaprokaaviasandni kriyante . na ca ekam anekdhikaraastham yugapat . na khalu api ekam anekdhikaraastham yugapat upalabhyate . na hi eka devadatta yugapat srughne bhavati mathurym ca . vine prdurbhve ca sarvam tath syt . kim . vinayet ca prdu yt ca . v mrta iti v nma loke na pracaret . gau jta iti
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (131 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

sarvam gobhtam anavakam syt . asti ca vairpyam . asti khalu api vairpyam : gau ca gau ca khaa mua iti . tath ca vigraha . evam ca krtv vigraha upapanna bhavati : gau ca gau ca iti . vyartheu ca muktasaayam . vyartheu ca muktasaayam bhavati . krtau api padrthe ekaea vaktavya : ak , pd , m iti . (P_1,2.64.10) KA_I,245.6-247.16 Ro_II,153-159 ligavacanasiddhi guasya anityatvt . ligavacanni siddhni bhavanti . kuta . guasya anityatvt . anity gu apyina upyina ca . kim ye ete ukldaya . na iti ha . strpunapusakni sattvagu ekatvadvitvabahutvni ca . kad cit krti ekatvena yujyate kad cit dvitvena kad cit bahutvena kad cit strtvena kad cit pustvena kadcit napusakatvena . bhavet ligaparihra upapanna vacanaparihra tu na upapadyate . yadi hi kad cit krti ekatvena yujyate kad cit dvitvena kad cit bahutvena ek krti iti pratij hyeta . yat ca asya pakasya updne prayojanam uktam ekaea na vaktavya iti sa ca idnm vaktavya bhavati . evam tarhi ligavacanasiddhi guavivaknityatvt . ligavacanni siddhni bhavanti . kuta . guavivaky anityatvt . anity guavivak . kad cit krti ekatvena vivakit bhavati kad cit dvitvena kad cit bahutvena kad cit strtvena kad cit pustvena kad cit napusakatvena . bhavet ligaparihra upapanna vacanaparihra tu na upapadyate . yadi kad cit krti ekatvena vivakit bhavati kad cit dvitvena kad cit bahutvena ek krti iti pratij hyeta . yat ca asya pakasya updne prayojanam uktam ekaea na vaktavya iti sa ca idnm vaktavya bhavati . ligaparihra ca api na upapadyate . kim kraam . vialig jti yat ligam updya pravartate utpattiprabhrti vint tat ligam na jahti . tasmt na vaiykaraai akyam laukikam ligam sthtum . avayam ka cit svakrtnta stheya . ka asau svakrtnta . sastynaprasavau ligam . sastynaprasavau ligam stheyau . kim idam sastynaprasavau iti . sastyne styyate ra : str . ste sap prasave pumn . nanu ca loke api styyate eva str ste ca pumn . adhikaraasdhan loke str : styyati asym garbha iti . kartrsdhana ca pumn : ste pumn iti . iha puna ubhayam bhvasdhanam : stynam pravrtti ca . kasya puna stynam str pravrtti v pumn . gunm . kem . abdaspararparasagandhnm . sarv ca puna mrtaya evamtmik sastynaprasavagu abdaspararparasagandhavatya . yatra alpysa gu tatra avarata traya : abda spara rpam iti . rasagandhau na sarvatra . pravrtti khalu api nity . na hi iha ka cit api svasmin tmani muhrtam api avatihate . vardhate yvat anena vardhitavyam apacayena v yujyate . tat ca ubhayam sarvatra . yadi ubhayam sarvatra kuta vyavasth . vivakta. sastynavivakym str prasavavivakym pumn ubhayo api avivakym napusakam . tatra ligavacanasiddhi guavivaknityatvt iti ligaparihra upapanna . vacanaparihra tu na upapadyate . vacanaparihra ca api upapanna . idam tvat ayam praavya : atha yasya dravyam padrtha katham tasya ekavacanadvivacanabahuvacanni bhavanti iti . evam sa vakyati : ekasmin ekavacanam dvayo dvivacanam bahuu bahuvacanam iti . yadi tasya api vcanikni na svbhvikni aham api evam vakymi : ekasmin ekavacanam dvayo dvivacanam bahuu bahuvacanam iti . na hi krtipadrthikasya dravyam na padrtha dvavyapadrthikasya v krti na padrtha . ubhayo ubhayam padrtha . kasya cit tu kim cit pradhnabhtam kim cit guabhtam . krtipadrthikasya krti pradhnabht dravyam guabhtam . dravyapadrthikasya dravyam pradhnabhtam krti guabht . guavacanavat v .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (132 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

guavacanavat v ligavacanni bhaviyanti . tat yath guavacannm abdnm rayata ligavacanni bhavanti : uklam vastram , ukl ukla kambala , uklau kambalau ukl kambal iti . yat asau dravyam rita bhavati gua tasya yat ligam vacanam ca tat guasya api bhavati . evam iha api yat asau dravyam rit krti tasya yat ligam vacanam ca tat krte api bhaviyati . adhikaraagati shacaryt . krtau rambhadnm sambhava na asti iti krtv krtisahacarite dravye rambhadni bhaviyanti . na ca ekam anekdhikaraastham yugapat iti dityavat viaya . na khalu api ekam anekdhikaraastham yugapat upalabhyate iti dityavat viaya bhaviyati . tat yath eka ditya anekdhikaraastha yugapat upalabhyate . viama upanysa . na eka dra anekdhikaraastham dityam yugapat upalabhate . evam tarhi itndravat viaya . tad yath eka indra anekasmin kratuate hta yugapat sarvatra bhavati evam krti yugapat sarvatra bhaviyati . avina anritatvt . dravyavine krte avina . kuta . anritatvt . anrit krti dravyam . kim ucyate anritatvt iti yat idnm eva uktam adhikaraagati shacaryt iti . evam tarhi avina anaiktmyt . dravyavine krte avina . kuta . anaiktmyt . aneka tm krte dravyasya ca . tat yath vrkastha avatna vrke chinne api na vinayati . vairpyavigrahau dravyabhedt . vairpyavigrahau api dravyabhedt bhaviyata . vyartheu ca smnyt siddham . vibhinnrtheu ca smnyt siddham sarvam . anote aka . padyate pda . mimte ma . tatra kriysmnyt siddham . apara tu ha . purkalpe etat st oaa m krpaam oaaphalca maambaya . tatra sakhysmnyt siddham . (P_1,2.65) KA_I,247.18-20 Ro_II,160 iha kasmt na bhavati : aja ca barkara ca , ava ca kiora ca , ura ca karabha ca iti . tallakaa cet eva viea iti ucyate na ca atra tallakaa eva viea . tallakaa eva viea yat samnym krtau abdabheda . (P_1,2.66.1) KA_I,247.22-248.3 Ro_II,161 idam sarveu strgrahaeu vicryate : strgrahae strpratyayagrahaam v syt stryarthagrahaam v strabdagrahaam v iti . kim ca ata . yadi pratyayagrahaam v abdagrahaam v grg ca grgyyaau ca garg : kena yaabda na ryeta . astriym iti hi luk ucyate . iha ca grg ca grgyyaau ca gargn paya : tasmt asa na pusi iti natvam na prpnoti . atha arthagrahaam na doa bhavati . yath na doa tath astu (P_1,2.66.2) KA_I,248.4-6 Ro_II,161 iha kasmt na bhavati : aj ca barkara ca , vaav ca kiora ca , ur ca karabha ca iti . tallakaa cet eva viea iti ucyate . na ca atra tallakaa eva viea . tallakaa eva viea yat samnym krtau abdabheda . (P_1,2.67) KA_I,248.8-10 Ro_II,162 iha kasmt na bhavati : hasa ca vara ca kacchapa ca ul ca , rya ca rohit ca iti . tallakaa cet eva viea iti ucyate . na ca atra tallakaa eva viea . tallakaa eva viea yat samnym krtau abdabheda . (P_1,2.68.1) KA_I,248.12-18 Ro_II,162 kimartham idam ucyate na pumn striy iti eva siddham . na sidhyati . tallakaa cet eva viea iti ucyate . na ca atra tallakaa eva viea . tallakaa eva viea yat samnym krtau abdabheda . evam tarhi siddhe sati yat imam yogam sti tat jpayati crya : yatra rdhvam prakrte tallakaa eva
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (133 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

viea tatra ekaea bhavati iti . kim etasya jpane prayojanam . hasa ca vara ca , kacchapa ca ul ca , rya ca rohit ca iti atra ekaea na bhavati . prvayo yogayo bhyn parihra . yvat bryt gotram yn iti tvat vrddha yn iti . prvastre gotrasya vrddham iti saj kriyate . (P_1,2.68.2) KA_I,248.19-249.20 Ro_II,163-165 asarpm yuvasthavirastrpusnm vieasya avivakitatvt smnyasya ca vivakitatvt siddham . asarpm yuvasthavirastrpusnm viea ca avivakita smnyam ca vivakitam . vieasya avivakitatvt smnyasya ca vivakitatvt sarpm ekaea ekavibhaktau iti eva siddham . pumn striy iha kasmt na bhavati : brhmaavats ca brhmavatsa ca iti . brhmaavatsbrhmavatsayo vibhaktiparasya vieavcakatvt anekaea . brhmaavatsbrhmavatsayo ligasya vibhaktiparasya vieavcakatvt ekaea na bhaviyati . yatra ligam vibhaktiparam eva vieavcakam tatra ekaea bhavati . na atra ligam vibhaktiparam eva vieavcakam . yadi tarhi yatra ligam vibhaktiparam eva vieavcakam tatra ekaea bhavati iha na prpnoti : kraka ca krik ca krakau . na hi atra ligam vibhaktiparam eva vieavcakam . katham puna idam vijyate : abda y str tallakaa cet eva viea iti hosvit artha y str tallakaa cet eva viea iti . kim ca ata . yadi vijyate abda y str tallakaa cet eva viea iti siddham kraka ca krik ca krakau . idam tu na sidhyati : gomn ca gomat ca gomantau . atha vijyate artha y str tallakaa cet eva viea iti siddham gomn ca gomat ca gomantau . idam tu na sidhyati : kraka ca krik ca krakau . ubhayath api pau ca pav ca pa* iti etat na sidhyati . evam tarhi na evam vijyate abda y str tallakaa cet eva viea iti na api artha y str tallakaa cet eva viea iti . katham tarhi . abdrthau y str tatsadbhvena ca tallakaa viea ryate . evam ca krtv iha api prpti : brhmaavats ca brhmavatsa ca iti . evam tarhi idam iha vyapadeyam sat crya na vyapadiati . kim . tat iti anuvartate . tat iti anena prakrtau strpusau pratinirdiyete . kau ca prakrtau . pradhne . pradhnam y abdastr pradhnam y arthastr iti . (P_1,2.69) KA_I,249.22-250.10 Ro_II,166-167 ayam yoga akya avaktum . katham ukla ca kambala uklam ca vastram tat idam uklam , te* ime ukle , ukla ca kambala ukl ca brhatik uklam ca vastram tat idam uklam , tni imani uklni . pradhne kryasampratyayt ea . pradhne kryasampratyayt ea bhaviyati . kim ca pradhnam . napusakam . katham puna jyate napusakam pradhnam iti . evam hi dryate loke : anirjte arthe guasandehe ca napusakaligam prayujyate . kim jtam iti ucyate . dvayam ca eva hi jyate str v pumn v . tath vidre avyaktam rpam drv vaktra bhavanti mahirpam iva brhmarpam iva . pradhne kryasampratyayt napusakasya ea bhaviyati . idam tarhi prayojanam : ekavat ca asya anyatarasym iti vakymi iti . etat api na asti prayojanam . krtivcitvt ekavacanam . krtivcitvt ekavacanam bhaviyati . yad dravybhidhnam tad dvivacanabahuvacane bhaviyata . (P_1,2.68,70-71) KA_I,250.13-251.7 Ro_II,168-169 kimartham idam ucyate na pumn striy iti eva siddham . bhrtrputrapitrvaurm krat dravye abdanivea . bhrtrputrapitrvaurm krat dravye abdanivea bhavati . bhrtrputrapitrvaurm krad dravye abdanivea iti cet tulyakraatvt siddham . yadi tvat bibharti iti bhrt
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (134 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

svasari api etat bhavati . tath yadi punti prti iti v putra duhitari api etat bhavati . tath yadi pti playati iti v pit mtari api etat bhavati . tath yadi u ptavya vaura varvm api etat bhavati . daranam vai hetu . na hi svasari bhrtrabda dryate . daranam hetu iti cet tulyam . daranam hetu iti cet tulyam etat bhavati . svasari api bhrtrabda dryatm . tulyam hi kraam . na vai ea loke sampratyaya . na hi loke bhrt nyatm iti ukte svas nyate . tadviayam ca . tadviayam ca etat draavyam bhavati : svasari bhrtrtvam . kiviayam . ekaeaviayam . yuktam puna yat niyataviay abd syu . bham yuktam . anyatra api tadviayadarant . anyatra api tadviay abd dryante . tat yath : samne rakte vare gau lohita iti bhavati ava oa iti . samne ca kle vare gau kra iti bhavati ava hema iti . samne ca ukle vare gau veta iti bhavati ava karka iti . (P_1,2.72.1) KA_I,251.9-14 Ro_II,169-170 tyaddita ee punnapusakata ligavacanni . tyaddita ee punnapusakata ligavacanni bhavanti . s ca devadatta ca tau s ca kue ca tni . advandvatatpuruavieanm . advandvatatpuruavieanm iti vaktavyam . iha m bht . sa ca kukkua s ca mayr kukkuamayryau te . ardham pippaly tat ardhapippal ca s ardhapippalyau te . (P_1,2.72.2) KA_I,251.15-252.11 Ro_II,170-171 ayam api yoga akya avaktum . katham . tyaddnm smnyrthatvt . tyaddnm smnyam artha . ta ca smnyam . devadatte api hi sa iti etat bhavati yajadatte api . tyaddnm smnyrthatvt ea bhaviyati . idam tarhi prayojanam : parasya eam vakymi iti . parasya ca ubhayavcitvt . ubhayavci param . prvaeadarant ca . prvasya khalu api ea dryate : sa ca ya ca tau naya , yau naya iti . idam tarhi prayojanam :dvandva m bht iti . etat api na asti prayojanam . smnyavieavcino ca dvandvbhvt siddham . smnyavieavcino ca dvandva na bhavati iti vaktavyam . yadi smnyavieavcino dvandva na bhavati iti ucyate drbhram , gobalvardam , trolapam iti na sidhyati . na ea doa . iha tvat drbhram iti : bhr jtyantari . gobalvardam iti : gva utklitapusk vhya ca vikrayya ca . striya eva avaiyante . trolapam iti : apm ulapam iti nmadheyam . tat tarhi vaktavyam . na vaktavyam . smnyena uktatvt vieasya prayoga na bhaviyati . smnyena uktatvt tasya arthasya vieasya prayogea na bhavitavyam . kim kraam . uktrthnm aprayoga iti . na tarhi idnm idam bhavati : tam brhmaam naya grgyam iti . bhavati yad niyogata tasya eva nayanam bhavati . evam tarhi yena eva khalu api hetun etat vkyam bhavati tam brhmaam naya grgyam iti tena eva hetun vrtti api prpnoti . tasmt smnyavieavcino dvandva na bhavati iti vaktavyam . (P_1,2.73) KA_I,252.13-23 Ro_II,172 ayam api yoga akya avaktum . katham gva im caranti , aj im caranti . gva utklitapusk vhya ca vikrayya ca . striya eva avaiyante . idam tarhi prayojanam : grmyeu iti vakymi iti . iha m bht : nyakava ime , kar ime iti . ka puna arhati agrmym pusa utklayitum ye grahtum aaky . kuta eva vhya ca vikrayya ca . idam tarhi prayojanam : pauu iti vakymi iti . iha m bht : brhma ime , vral ime . ka puna arhati apanm pusa utklayitum ye aaky vhya ca vikrayya ca . idam tarhi prayojanam : sagheu iti vakymi iti . iha m bht : etau gva carata . ka puna arhati nirjte arthe anyath prayoktum . idam tarhi
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (135 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prayojanam : atarueu iti vakymi iti . iha m bht : uraak ime , barkar ime iti . ka puna arhati tarunm pusa utklayitum ye aaky vhya ca vikrayya ca . anekaapheu iti vaktavyam iha m bht : av caranti . gardabh caranti iti . (P_1,3.1.1) KA_I,253.2-254.12 Ro_II,173-178 kuta ayam vakra . yadi tvat sahitay nirdea kriyate bhvdaya iti bhavitavyam . atha asahitay bh-daya iti bhavitavyam . ata uttaram pahati : bhvdnm vakra ayam magalrtha prayujyate . mgalika crya mahata straughasya magalrtham vakram gamam prayukte . magaldni magalamadhyni magalntni hi stri prathante vrapurui ca bhavanti yumatpurui ca . adhyetra ca siddhrth yath syu iti . atha digrahaam kimartham . yadi tvat pahyante na artha digrahaena . anyatra api hi ayam pahan digrahaam na karoti . kva anyatra . mramrdagudhakuakliavadavasa ktv iti . atha na pahyante natarm artha digrahaena . na hi apahit aky digrahaena vieayitum . evam tarhi siddhe sati yat digrahaam karoti tat jpayati crya asti ca pha bhya ca strt iti . kim etasya jpane prayojanam . phena dhtusaj iti etat upapannam bhavati . phena dhtusajym samnaabdapratiedha . phena dhtusajym samnaabdnm pratiedha vaktavya . y iti dhtu y iti banta . v iti dhtu v iti nipta . nu iti dhtu nu iti pratyaya ca nipta ca . div iti dhtu div iti prtipadikam . kim ca syt yadi etem api dhtusaj syt . dhto iti tavydnm utpatti prasajyeta . na ea doa . sdhane tavydaya vidhyante sdhanam ca kriyy . kriybhvt sdhanbhva . sdhanbhvt satym api dhtusajym tavydaya na bhaviyanti . iha tarhi : y paya : ta dhto iti lopa prasajyeta . na ea doa . anpa iti evam sa . asya tarhi vabdasya niptasya adhtu iti prtipadikasajy pratiedha prasajyeta . aprtipadikatvt svdyutpatti na syt . na ea doa . niptasya anarthakasya prtipadikatvam coditam . tatra anarthakagrahaam na kariyate : nipta prtipadikam iti eva . iha tarhi : trasn iti : aci nudhtubhruvm yvo iyauvaau iti uvadea prasajyeta . na ea doa . cryapravrtti jpayati na pratyayasya uvadea bhavati iti yat ayam tatra nugrahaam karoti . asya tarhi divabdasya adhtu iti prtipadikasajy pratiedha prasajyeta . aprtipadikatvt svdyutpatti na syt . na ea doa . cryapravrtti jpayati utpadyante divabdt svdaya iti yat ayam diva sau auttvam sti . na etat asti jpakam . asti hi anyat etasya vacane prayojanam . kim . divabda yat prtipadikam tadartham etat syt : akady iti . na vai atra iyate . aniam ca prpnoti iam ca na sidhyati . evam tarhi ananubandhakagrahae na snubandhakasya iti evam etasya na bhaviyati . evam api ananubandhaka divabda na asti iti krtv snubandhakasya grahaam vijsyate . parimagrahaam ca . parimagrahaam ca kartavyam . iyn avadhi dhtusaja bhavati iti vaktavyam kuta hi etat bhabda dhtusaja bhaviyati na puna bhvedhabda iti . (P_1,3.1.2) KA_I,254.13-256.17 Ro_II,179-185 yadi puna kriyvacana dhtu iti etat lakaam kriyeta . k puna kriy . h . k puna h . ce . k puna ce . vypra . sarvath bhavn abdena eva abdn cae . na kim cid arthajtam nidarayati : evajtyik kriy iti . kriy nma iyam atyantparidr . aaky kriy pibht nidarayitum yath garbha nirluhita . s asau anumnagamy . ka asau anumna . iha sarveu sdhaneu sannihiteu kad cit pacati iti etat bhavati kadcit na bhavati . yasmin sdhane sannihite pacati
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (136 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

iti etat bhavati s nnam kriy . atha v yay devadatta iha bhtv paliputre bhavati s nnam kriy . katham puna jyate kriyvacan pacdaya iti . yat em karotin smndhikarayam : kim karoti . pacati . kim kariyati . pakyati . kim akrt . apkt iti . tatra kriyvacane upasargapratyayapratiedha . kriyvacane dhtau upasargapratyayayo pratiedha vaktavya . pacati prapacati . kim puna kraam prpnoti . saghtena arthagate . saghtena hi artha gamyate saprakrtikena sapratyayakena sopasargea ca . astibhavatividyatnm dhtutvam . astibhavatividyatnm dhtusaj vaktavy . yath hi bhavat karotin pacdnm smndhikarayam nidaritam na tath astydnm nidaryate . na hi bhavati kim karoti asti iti . pratyayrthasya avyatirekt prakrtyantareu . pratyayrthasya avyatirekt prakrtyantareu manymahe dhtu eva kriym ha iti . pacati pahati : prakrtyartha anya ca anya ca . pratyayrtha sa eva . dhto ca arthbhedt pratyayntareu . dhto ca arthbhedt pratyayntareu manymahe dhtu eva kriym ha iti . pakt pacanam pka iti : pratyayrtha anya ca anya ca bhavati . prakrtyartha sa eva. katham puna jyate ayam prakrtyartha ayam pratyayrtha iti . siddham tu anvayavyatirekbhym . anvayt vyatirekt ca . ka asau anvaya vyatireka v . iha pacati iti ukte ka cit abda ryate : pacabda cakrnta atiabda ca pratyaya . artha api ka cit gamyate : viklitti kartrtvam ekatvam ca . pahati iti ukte ka cit abda hyate ka cit upajyate ka cit anvay : pacabda hyate pahabda upajyate atiabda anvay . artha api ka cit hyate ka cit upajyate ka cit anvay : viklitti hyate pahikriy upajyate kartrtvam ca ekatvam ca anvay . te manymahe : ya abda hyate tasya asau artha ya artha hyate . ya abda upajyate tasya asau artha ya artha upajyate . ya abda anvay tasya asau artha ya artha anvay . viama upanysa . bahava hi abd ekrth bhavanti . tat yath : indra akra puruhta purandara , kandu koha kula iti . eka ca abda bahvartha . tat yath : ak pd m iti . ata kim na sdhya arthavatt siddh bhavati . na api brma arthavatt na sidhyati iti .varit arthavatt anvayavyatirekbhym eva . tatra kuta etat : ayam prakrtyartha ayam pratyayrtha iti na puna prakrti eva ubhau arthau bryt pratyaya eva v . smnyaabd ete evam syu . smnyaabd ca na antarea prakaraam vieam v vieeu avatihante . yata tu khalu niyogata pacati iti ukte svabhvata kasmin cit viee pacatiabda vartate ata manymahe na ime smnyaabd iti . na cet smnyaabd prakrti prakrtyarthe vartate pratyaya pratyayrthe . kriyvieaka upasarga . pacati iti kriy gamyate . tm pra viinai . yadi api tvat atra etat akyate vaktum yatra dhtu upasargam vyabhicarati yatra na khalu tam vyabhicarati tatra katham : adhyeti , adhte iti . yadi api atra dhtu upasargam na vyabhicarati upasarga tu dhtum vyabhicarati . te manymahe : ya eva asya adhe anyatra artha sa iha api iti . ka puna anyatra adhe artha . adhi uparibhve vartate . iha tarhi vyaktam arthntaram gamyate : tihati pratihate iti . tihati iti vrajikriyy nivrtti pratihate iti vrajikriy gamyate . te manymahe upasargakrtam etat yena atra vrajikriy gamyate . pra ayam drpacra dikarmai vartate . na ca idam na asti bahvarth api dhtava bhavanti iti . tat yath : vapi prakirae ra chedane api vartate : keamaru vapati iti . i stuticodanycsu dra prerae api vartate : agni vai ita vrim e maruta amuta cyvayanti iti . karoti abhtaprdurbhve dra nirmalkarae api vartate : prham kuru pcau , kuru . unmrdna iti gamyate . nikepae ca api vartate : kae kuru , ghae kuru , amnam ita kuru . sthpaya iti gamyate . evam iha api tihati eva vrajikriym
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (137 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

ha tihati eva vrajikriyy nivrttim . ayam tarhi doa : astibhavatividyatnm dhtutvam iti . (P_1,3.1.3) KA_I,256.18-258.6 Ro_II,185-192 yadi puna bhvavacana dhtu iti evam lakaam kriyeta . katham puna jyate bhvavacan pacdaya iti . yat em bhavatin smndhikarayam : bhavati pacati , bhavati pakyati , bhavati apkt iti . ka puna bhva . bhavate svapadrtha bhavanam bhva iti . yadi bhavate svapadrtha bhavanam bhva vipratiiddhnm dhtusaj na prpnoti : bheda , cheda . anya hi bhva anya hi abhva . ta ca anya bhva anya abhva iti . ya hi yasya bhvam icchati sa na tasya abhvam yasya ca abhvam na tasya bhvam . pacdnm ca dhtusaj na prpnoti . yath hi bhavat kriyvacane dhtau karotin pacdnm smndhikarayam nidaritam na tath bhvavacane dhtau nidaryate . karoti paccnm sarvn kln sarvn purun sarvi ca vacanni anuvartate . bhavati puna vartamnaklam ca eva ekatvam ca . k tarhi iyam vcoyukti : bhavati pacati , bhavati pakyati , bhavati apkt iti . e e vcoyukti : pacdaya kriy bhavatikriyy kartrya bhavanti iti . yadi api tvat atra etat akyate vaktum yatra any ca any ca kriy yatra khalu s eva kriy tatra katham : bhavet api bhavet , syt api syt iti . atra api anyatvam asti . kuta . klabhedt sdhanabhedt ca . ekasya atra bhavate bhavati sdhanam sarvakla ca pratyaya . aparasya bhyam sdhanam vartamnakla ca pratyaya . yvat atra api anyatvam asti pacdaya ca kriy bhavatikriyy kartrya bhavanti iti astu ayam kartrsdhana : bhavati iti bhva iti . kim krtam bhavati . vipratiiddhnm dhtusaj siddh bhavati . bhavet vipratiiddhnm dhtusaj siddh syt prtipadiknm api prpnoti : vrka , plaka iti . kim kraam . etni api hi bhavanti . evam tarhi karmasdhana bhaviyati : bhvyate ya sa bhva iti . kriy ca eva hi bhvyate svabhvasiddham tu dravyam . evam api bhavet kem cit na syt yni na bhvyante . ye tu ete sambandhiabd tem prpnoti : mt pit bhrt iti . sarvath vayam prtipadikaparyudst na mucymahe . pahiyati hi crya : bhvdipha prtipadikapayatydinivrttyartha iti . yvat pahiyati pacdaya ca kriy bhavatikriyy kartrya bhavanti iti astu ayam kartrsdhana : bhavati iti bhva . kim vaktavyam etat . na hi . katham anucyamnam gasyate . etena eva abhihitam strea bhvdaya dhtava iti . katham . na idam digrahaam . vade ayam audika i kartrsdhana : bhuvam vadanti iti bhvdaya iti . bhvavacane tadarthapratyayapratiedha . bhvavacane dhtau tadarthasya pratyayasya pratiedha vaktavya : iye iti . kim ca syt . aiti iti ttvam prasajyeta . tat hi dhto vihitam . itaretarrayam ca pratyaye bhvavacanatvam tasmt ca pratyaya . itaretarrayam ca bhavati . k itaretarrayat . pratyaye bhvavacanatvam tasmt ca pratyaya . utpanne hi pratyaye bhvavacanatvam gamyate sa ca tvat bhvavacant utpanna . tat etat itaretarrayam bhavati . itaretarrayi ca na prakalpante . siddham tu nityaabdatvt anritya bhvavacanatvam pratyaya . siddham etat . katham . nity abd . nityeu ca abdeu anritya bhvavacanatvam pratyaya utpadyate . prathamabhvagrahaam ca . prathamabhvagrahaam ca kartavyam . prathamam ya bhvam ha iti . kuta puna prthamyam . kim abdata hosvit arthata . kim ca ata . yadi abdata sandnm dhtusaj na prpnoti : putryati vastryati iti . atha arthata siddh sandnm dhtusaj sa eva tu doa bhavati : bhvavacane tadarthapratyayapratiedha iti . evam tarhi na eva arthata na eva abdata . kim tarhi . abhidhnata . sumadhyame abhidhne ya prathamam
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (138 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

bhvam ha. (P_1,3.1.4) KA_I,258.7-21 Ro_II,193-196 iha ye eva bhvavacane dhtau do te eva kriyvacane api . tatra te eva parihr . tatra idam aparihrtam : astibhavatividyatnm dhtutvam iti . tasya parihra . km puna kriym bhavn matv ha astibhavatividyatnm dhtusaj na prpnoti iti . kim yat tat devadatta kasaptrym pin odanam bhukte iti . na brma kraki kriy iti . kim tarhi . krakm pravrttiviea kriy . anyath ca kraki ukaudane pravartante anyath ca msaudane . yadi evam siddh astibhavatividyatnm dhtusaj . anyath hi kraki astau pravartante anyath hi mriyatau . a bhvavikr iti ha sma ha bhagavn vryyai : jyate asti vipariamate vardhate apakyate vinayati iti . sarvath sthita iti atra dhtusaj na prpnoti . bhya hi ebhya tihati . evam tarhi kriyy kriy nivartik bhavati dravyam dravyasya nivartakam . evam hi ka cit kam cit prcchati . kimavastha devadattasya vydhi iti . sa ha : vardhate iti . apara ha : apakyate iti . apara ha : sthita iti . sthita iti ukte vardhate ca apakyate ca nivrtti bhavati . atha v na antarea kriym bhtabhaviyadvartamn kl vyajyante . astydibhi ca api bhtabhaviyadvartamn kl vyajyante . atha v na anyat prena anyat khyeyam . tena na bhaviyati kim karoti asti iti . (P_1,3.1.5) KA_I,258.22-259.14 Ro_II,196-198 atha yadi eva kriyvacana dhtu iti ea paka atha api bhvavacana dhtu kim gatam etat iyat strea hosvit anyatarasmin pake bhya stram kartavyam . gatam iti ha . katham . ayam diabda asti eva vyavasthym vartate . tat yath : devadattdn samupavin ha : devadattdaya nyantm iti . te utthpya nyante . asti prakre vartate . tat yath : devadattdaya hy abhirp darany pakavanta . devadattaprakr iti gamyate . pratyekam ca diabda parisampyate . bhvdaya iti ca vdaya iti ca . tat yad tvat kriyvacana dhtu iti ea paka tad bh iti atra ya diabda sa vyavasthym vartate v iti atra ya diabda sa prakre . bh iti evamdaya v iti evamprakr iti . yad tu bhvavacana dhtu iti ea paka tad v iti atra ya diabda sa vyavasthym bh iti atra ya diabda sa prakre . v iti evamdaya bh iti evamprakr iti . yadi tarhi lakaam kriyate na idnm pha kartavya . kartavya ca . kim prayojanam . bhvdipha prtipadikapayatydinivrttyartha . bhvdipha kartavya . kim prayojanam . prtipadikapayatydinivrttyartha . prtipadikanivrttyartha apayatydinivrttyartha ca . ke puna apayatydaya . apayati vaati vahati iti . svarnubandhajpanya ca . svarnubandhajpanya ca pha kartavya : svarn anubandhn ca jsymi iti . na hi antarea ptham svar anubandh v aky vijtum . ye tu ete nyyyavikara udtt ananubandhak pahyante etem pha akya akartum . etem api avayam apayatydinivrttyartha pha kartavya . na kartavya . iaprayogt apayatydnm nivrtti bhaviyati . sa ca avayam iaprayoga upsya ye api pahyante tem api viparysanivrttyartha . loke hi kryarthe kasim prayujate dryarthe ca diim . (P_1,3.2.1) KA_I,259.16-23 Ro_II,198-199 upadee iti kimartham . abhre m apa : uddee ya anunsika tasya m bht iti . ka puna uddeopadeayo viea . pratyakam khynam upadea , guai prpaam uddea . pratyakam tvat khynam upadea . tat yath : agojya ka cit gm sakhthani kare v grhtv upadiati : ayam gau iti . sa
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (139 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

pratyakam khytam ha : upadia me gau iti . guai prpaam uddea . tat yath : ka cit kam cit ha : devadattam me bhavn uddiatu iti . sa ihastha paliputrastham devadattam uddiati : agad kual kir vyhoraska vrttabhu lohitka tugansa citrbharaa dra devadatta iti . sa guai prpyamam ha : uddia me devadatta iti . (P_1,3.2.2) KA_I,259.24-261.3 Ro_II,199-202 itsajym sarvaprasaga aviet . itsajym sarvaprasaga . sarvasya anunsikasya itsaj prpnoti . asya api prpnoti : abhre m apa . kim kraam . aviet . na hi ka cit viea : updyate evajtyakasya anunsikasya itsaj bhavati iti . anupdyamne viee sarvaprasaga . kim ucyate anupdyamne viee iti . katham na nma updyate yad upadee iti ucyate . lakaena hi upadea . sakrau uddeopadeau . pratyakam khynam uddea guai ca prpaam upadea . pratyakam tvat khynam uddea . tat yath : ka cit kam cit ha : anuvkam me bhavn uddiatu iti . sa tasmai cae : ietvakam adhva . annodevyam adhva iti . sa pratyakam khytam ha : uddia me anuvka . tam adhyeye iti . guai ca prpaam upadea . tat yath : ka cit kam cit ha : grmantaram gamiymi . panthnam me bhavn upadiatu iti . sa tasmai cae : amumin avake hastadakia grahtavya , amumin hastavma iti . sa guai prpyamam ha : upadia me panth iti . evam etau sakrau uddeopadeau . evam tarhi itkrybhvt itsaj na bhaviyati . nanu ca lopa eva itkryam syt . akryam lopa . iha hi abdasya dvyartha upadea . kryrtha v bhavati upadea ravartha v . kryam ca iha na asti . krye ca asati yadi ravaam api na syt upadea anarthaka syt . idam asti itkryam : abhre m aita : anantaralakaym itsajym satym dita ca iti ipratiedha prasajyeta . siddham tu upadeane anunsikavacant . siddham etat katham . upadeane ya anunsika sa itsaja bhavati iti vaktavyam . kim puna upadeanam . stram . sidhyati . stram tarhi bhidyate . yathnysam eva astu . nanu ca uktam itsajym sarvaprasaga aviet iti . na ea doa . upadea iti gha ayam karaasdhana . na sidhyati . paratvt lyu prpnoti . na brma akartari ca krake sajym iti . kim tarhi . hala ca iti . tatra api sajym iti vartate . na ca e saj . pryavacant asajym api bhaviyati . pryavacant sajym eva syt v na v . na hi updhe updhi bhavati vieaasya v vieaam . yadi na updhe updhi bhavati vieaasya v vieaam kalyydnm ina kulay v ina vibh na prpnoti . ina eva atra pradhnam . vihita pratyaya prakrta ca anuvartate . iha tarhi : vkindnm kuk ca putrt anyatarasym iti kuk vibh na prpnoti . atra api kuk eva pradhnam . vihita pratyaya prakrta ca anuvartate . evam na ca idam akrtam bhavati na updhe updhi bhavati vieaasya v vieaam iti na ca ka cit doa bhavati . evam ca krtv gha na prpnoti . evam tarhi krtyalyua bahulam iti evam atra gha bhaviyati . (P_1,3.3.1) KA_I,261.5-15 Ro_II,202-203 halantye sarvprasaga sarvntyatvt . halantye sarvprasaga . sarvasya hala itsaj prpnoti . kim kraam . sarvntyatvt . sarva hi hal tam tam avadhim prati antya bhavati . siddham tu vyavasitntyatvt . siddham etat . katham . vyavasitntyatvt . vyavasitntya hal itsaja bhavati iti vaktavyam . ke puna vyavasit . dhtuprtipadikapratyayaniptgamde . sidhyati . stram tarhi bhidyate . yathnysam
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (140 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

eva astu . nanu ca uktam halantye sarvprasaga sarvntyatvt iti . na ea doa . ha ayam hal antyam itsajam bhavati iti . sarva ca hal tam tam avadhim prati antya bhavati . tatra prakaragati vijsyate : sdhya ya antya iti . ka ca sdhya . ya vyavasitntya . atha v speka ayam nirdea kriyate . na ca anyat kim cit apekyam asti . te vyavasitam eva apekiymahe . (P_1,3.3.2) KA_I,261.16-262.3 Ro_II,203-205 lakrasya anubandhjpitatvt halgrahaprasiddhi . lakrasya anubandhatvena ajpitatvt halgrahaprasiddhi . hal antyam itsajam bhavati iti ucyate . lakrasya eva tvat itsaj na prpnoti . siddham tu lakranirdet . siddham etat . katham . lakranirdea kartavya . hal antyam itsajam bhavati lakra ca iti vaktavyam . ekaeanirdet v . atha v ekaeanirdea ayam . hal ca hal ca hal . hal antyam itsajam bhavati iti . atha v lkrasya eva idam guabhtasya grahaam . tatra upadee ac anunsika it iti itsaj bhaviyati . atha v cryapravrtti jpayati bhavati lakrasya itsaj iti yat ayam alam litam karoti . (P_1,3.3.3) KA_I,262.4-17 Ro_II,205-207 prtipadikapratiedha akrttaddhite . akrttaddhitntasya prtipadikasya pratiedha vaktavya . udavit akr iti . akrttaddhitntasya iti kimartham . kumbhakra nagarakra aupagava kpaava . idarthbhvt siddham . itkrybhvt atra itsaja na bhaviyati . idam asti itkryam titsvaritam iti svaritatvam yath syt . na etat asti . pratyayagrahaam tatra codayiyati . idam tarhi : rj tak . niti dyudttatvam yath syt . niti iti ucyate . tatra vyapavargbhvt na bhaviyati . idam tarhi sva . upottamam riti ea svara yath syt . svaritakaraasmarthyt na bhaviyati . nyasvarau svritau iti . iha tarhi anta . uttamaabda triprabhrtiu vartate . na ca atra triprabhrtaya santi . iha tarhi sanuta . upottamam riti iti ea svara yath syt . antodttaniptanam kariyate . sa ca niptasvara ritsvarasya bdhaka bhaviyati . etat ca atra yuktam yat itkrybhvt itsaj na syt . yatra itkryam bhavati bhavati tatra itsaj . tat yath gastyakauinyayo agastikuinac . (P_1,3.4) KA_I,262.19-263.9 Ro_II,207-209 vibhaktau tavargapratiedha ataddhite . vibhaktau tavargapratiedha ataddhite iti vaktavyam . iha m bht . kima at kve prepsan dpyase kva ardhams iti . sa tarhi pratiedha vaktavya . na vaktavya . cryapravrtti jpyati na vibhaktau taddhite pratiedha bhavati iti yat ayam idama thamu iti makrasye itsajparitrrtham ukram anubandham karoti . yadi etat jpyate idnm iti atra api prpnoti . itkrybhvt atra itsaj na bhaviyati . idam asti itkryam mit aca antyt para iti acm antyt para yath syt . ibhve krte na asti viea mit aca antyt para iti v paratve pratyaya para iti v . sa eva tvat ibhva na prpnoti . kim kraam . prk dia pratyayeu iti ucyate . ka puna arhati ibhvam prg dia pratyayeu vaktum . kim tarhi . prk dia artheu ibhva kisarvanmabahubhya advydibhya pratyayotpatti . evam tarhi tada api ayam vaktavya . tada ca mit aca antyt paratvena na sidhyati . nanu ca atra api atve krte na asti viea mit aca antyt para iti v paratve pratyaya para iti v . tat hi attvam na prpnoti . kim kraam . vibhaktau iti ucyate . evam tarhi yakrnta dnm kariyate . kim yakra na ryate . luptanirdia yakra . (P_1,3.7.1) KA_I,263.11-18 Ro_II,209 cucupcaapo cakrapratiedha . cucupcaapo

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (141 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

cakrasya pratiedha vaktavya . keacucu keacaa . itkrybhvt siddham . itkrybhvt atra itsaj na bhaviyati . idam asti itkryam cita anta udtta bhavati iti antodttatvam yath syt . pitkaraam idnm kimartham syt . pitkaraam kimartham iti cet paryyrtham . pitkaraam kimartham iti cet paryyrtham etat syt . evam tarhi yakrd cucupcaapau . kim yakra na ryate . luptanirdia yakra . (P_1,3.7.2) KA_I,263.19-264.10 Ro_II,210-211 ira upasakhynam . ira upasakhynam kartavyam : rudhir : arudhat , arautst . avayavagrahat siddham . rephasya atra halantyam iti itsaj bhaviyati ikrasya upadee ac anunsika iti . avayavagrahat iti cet ididvidhiprasaga . avayavagrahat iti cet ididvidhiprasaga prpnoti . bhett chett . idita num dhto iti num prpnoti . yadi puna ayam ididvidhi kumbhdhnyanyyena vijyeta . tat yath . kumbhdhnya rotriya iti ucyate . yasya kumbhym eva dhnyam sa kumbhdhnya . yasya puna kumbhym ca anyatra ca na asau kumbhdhnya . na ayam ididvidhi kumbhdhnyanyyena akya vijtum . iha hi doa syt . unadi nandathu iti . evam tarhi na evam vijyate ikra it yasya sa ayam idit tasya idita iti . katham tarhi . ikra eva it idit ididantasya iti . atha v rkrasya eva idam irtvabhtasya grahaam . tatra upadee ac anunsika it iti itsaj bhaviyati . atha v cryapravrtti jpayati na evajtyaknm ididvidhi bhavati iti yat ayam irita kn cit numanuaktn pahati . ubundir nimane . skandir gatioaayo . atha v cryapravrtti jpayati irabdasya itsaj bhavati iti yat ayam irita v iti ha . atha v ante iti vartate . (P_1,3.9.1) KA_I,264.12-20 Ro_II,211-212 tasyagrahaam kimartham . itsajaka pratinirdiyate . na etat asti prayojanam . prakrtam it iti vartate . kva prakrtam . upadee ac anunsika it iti . tat vai prathamnirdiam ahnirdiena ca iha artha . artht vibhaktiviparima bhaviyati . tat yath . uccni devadattasya grhi . mantrayasva enam . devadattam iti gamyate . devadattasya gva av hirayam iti . hya vaidhaveya . devadatta iti gamyate . purastt ahnirdiam sat artht dvitynirdiam prathamnirdiam ca bhavati . evam iha api purastt prathamnirdiam sat artht ahnirdiam bhaviyati . idam tarhi prayojanam . ye anekla itsaj tem lopa sarvdea yath syt . atha kriyame api ca tasyagrahae katham iva lopa sarvdea labhya . labhya iti ha . kuta . vacanaprmyt . tasyagrahaasmarthyt . (P_1,3.9.2) KA_I,264.21-265.17 Ro_II,212-214 ita lope alktvnihsu upasakhynam itpratiedht . ita lope alktvnihsu upasakhynam kartavyam . al . aham papaca . ktv . devitv sevitv . nih . ayita ayitavn . kim puna kraam na sidhyati . itpratiedht . pratiidhyate atra itsaj . al uttama it v bhavati . ktv se na kit bhavati . nih se na kit bhavati iti . siddham tu aldnm grahaapratiedht . siddham etat . katham . aldnm grahani pratiidhante . al uttama v idgrahaena grhyate . ktv se na kidgrahaena grhyate . nih se na kidgrahaena grhyate iti . nirdialopt v . nirdialopt v siddham eva . atha v nirdiasya ayam lopa kriyate . tasmt siddham etat . tatra tusmnm pratiedha . tatra tusmnm pratiedha vaktavya . tasmt tasmin yasmt yasmin vrk plak acinavam asunavam akaravam . na v uccraasmarthyt . na v vaktavya . kim kraam . uccraasmarthyt atra lopa na bhaviyati . anubandhalope bhvbhvayo vipratiedht aprasiddhi . anubandhalope bhvbhvayo virodht
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (142 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

aprasiddhi . na jyate kena abhipryea prasajati kena nivrttim karoti iti . siddham tu apavdanyyena . siddham etat . katham . apavdanyyena . kim puna iha tath yath utsargpavdau . bhva hi kryrtha nanyrtha lopa . kryam kariymi iti anubandha sajyate kryd anyan m bht iti lopa . (P_1,3.9.3) KA_I,265.18-267.6 Ro_II,214-217 atha yasya anubandha sajyate kim sa tasya eknta bhavati hosvit aneknta . eknta tatra upalabdhe . eknta iti ha . kuta . tatra upalabdhe . tatrastha hi asau upalabhyate . tat yath vrkasth kh vrkaiknt upalabhyate . tatra asarpasarvdeadppratiedhe prthaktvanirdea ankrntatvt . tatra asarpavidhau doa bhavati . karmai a ta anupasarge ka iti . kaviaye a api prpnoti . sarvdee ca doa bhavati . diva aut sarvdea prpnoti . dppratiedhe prthaktvanirdea kartavya . adbdaipau iti vaktavyam . kim puna kraam na sidhyati . ankrntatvt . nanu ca ttve krte bhaviyati . tat hi ttvam na prpnoti . kim kraam . anejantatvt . astu tarhi aneknta . aneknte vrttiviea . yadi aneknta vrttiviea na sidhyati . kiti iti iti kryi na sidhyanti . kim hi sa tasya it bhavati yena itkrtam syt . evam tarhi anantara . anantara iti cet prvaparayo itkrtaprasaga . anantara iti cet prvaparayo itkrtam prpnoti . vucha . siddham tu vyavasitapht . siddham etat . katham . vyavasitapha kartavya . vu cha . sa ca avayam vyavasitapha kartavya . itarath hi eknte api sandeha . akriyame vyavasitaphe eknte api sandeha syt . tatra na jyate kim ayam prvasya bhavati hosvit parasya iti . sandehamtram etat bhavati . sarvasandeheu ca idam upatihate vykhynata vieapratipatti na hi sandeht alakaam iti . prvasya iti vykhysyama . vrttt v . vrttt v puna siddham etat . vrddhimantam dyudttam drv it iti vyavaseyam . antodttam drv kit iti . yuktam puna yat vrttinimittaka anubandha syt na anubandhanimittakena nma vrttena bhavitavyam . vrttinimittaka eva anubandha . vrttija hi crya anubandhn sajati . ubhayam idam anubandheu uktam eknt aneknt iti . kim atra nyyyam . eknt iti nyyyam . kuta etat . atra hi hetu vyapadia . yat ca nma sahetukam tat nyyyam . nanu ca uktam tatra asarpasarvdeadppratiedhe prthaktvanirdea ankrntatvt iti . asarpavidhau tvat na doa . cryapravrtti jpayati na anubandhakrtam asrpyam bhavati iti yat ayam dadtidadhtyo vibh iti vibh am sti . yat api uktam sarvdee iti . atra api cryapravrtti jpayati na anubandhakrtam anekltvam bhavati iti yat ayam it sarvasya iti ha . yat api uktam dppratiedhe prthaktvanirdea kartavya iti . na kartavya . cryapravrtti jpayati na anubandhakrtam anejantatvam bhavati iti yat ayam udcm ma vyathre iti mea snubandhakasya ttvabhtasya grahaam karoti . (P_1,3.10.1) KA_I,267.8-13 Ro_II,218 kim iha udharaam . ika ya aci . dadhi atra madhu atra . na etat asti . sthne antaratamena api etat siddham . kuta ntaryam . tlusthnasya tlusthna ohasthnasya ohasthna bhaviyati iti . idam tarhi . tasthasthamipm tmtamtma iti . nanu ca etat api sthne antaratamena eva siddham . kuta ntaryam . ekrthasya ekrtha dvyarthasya dvyartha bahvarthasya bahvartha bhaviyati iti . idam tarhi tdaltruavarmatkcavrt hakchahayaka iti . (P_1,3.10.2) KA_I,267.14-268.2 Ro_II,218-220 kimartham puna idam ucyate . sajsamsanirdet sarvaprasaga anudeasya yathsakhyavacanam niyamrtham .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (143 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

sajay samsai ca nirde kriyante . sajay tvat . parasmaipadnm alatususthalathusaalvam iti . samsai . tdalturavarmatkcavrt hakchahayaka iti . sajsamsanirdet sarvaprasaga anudeasya yathsakhyavacanam niyamrtham . sarvasya uddeasya sarva anudea prpnoti . iyate ca samasakhyam yath syt iti . tat ca antarea yatnam na sidhyati iti tatra yathsakhyavacanam niyamrtham . evamartham idam ucyate . kim puna kraam sajay samsai ca nirde kriyante . sajsamsanirdea lprthak vibhaktisajyanuccrartha . sajay samsai ca nirde kriyanteprthak vibhakt sajina ca m uccicram iti . prakarae ca sarvasampratyayrtha . prakarae ca sarvem sampratyaya yath syt . vida laa v iti . (P_1,3.10.3) KA_I,268.3-271.17 Ro_II,220-227 kim puna abdata smye sakhytnudea bhavati hosvit arthata . ka ca atra viea . sakhysmyam abdata cet aldaya parasmaipadnm raurasa prathamasya ayavyva eca iti anirdea . agamaka nirdea anirdea . parasmaipadnm alatususthalathusaalvam iti aldaya bahava parasmaipadnm iti eka abda . vaiamyt sakhytnudea na prpnoti . raurasa prathamasya . raurasa bahava prathamasya iti eka abda . vaiamyt sakhytnudea na prpnoti . eca ayavyva . ayavyva bahava eca iti eka abda . vaiamyt sakhytnudea na prpnoti . astu tarhi arthata . arthata cet lrluornandyarhaasindhutakaildiu doa . lrluornandyarhaasindhutakaildiu doa bhavati . syatslrluo . syats dvau lrluo iti asya traya arth . vaiamyt sakhytnudea na prpnoti . nandigrahipacdibhya lyuinyaca . nandydaya bahava lyuinyaca traya . vaiamyt sakhytnudea na prpnoti . arhadaya bahava vudaya saptadaa . vaiamyt sakhytnudea na prpnoti . sindhutakaildibhya aaau . sindhutakaildaya bahava aaau dvau . vaiamyt sakhytnudea na prpnoti . tmanepadavidhinihsrvadhtukadvigrahaeu . tmanepadavidhinihsrvadhtukadvigrahaeu ca doa bhavati . tmanepadavidhi ca na sidhyati . anudttaita tmanepadam . anudttaitau dvau tmanepadam iti asya dvau arthau . tatra sakhytnudea prpnoti . nih . radbhym nihta na prvasya ca da iti . rephadakrau dvau nih iti asya dvau arthau . tatra sakhytnudea prpnoti . srvadhtukadvigrahaeu ca doa bhavati . naso allopa namast dvau srvadhtukam iti asya dvau arthau . tatra sakhytnudea prpnoti . ea prvatve pratiedha . ea prvatve pratiedha vaktavya . ea padntt ati asiaso ca . asiasau dvau e iti asya dvau arthau . tatra sakhytnudea prpnoti . astu tarhi abdata . nanu ca uktam sakhysmyam abdata cet aldaya parasmaipadnm raurasa prathamasya ayavyva eca iti anirdea iti . na ea do . sthne antaratama iti anena vyavasth bhaviyati . kuta ntaryam . ekrthasya ekrtha dvyarthasya dvyartha bahvarthasya bahvartha . savrtvarasya savrtvara vivrtvarasya vivrtvara . atiprasaga guavrddhipratiedhe kiti . atiprasaga bhavati guavrddhipratiedhe kiti . guavrddh dve kitau dvau . tatra sakhytnudea prpnoti . na ea doa . gakra api atra nirdiyate . tat gakragrahaam api kartavyam . na kartavyam . kriyate nyse eva . kakre gakra cartvabhta nirdiyate . giti kiti iti iti . udi kle rujivaho . udikle dve rujivahau dvau . tatra sakhytnudea prpnoti . na ea doa . na udi upapadam . kim tarhi . vieaam
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (144 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

rujivaho . utprvbhym rujivahibhym kle upapade iti . tacchldiu dhtutrigrahaeu . tacchldiu dhtutrigrahaeu doa bhavati . vidibhidicchide kurac . vidibhidicchidaya traya tacchldaya traya . tatra sakhytnudea prpnoti . ghadiu dvigrahaeu . ghadiu dvigrahaeu doa bhavati . nirabhyo plvo . nirabh dvau plvau dvau . tatra sakhytnudea prpnoti . na ea doa . iyate ca atra sakhytnudea : nipva , abhilva iti . evam tarhi akartari ca krake bhve ca iti dvau plvau ca dvau . tatra sakhytnudea prpnoti . ave trstro karadhikaraayo . trstrau dvau karadhikarae dve . tatra sakhytnudea prpnoti . kartrkarmao ca bhkro . kartrkarma dve bhkrau dvau . tatra sakhytnudea prpnoti . anavaklptyamarayo akivrtte api . anavaklptyamarau dvau kivrttkivrtte dve . tatra sakhytnudea prpnoti . krbhvo ktvamulau . krbhvau dvau ktvamulau dvau . tatra sakhytnudea prpnoti . adhynaviduo chandobrhmani . chandobrhmani iti dve adhte veda iti ca dvau . tatra sakhytnudea prpnoti . ropadheto pathidtayo . ropadheto prcm tat gacchati pathidtayo . ropadhetau dvau pathidtau dvau . tatra sakhytnudea prpnoti . tatra bhavata tasya vykhyna kratuyajebhya . tatra bhavatastasyavykhynau dvau kratuyajau dvau . tatra sakhytnudea prpnoti . saghdiu aprabhrtaya aghdiu aprabhrtaya sakhytnudeena na sidhyanti . na ea doa . ghoagrahaam atra kartavyam . veoyaade bhagt yalkhau . veoyaad dvau yalkhau dvau . tatra sakhytnudea prpnoti . asiaso khyatyt parasya . asiasau dvau khyatyau dvau . tatra sakhytnudea prpnoti . na v samnayogavacant . na v ea doa . kim kraam . samnayogavacant . samnayoge sakhytnudeam vakymi . tasya doa vida laa v . tasya etasya lakaasya doa vida laa v iti sakhytnudea na prpnoti . dhmdheto nmuyo ca . dhmdheto nmuyo ca sakhytnudea na prpnoti . khalagoratht initrakayaca ca . sakhytnudea na prpnoti . sindhvapakarbhym kan aaau ca . sakhytnudea na prpnoti . yumadasmado ca de . yumadasmado ca de sakhytnudeena na sidhyanti . tasmt yasmin pake alpysa do tm sthya pratividheyam doeu . atha v evam vakymi . yathsakhyam anudea samnm svaritena . tata adhikra . adhikra ca bhavati svaritena iti . evam api svaritam drv sandeha syt . na jyate kim ayam samasakhyrtha hosvit adhikrrtha iti . sandehamtram etat bhavati . sarvasandeheu ca idam upatihate vykhynata vieapratipatti na hi sandeht alakaam iti samasakhyrtha iti vykhysyma . (P_1,3.11.1) KA_I,271.19-272.10 Ro_II,228-229 kimartham idam ucyate . adhikra pratiyogam tasya anirdertha . adhikra kriyate pratiyogam tasya anirdertha iti . kim idam pratiyogam iti . yogam yogam prati pratiyogam . yoge yoge tasya grahaam m kram iti . kim gatam etat iyat strea . gatam iti ha . kuta . lokata . tat yath loke adhikrta asau grme adhikrta asau nagare iti ucyate ya yatra vypram gacchati . abdena ca api adhikrtena ka anya vypra akya avagantum anyat ata yoge yoge upasthnt . na v nirdiyamndhikrtatvt yath loke . na v etat prayojanam . kim kraam . nirdiyamndhikrtatvt yath loke . nirdiyamnam adhikrtam gamyate . tat yath . devadattya gau dyatm yajadattya viumitrya iti . gau iti gamyate . evam iha api padarujaviaspra gha sr sthire bhve . gha iti gamyate . anyanirdea tu nivartaka
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (145 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

tasmt paribh . anyanirdea tu loke nivartaka bhavati . tat yath . devadattya gau dyatm yajadattya kambala viumitrya ca iti . kambala gonivartaka bhavati . evam iha api abhividhau bhve inu ghaa nivartaka syt . tasmt paribh kartavy . (P_1,3.11.2) KA_I,272.11-273.5 Ro_II,229-230 adhikraparimjnam tu . adhikraparimjnam tu bhavati . na jyate kiyantam avadhim adhikra anuvartate iti . adhikraparimajnrtham tu . adhikraparimajnrtham eva tarhi ayam yoga vaktavya . adhikraparimam jsymi iti . katham puna svaritena adhikra iti anena adhikraparimam akyam vijtum . evam vakymi svarite na adhikra iti . svaritam drv adhikra na bhavati iti . kena idnm adhikra bhaviyati . laukika adhikra . na adhikra iti cet uktam . kim uktam . anyanirdea tu nivartaka tasmt paribh iti . adhikrrtham eva tarhi ayam yoga vaktavya . nanu ca uktam adhikraparimjnam tu iti . yvatitha al anubandha tvata yogn iti vacant siddham . yvatitha al anubadhyate tvata yogn adhikra anuvartate iti vaktavyam . atha idnm yatra alpysa ala bhyasa ca yogn adhikra anuvartate katham tatra kartavyam . bhyasi prgvacanam . bhyasi prgvacanam kartavyam . prk amuta iti vaktavyam . tat tarhi vaktavyam . na vaktavyam . sandehamtram etat bhavati . sarvasandeheu ca idam upatihate vykhynata vieapratipatti na hi sandeht alakaam iti . prk amuta iti vykhysyma . yadi evam na artha anena . kena idnm adhikra bhaviyati . laukika adhikra . nanu ca uktam na adhikra iti cet uktam . kim uktam . anyanirdea tu nivartaka tasmt paribh . sandehamtram etat bhavati . sarvasandeheu ca idam upatihate vykhynata vieapratipatti na hi sandeht alakaam iti . inu gha iti sandehe gha iti vykhysyma . (P_1,3.11.3) KA_I,273.6-25 Ro_II,230-232 na tarhi idnm ayam yoga vaktavya . vaktavya ca . kim prayojanam . svaritena adhikragati yath vijyeta , adhikam kryam , adhika kra . adhikragati : gostriyo upasarjanam iti atra gograhaam coditam . tat na kartavyam bhavati . strgrahaam svarayiyate . svaritena adhikragati bhavati iti striym iti evam prakrtya ye pratyay vihit tem grahaam vijsyate . tatra svaritena adhikragati bhavati iti na doa bhavati . adhikam kryam : apdnam crya kim nyyyam manyate . yatra prpya nivrtti . tena iha eva syt : grmt gacchati . nagart gacchati . skyakebhya paliputrak abhirpatar iti atra na syt . svaritena adhikarm kryam bhavati iti atra api siddham bhavati . tath adhikaraam crya kim nyyyam manyate . yatra krtsna dhrtm vypta bhavati . tena iha eva syt : tileu tailam . dadhni sarpi iti . gagym gva . kpe gargakulam iti atra na syt . svaritena adhikarm kryam bhavati iti atra api siddham bhavati . adhikam kryam . adhika kra : prvavipratiedh na pahitavy bhavanti . guavrddhyauttvatrjvadbhvebhya num prvavipratiiddham numaciratrjvadbhvebhya nu iti . numnuau svarayiyete . tatra svaritena adhika kra bhavati iti numnuau bhaviyata . katham puna adhika kra iti anena prvavipratiedh akya na pahitum . lokata . tat yath loke adhikam ayam kram karoti iti ucyate ya ayam durbala san balavadbhi saha bhram vahati . evam iha api adhikam ayam kram karoti iti ucyate ya ayam prva san param bdhate . adhikragati stryarth vieya adhikam kryam . atha ya anya adhika kra prvavipratiedhrtha sa . (P_1,3.12.1) KA_I,274.2-11 Ro_II,233 vikaraebhya pratiedha vaktavya . cinuta

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (146 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

sunuta lunta punta . ita iti tmanepadam prpnoti . na ea doa . na evam vijyate akra it asya sa ayam it ita iti . katham tarhi . akra eva it it ita . atha v upadee iti vartate . atha v uktam etat siddham tu prvasya krytidet iti . sarvath caabhym prpnoti . evam tarhi dhto iti vartate . kva prakrtam . bhvdaya dhtava iti . tat vai prathamnirdiam pacamnirdiena ca iha artha . artht vibhaktiviparima bhaviyati . tat yath . uccni devadattasya grhi . mantrayasva enam . devadattam iti gamyate . devadattasya gva av hirayam iti . hya vaidhaveya . devadatta iti gamyate . purastt ahnirdiam sat artht dvitynirdiam prathamnirdiam ca bhavati . evam iha api purastt prathamnirdiam sat artht pacamnirdiam bhaviyati . (P_1,3.12.2) KA_I,274.11-275.15 Ro_II,233-237 kimartham puna idam ucyate . tmanepadavacanam niyamrtham . niyamrtha ayam rambha . kim ucyate niyamrtha ayam iti na puna vidhyartha api syt . lavidhnt vihitam . lavidhnt hi tmanepadam parasmaipadam ca vihitam . asti prayojanam etat . kim tarhi iti . vikaraai tu vyavahitatvt niyama na prpnoti . idam iha sampradhryam . vikara kriyantm niyama iti . kim atra kartavyam . paratvt vikara . nity khalu api vikara . krte api niyame prpnuvanti akrte api prpnuvanti . nityatvt paratvt ca vikaraeu krteu vikaraai vyavahitatvt niyama na prpnoti . na ea doa . anavaka niyama . svaka . ka avaka . ye ete lugvikara luvikara liliau ca . yadi puna iyam paribh vijyeta . kim krtam bhavati . kryaklam sajparibham yatra kryam tatra draavyam . lasya tibdaya bhavanti iti upasthitam idam bhavati anudttaita tmanepadam et kartari parasmaipadam iti . evam api itaretarrayam bhavati . k itaretarrayat . abhinirvrttnm lasya sthne tibdnm tmanepadaparasmaipadasajay bhavitavyam sajay ca tibdaya bhvyante . tat itaretarrayam bhavati . itaretarrayi kryi ca na prakalpante . parasmaipadeu tvat na itaretarrayam bhavati . parasmaipadnukramaam na kariyate . avayam kartavyam anuparbhym kra iti evamartham . nanu ca etat api tmanepadnukramae eva kariye . svaritaita kartrabhipraye kriyphale tmanepadam bhavati kartari . anuparbhym kra na iti . tmanepadeu ca api na itaretarrayam bhavati . katham . bhvin saj vijsyate straakavat . tat yath : ka cit kam cit tantuvyam ha : asya strasya akam vaya iti . sa payati . yadi aka na vtavya atha vtavya na aka . aka vtavya iti vipratiiddham. bhvin khalu asya saj abhipret . sa manye vtavya yasmin ute aka iti etat bhavati iti . evam iha api sa lasya sthne kartavya lyasya abhinirvrttasya tmanepadam iti e saj bhaviyati . atha v puna astu niyama . nanu ca utkam vikaraai tu vyavahitatvt niyama na prpnoti . na ea doa . cryapravrtti jpayati vikaraebhya niyama balyn iti yat ayam vikaraavidhau tmanepadaparasmaipadni rayati . pudidyutdlrdita parasmaipadeu tmanepadeu anyatarasym iti . na etat asti jpakam . abhinirvrttni hi lasya sthne tmanepadni parasmaipadni ca . yat tarhi anupasargt v iti vibhm sti . (P_1,3.12.3) KA_I,275.16-277.18 Ro_II,237-244 kim puna ayam pratyayaniyama : anudttaita eva tmanepadam bhavati , bhvakarmao eva tmanepadam bhavati iti . hosvit prakrtyarthaniyama : anudttaita tmanepadam eva , bhvakarmao tmanepadam eva . ka ca atra viea . tatra pratyayaniyame eavacanam
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (147 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

parasmaipadasya anivrttatvt . tatra pratyayaniyame eagrahaam kartavyam parasmaipadaniyamrtham . et kartari parasmaipadam iti . kim kraam . parasmaipadasya anivrttatvt . pratyay niyat prakrtyarthau aniyatau . tatra parasmaipadam prpnoti . tatra eagrahaam kartavyam parasmaipadaniyamrtham . et eva parasmaipadam bhavati na anyata iti . kyaa tmanepadavacanam tasya anyatra niyamt . kyaa tmanepadam vaktavyam . lohityati lohityate . kim puna kraam na sidhyati . tasya anyatra niyamt . tat hi anyatra niyamyate . ucyate ca na ca prpnoti . tat vacant bhaviyati . astu tarhi prakrtyarthaniyama . prakrtyarthaniyame anybhva . prakrtyarthaniyame anyem pratyaynm abhva . anudttaita trjdaya na prpnuvanti . na ea doa . anavak trjdaya ucyante ca . te vacant bhaviyanti . svak trjdaya . ka avaka . parasmaipadina avaka . tatra api niyamt na prpnuvanti . tavydaya tarhi bhvakarmao niyamt na prpnuvanti . tavydaya api anavak . te vacant bhaviyanti . ci tarhi bhvakarmao niyamt na prpnoti . ci api vacant bhaviyati . gha tarhi bhvakarmao niyamt na prpnoti . tatra api prakrtam karmagrahaam . kva prakrtam . a karmai ca iti . tat vai tatra upapadavieaam abhidheyavieaena ca iha artha . na ca anyrtham prakrtam anyrtham bhavati . na khalu api anyat prakrtam anuvartant anyat bhavati . na hi godh sarpant sarpat ahi bhavati . yat tvat ucyate na ca anyrtham prakrtam anyrtham bhavati iti anyrtham api prakrtam anyrtham bhavati at yath . lyartham kuly prayante tbhya ca pyam pyate upapryate ca laya ca bhvyante . yad api ucyate na khalu api anyat prakrtam anuvartant anyat bhavati . na hi godh sarpant sarpat ahi bhavati iti . bhavet dravyeu etat evam syt . abda tu khalu yena yena vieea abhisambadhyate tasya tasya vieaka bhavati . eavacanam ca . eagrahaam ca kartavyam . et kartari parasmaipadam iti . kim prayojanam . eaniyamrtham . prakrtarthau niyatau . pratyay aniyat . te ee api prpnuvanti . tatra eagrahaam kartavyam . et kartari parasmaipadam eva na anyat iti . kartari ca tmanepadaviaye parasmaipadapratiedhrtham . kartari ca tmanepadaviaye parasmaipadapratiedhrtham dvityam eagrahaam kartavyam . et ee iti vaktavyam . iha m bht . bhidyate kula svayam eva iti . katarasmin pake ayam doa . prakrtyarthaniyame . prakrtyarthaniyame tvat na doa . prakrtyarthau niyatau . pratyay aniyat . tatra na artha kartrgrahaena kartrgrahat ca doa . pratyayaniyame tarhi ayam doa . pratyay niyat . prakrtyarthau aniyatau . tatra kartrgrahaam kartavyam bhvakarmao nivrttyartham . kartrgrahat ca ea doa . prakrtyarthaniyame eagrahaam akyam akartum . katham . prakrtayarthau niyatau . pratyay aniyat . tata vakymi parasmaipadam bhavati iti . tat niyamrtham bhaviyati . yatra parasmaipadam ca anyat ca prpnoti tatra parasmaipadam eva bhavati iti . tat tarhi pratyayaniyame dvityam eagrahaam kartavyam . na kartavyam . yogavibhga kariyate . anudttaita tmanepadam . tata bhvakarmao . tata kartari . kartari ca tmanepadam bhavati bhvakarmao . tata karkmavyatihre . kartari iti eva . bhvakarmao iti nivrttam . yath eva tarhi karmai kartari bhavati evam bhve api kartari prpnoti . eti jvantam nanda . na asya kim cit rujati iti . dvitya yogavibhga kariyate . anudttaita tmanepadam . tata bhve . tata karmai . karmai ca tmanepadam bhavati . tata kartari . kartari ca tmanepadam bhavati . karmai iti anuvartate . bhve iti nivrttam . tata karmavyatihre . kartari iti eva . karmai iti nivrttam . evam api eagrahaam kartavyam anuparbhym kra
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (148 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

iti evamartham . iha m bht anukriyate svayam eva . parkriyate svayam eva . nanu ca etat api yogavibhgt eva siddham . na sidhyati . anantar y prpti s yogavibhgena aky bdhitum . kuta etat . anantarasya vidhi v bhavati pratiedha v iti . par prpti apratiiddh . tay bhaviyati . nanu ca iyam prpti prvm prptim bdhate . na utsahate pratiiddh sat bdhitum . evam tarhi kartari karmavyatihre iti atra kartrgrahaam pratykhyyate . tat prakrtam uttaratra anuvartiyate . et kartari kartari iti . kimartham idam kartari kartari iti . kart eva ya kart tatra yath syt . kart ca anya ca ya kart tatra m bht iti . tata anuparbhym kra . kartari kartari iti eva . (P_1,3.14.1) KA_I,277.20-278.6 Ro_II,244-245 kriyvyatirhre iti vaktavyam . karmavyatirhre iti ucyamne iha prasajyeta devadattasya dhnyam vyatilunanti iti iha ca na syt vyatilunate vyatipunate iti . tat tarhi vaktavyam . na vaktavyam . kriym hi loke karma iti upacaranti . km kriym kariyasi . kim karma kariyasi iti . evam api kartavyam . krtrimkrtrimayo krtrime sampratyaya bhavati . kriy api krtrimam karma . na sidhyati . kartu psitatamam karma iti ucyate . katham ca kriy nma kriyepsitatam syt . kriy api kriyepsitatam bhavati . kay kriyay . sampayatikriyay prrthayatikriyay adhyavasyatikriyay v . iha ya ea manuya prekprvakr bhavati sal buddhy tvat kam cit artham sampayati . sandre prrthan prrthite adhyavasya adhyavasye rambha rambhe nirvrtti nirvrttau phalvapti . evam kriy api krtrimam karma . evam api ubhayo krtrimkrtrimayo ubhayagati prasajyeta . tasmt kriyvyatihre iti vaktavyam . na vaktavyam . iha kartari vyatihre iti iyat siddham . sa ayam evam siddhe sati yat karmagrahaam karoti tasya etat prayojanam kriyvyatihre yath syt karmavyatihre m bht iti . (P_1,3.14.2) KA_I,278.7-21 Ro_II,246 atha kartrgrahaam kimartham . karmavyatihrdiu kartrgrahaam bhvakarmanivrttyartham . karmavyatihrdiu kartrgrahaam kriyate bhvakarmao anena tmanepadam m bht iti . itarath hi tatra pratiedhe bhvakarmao pratiedha . akriyame kartrgrahae bhvakarmao api tmanepadam prasajyeta . tatra ka doa . tatra pratiedhe bhvakarmao pratiedha . tatra ka doa . tatra pratiedhe bhvakarmao api anena tmanepadasya pratiedha prasajyeta . vyatigamyante grm vyatihanyante dasyava iti . na v anantarasya pratiedht . na v ea doa . kim kraam . anantarasya pratiedht . anantaram yat tmanepadavidhnam tasya pratiedht . kuta etat . anantarasya vidhi v bhavati pratiedha v iti . prv prpti apratiiddh tay bhaviyati . nanu ca iyam prpti prvm prptim bdhate . na utsahate pratiiddh sat bdhitum . uttarrtham tarhi kartrgrahaam kartavyam . na kartavyam . kriyate tatra eva et kartari parasmaipadam iti . dvityam kartrgrahaam kartavyam . kim prayojanam . kart eva ya kart tatra yath syt . karta ca anya ca ya kart tatra m bht iti . (P_1,3.15) KA_I,278.23-279.3 Ro_II,247 pratiedhe hasdnm upasakhynam . pratiedhe hasdnm upasakhynam kartavyam . vyatihasanti vayatijalpanti vyatipahanti . harivahyo apratiedha . harivahyo apratiedha bhavati iti vaktavyam . sampraharante rjna . savivahante gargai iti . na vahi gatyartha . dentaraprpaakriya vahi . (P_1,3.16) KA_I,279.5 Ro_II,248 prarasparopapadt ca . prarasparopapadt ca iti

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (149 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

vaktavyam . parasparasya vyatilunanti . parasparasya vyatipunanti . (P_1,3.19) KA_I,279.9-13 Ro_II,248-249 upasargagrahaam kartavyam . par jayati sen iti . tat tarhi vaktavyam . na vaktavyam . yadi api tvat ayam parabda drpacra upasarga ca anupasarga ca ayam tu khalu viabda adrpacra upasarga eva . tasya asya ka dvitya sahya bhavitum arhati anyat ata upasargt . tat yath asya go dvityena artha iti gau eva updyate na ava na gardabha . (P_1,3.20) KA_I,279.15-23 Ro_II,249-250 a da avyasanakriyasya . a da avyasanakriyasya iti vaktavyam . iha api yath syt . vipdikm vydadti . klam vydadti iti . tat tarhi vaktavyam . na vaktavyam . iha a da ansye iti iyat siddham . sa ayam evam siddhe sati yat viharaagrahaam karoti tasya etat prayojanam syaviharaasamnakriyt api yath syt . yathjtyak ca syaviharaakriy tathjtyak atra api . svgakarmt ca . svgakarmt ca iti vaktavyam . iha m bht . vydadate piplik patagamukham iti . (P_1,3.21) KA_I,280.2-20 Ro_II,251-253 upasargagrahaam kartavyam . iha m bht . anu krati mavakam . sama akjane . sama akjane iti vaktavyam . iha m bht . sakranti akani . game kamym . game kamym upasakhyanam kartavyam . gamayasva tvat mavka . ike jijsym . ike jijsym upasakhyanam kartavyam . vidysu ikate . dhanui ikate . kirate harajvikkulyakaraeu . kirate harajvikkulyakaraeu upasakhyanam kartavyam . apaskirate vrabha hra . apaskirate kukkua bhakrth . apaskirate v rayrth . harate gatatcchlye . harate gatatcchlye upasakhyanam kartavyam . paitrkam av anuharante . mtrkam gva anuharante . i nupracchyo . i nupracchyo upasakhyanam kartavyam . nute rgla . prcchate gurum . ii ntha . ii ntha upasakhyanam kartavyam . sarpia nthate . madhuna nthate . apa upalambhane . apa upalambhane upasakhyanam kartavyam . devadattya apate . yajadattya apate . (P_1,3.22) KA_I,280.22-24 Ro_II,253 a stha pratijne . a stha pratijne iti vaktavyam . astim sakram tihate . gamau guavrddh tihate . vikrau guavrddh tihate . (P_1,3.24) KA_I,281.2-3 Ro_II,253 uttihati sen iti . uda hym . uda hym iti vaktavyam . iha m bht .

(P_1,3.25) KA_I, 281.5-17 Ro_II,254 upt pjsagatakaraayo . upt pjsagatakaraayo iti vaktavyam . dityam upatihate . candramasam upatihate . sagatakarae . rathikn upatihate . avrohn upatihate . bahnm api acittnm eka bhavati cittavn . paya vnarasainye asmin yat arkam upatihate . m evam masth sacitta ayam ea api yath vayam . etat api asya kpeyam yat arkam upatihati . apara ha : upt devapjsagatakaraamitrakaraapathiu iti vaktavyam . sagatakarae udhrtam . mitrakarae . rathikn upatihate . avrohn upatihate . pathi. ayam panth srughnam upatihate . ayam panth sketam upatithate . v lipsym . v lipsym iti
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (150 of 190) [3/8/2008 12:51:12 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

vaktavyam . bhikuka brhmaakulam upatihate . bhikuka brhmaakulam upatihati v . (P_1,3.27) KA_I,281.19-282.5 Ro_II,255-256 akarmakt iti eva . ut tapati suvaram suvarakra . svgakarmakt ca . svgakarmakt ca iti vaktavyam . uttapate p . vitapate p . uttapate prham . vitapate prham . atha udbhibhym iti atra kim pratyudhriyate . niapyate iti . kim puna kraam tmanepadam eva udhriyate na parasmaipadam pratyudhryam syt . tapi ayam akarmaka . akarmak ca api sopasarg sakarmak bhavanti . na ca antarea karmakartram sakarmak akarmak bhavanti . yat ucyate na ca antarea karmakartram sakarmak akarmak bhavanti iti antarea api karmakartram sakarmak akarmak bhavanti . tat yath . nadvahati iti akarmaka . bhram vahati iti sakarmaka . tasmt niapati iti pratyudhartavyam . (P_1,3.28) KA_I,282.7-9 Ro_II,256 akarmakt iti eva . yacchati rajjum kpt . hanti vralam pdena . svgakarmakt ca . svgakarmakt ca iti vaktavyam . yacchate p . hate udaram iti . (P_1,3.29) KA_I,282.11-18 Ro_II,256-257 sama gamydiu vidipracchisvaratnm upasakhynam . sama gamydiu vidipracchisvaratnm upasakhynam kartavyam . savitte samprcchate sasvarate . artirudribhya ca . artirudribhya ca iti vaktavyam . ma samrta m samrtm m samrata . arti . ru . sarute . dri . sampayate . upasargt asyatyhyo vvacanam . upasargt astyhyo v iti vaktavyam . nirasyati nirasyate . samhati samhate . (P_1,3.40) KA_I,282.20-21 Ro_II,257 jyotim udgamane. jyotim udgamane iti vaktavyam . iha m bht . krmati dhma harmyatalam iti . (P_1,3.48) KA_I,283.2-11 Ro_II,257-258 vyaktavcm iti kimartham . varatanu sampravadanti kukku . vyaktavcm iti ucyamne api atra prpnoti . ete api hi vyaktavca . ta ca vyaktavca kukkuena udite ucyate kukkua vadati iti . evam tarhi vyaktavcm iti ucyate . sarve eva hi vyaktavca . tatra prakaragati vijsyate . sdhya ye vyaktavca iti . ke ca sdhya . yem vci akrdaya var vyajyante . na ca etem vci akrdaya var vyajyante . etem api vci akrdaya var vyajyante . ta ca vyajyante evam hi hu kukku kukku iti . na evam te hu . anukaraam etat tem . atha v na evam vijyate vyakt vk yem te ime vyaktavca iti . katham tarhi . vyakt vci var yem te ime vyaktavca iti . (P_1,3.51) KA_I,283.13-15 Ro_II,258 avd gra girate . avd gra iti atra girate iti vaktavyam . grte m bht . tat tarhi vaktavyam . na vaktavyam prayogbhvt . avt gra iti ucyate na ca prvasya grte prayoga asti . (P_1,3.54) KA_I,283.17-22 Ro_II,258-259 trtyyuktt iti kimartham . ubhau lokau cacarasi imam ca amum ca devala . trtyyuktt iti ucyamne api atra prpnoti . atra api hi trtyay yoga . evam tarhi trtyyuktt iti ucyate sarvatra ca trtyay yoga . tatra prakaragati
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (151 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

vijsyate : sdhya yatra trtyay yoga iti . kva ca sdhya . yatra trtyay yoga ryate . (P_1,3.55) KA_I,284.2-8 Ro_II,259-260 s cet trty caturthyarthe iti ucyate . katham nma trty caturthyarthe syt . evam tarhi aiavyavahre anena trty ca vidhyate tmanepadam ca . dsy samprayacchate . vraly sampracchate . ya hi iavyavahra brhmabhya samprayacchati iti eva tatra bhavitavyam . yadi evam na artha anena yogena . kena idnm trty bhaviyati tmanepadam ca . sahayukte trty syt vyatihre taa vidhi . sahayukte apradhne iti eva trty bhaviyati . kartari karmavyatihre iti tmanepadam . (P_1,3.56) KA_I,284.10-12 Ro_II,260 iha kasmt na bhavati . svam akntam upayacchati iti . asvam yad svam karoti tad bhavitavyam . yadi evam svkarae iti prpnoti . vicitr taddhitavrttaya . na ata taddhita utpadyate . (P_1,3.58) KA_I,284.14-285.2 Ro_II,260-261 ano ja pratiedhe sakarmakavacanam . ano ja pratiedhe sakarmakagrahaam kartavyam . iha ma bht . auadhasya anujijsate iti . na v akarmakasya uttarea vidhnt . na v kartavyam . kim kraam . akarmakasya uttarea vidhnt . akarmakt jante uttarea yogena tmanepadam vidhyate prvavat sana iti . pratiedha prvasya ca . prvasya ca ayam pratiedha . sa ca sakarmakrtha rambha . katham puna jyate prvaysa ayam pratiedha iti . anantarasya vidhi v bhavati pratiedha v iti . katham puna jyate sakarmakrtha rambha iti . akarmakt jnte sana tmanepadavacane prayojanam na asti iti krtv sakarmakrtha vijyate . (P_1,3.60.1) KA_I,285.4-21 Ro_II,261-263 ade ita parasmaipadrayatvt tmanepadbhva . ade ita parasmaipadrayatvt tmanepadasya abhva . yate yete yante . kim ca bho ade it parasmaipadeu iti ucyate . na khalu parasmaipadeu iti ucyate parasmaipadeu tu vijyate . katham anudttaita tmanepadam bhvakarmao tmanepadam iti etau dvau yogau uktv et kartari parasmaipadam ucyate . evam na ca parasmaipadeu ucyate parasmaipadeu ca vijyate . ka puna arhati etau dvau yogau uktv et kartari parasmaipadam vaktum . kim tarhi . avieea sarvam tmanepadaprakaraam anukramya et kartari parasmaipadam iti ucyate . evam api parasmaipadraya bhavati . katham . idam tvad ayam praavya . yadi idam na ucyeta kim iha syt iti . parasmaipadam iti ha . parasmaipadam iti cet parasmaipadraya bhavati . siddham tu ladnm tmanepadavacanam . siddham etat . katham . ade ladnm tmanepadam bhavati iti vaktavyam . sidhyati . stram tarhi bhidyate . yathnysam eva astu . nanu ca uktam ade ita parasmaipadrayatvt tmanepadbhva iti . na ea doa . ita iti na e pacam . k tarhi . sambandhaah . ita ya adi . ka ca ita adi . prakrti . ade itprakrte iti . atha v ha ayam ade ita iti na ca adi it asti . te evam vijsyma ade idviayt iti . atha v yadi api tvat etat anyatra bhavati vikaraebhya niyama balyn iti iha etat na asti . vikaraa hi iha ryate ita iti . (P_1,3.60.2) KA_I,285.22-287.5 Ro_II,263-268 upasargaprvaniyame avyavye upasakhynam . upasargaprvasya niyame avyavye upasakhynam kartavyam . nyaviata vyakrta . kim puna krat na sidhyati . a vyavahitatvt . nanu ca ayam a dhtubhakta dhtugrahaena grahyate . na sidhyati . agasya hi a ucyate vikarantam ca
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (152 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

agam . sa asau saghtabhakta na akya dhtugrahaena grahtum . evam tarhi idam iha sampradhryam : a kriyatm vikaraa iti . kim atra kartavyam . paratvt a gama . nity vikara . krte api ai prpnuvanti akrte api prpnuvanti . a api nitya . krteu api vikaraeu prpnoti akrteu api prpnoti . anitya a . anyasya krteu vikaraeu prpnoti anyasya akrteu . abdntarasya ca prpnuvan vidhi anitya bhavati . evam tarhi idam iha sampradhryam . a kriyatm ldea iti . kim atra kartavyam . paratvt a gama . nitya ldea . krte api ai prpnoti akrte api prpnoti . nityatvt ldeasya tmanepade eva agama bhaviyati . nityatvt ldeasya tmanepade a gama iti cet aa nityanimittatvt tmanepadbhva . nityatvt ldeasya tmanepade eva agama iti cet evam ucyate . a api nityanimitta . krte api ladee prpnoti akrte api prpnoti . aa nityanimittatvt tmanepadbhva . tasmt upasakhynam . tasmt upasakhynam kartavyam . na kartavyam . antaraga tarhi ldea . na etat vivadmahe antaraga na antaraga iti . astu ayam nitya antaraga ca . atra khalu ldee krte tri kryi yugapat prpnuvanti : vikara a gama niyama iti . tat yadi sarvata niyama labhyeta krtam syt . tat tu na labhyam . atha api vikarat a iti a labhyeta evam api krtam syt . tat tu na labhyam . kim kraam . gt prvam vikara eitavy tarata , taranti iti evamartham . abhym api anyat gam prvam eitavyam uprcchati iti evamartham . tatra hi i krte skasya rcchibhva prpnoti . nanu ca rcchibhve krte abdntarasya akrta iti krtv puna bhaviyati . puna rcchibhva puna iti cakrakam avyavasth prpnoti . na ea doa . yat tvat ucyate gt prvam vikara eitavy tarata taranti iti evamartham iti . bhavet siddham yatra vikara nity gam anityam tatra gt prvam vikara syu . yatra tu khalu ubhayam nityam paratvt tatra gam tvat bhavati . yat api ucyate abhym api anyat gam prvam eitavyam uprcchati iti evamartham iti . astu atra . i krte skasya rcchibhve krte abdntarasya akrta iti krtv puna bhaviyati . nanu ca uktam puna rcchibhva puna iti cakrakam avyavasth prpnoti . na ea doa . cakrakeu iata vyavasth . atha v ne iti na e pacam . k tarhi . vieaaah . ne ya vii . ka ca ne vii . vieya . vyavahita ca api akyate vieayitum . atha v ni api padam vii api padam .padavidhi ca samarthmm . vyavahite api smarthyam bhavati . (P_1,3.62.1) KA_I,287.7-15 Ro_II,268-269 kim idam prvagrahaam sanapekam . prk sana yebhya tmanepadm uktam tebhya sanantebhya api bhavati iti . hosvit yogpekam . prk etasmt yogt yebhya tmanepadam uktam tebhya sanantebhya tmanepadam bhavati iti . kim ca ata . yadi sanapekam nimittam avieitam bhavati . prvavat sana na jyate kimantt bhavitavyam . atha yogpekam uttaratra vidhi na prakalpate . bubhukate upayuyukate iti . yath icchasi tath astu . astu tvat sanapekam . nanu ca uktam nimittam avieitam bhavati . nimittam ca vieitam . katham . sanam eva atra nimittatvena apekiymahe . prvavat sana tmanepadam bhavati . kuta sana iti . atha v puna astu yogpekam . nanu ca uktam uttaratra vidhi na prakalpate . vidhi ca praklpta . katham . uttaratra api prvavat sana iti eva anuvartiyate . (P_1,3.62.2) KA_I,287.16-288.17 Ro_II,269-271 kimartham puna idam ucyate . prvavat sana iti adimriyatyartham . adimriyatyartha ayam rambha . adimriyatibhym sanantbhym tmanepadam m bht iti . itarath hi tbhym sanantbhym
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (153 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

tmanepadapratiedha . itarath hi anucyamne asmin tbhym sanantbhym tmanepadasya pratiedha vaktavya syt . iitsati mumrati . katham puna prvavat sana iti anena adimriyatibhym sanantbhym tmanepadasya pratiedha akya vijtum . vatinirdea ayam kmacra ca vatinirdee vkyaeam samarthayitum . tat yath : unaravat madreu yav . santi na santi iti . mtrvat asy kal . santi na santi . evam iha api prvavat bhavati na bhavati iti . na bhavati iti vkyaeam samarthayiymahe . yath prvayogayo sanantbhym tmanepadam na bhavati evam iha api adimriyatibhym sanantbhym tmanepadam na bhavati iti . yadi tarhi adimriyatyartha ayam rambha vidhi na prakalpate . sisiate iayiate . atha vidhyartha adimriyatibhym sanantbhym tmanepadam prpnoti . yath icchasi tath astu . astu tvat pratiedhrtha . nanu ca uktam vidhi na prakalpate iti . vidhi ca praklpta . katham . etat eva jpayati sanantt tmanepadam bhavati iti yat ayam adimriyatibhym sanantbhym tmanepadasya pratiedham sti . atha v puna astu vidhyartha . nanu ca uktam adimriyatibhym sanantbhym tmanepadam prpnoti iti . na ea doa . prakrtam sana na iti anuvartiyate . kva prakrtam . jrusmrdrm sana na ano ja . sakarmakt sana na . pratybhym ruva sana na . ade ita sana na . mriyate lulio ca sana na iti . iha idnm prvavat sana iti sana iti vartate na iti nivrttam . evam ca krtv sa api adoa bhavati yat uktam nimittam avieitam bhavati iti . na eva v puna atra adimriyatibhym sanantbhym tmanepadam prpnoti . kim kraam . ade ita iti ucyate na ca adi eva tmanepadasya nimittam . kim tarhi . it api nimittam . atha api adi eva itpara tu nimittam . na ca ayam sanpara itpara bhavati . yatra tarhi it na ryate mriyate lulio ca iti . atra api na mriyati eva tmanepadasya nimittam . kim tarhi . luliau api nimittam . atha api mriyati eva lulipara tu nimittam . na ca ayam sanpara lulipara bhavati . (P_1,3.62.3) KA_I,288.18-289.8 Ro_II,271-272 kim puna prvasya yat tmanepadadaranam tat sanantasya api atidiyate . evam bhavitum arhati . prvasya tmanepadadarant sanantt tmanepadabhva iti cet gupdiu aprasiddhi . prvasya tmanepadadarant sanantt tmanepadabhva iti cet gupdiu aprasiddhi . gupdnm na prpnoti . jugupsate mmsate iti . na hi etebhya prk sana tmanepadam na api parasmaipadam payma . siddham tu prvasya ligtidet . siddham etat . katham . prvasya yat tmanepadaligam tat sanantasya api atidiyate . krdiu tu ligapratiedha . krdiu tu ligapratiedha vaktavya . anucikrati parcikrati iti . astu tarhi prk sana yebhya tmanepadam dram tebhya sanantebhya api bahvati iti . nanu ca uktam prvasya tmanepadadarant sanantt tmanepadabhva iti cet gupdiu aprasiddhi iti . na ea doa . anubandhakaraasmarthyt bhaviyati . atha v avayave krtam ligam samudyasya vieakam bhavati . tat yath go sakthani kare v krtam ligam samudyasya vieakam bhavati . yadi avayave krtam ligam samudyasya vieakam bhavati jugupsayati mmsyati iti atra api prpnoti . na ea doa . avayave krtam ligam kasya samudyasya vieakam bhavati . yam samudyam ya avayava na vyabhicarati . sanam ca na vyabhicarati . icam puna vyabhicarati . tat yath go sakthani kare v krtam ligam go eva vieakam bhavati na gomaalasya . (P_1,3.62.4) KA_I,289.9-21 Ro_II,273 pratyayagrahaam ijartham . pratyayasya grahaam

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (154 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

kartavyam . prvavat pratyayt iti vaktavyam . kim prayojanam . ijartham . ijantt api yath syt iti . kusmayate vikusmayate hryate mahyate iti. tatra ka doa . tatra hetumaica pratiedha . tatra hetumaica pratiedha vaktavya . sayati yayati . stram ca bhidyate . yathnysam eva astu . katham kusmayate vikusmayate hryate mahyate iti. anubandhakaraasmarthyt bhaviyati . atha v avayave krtam ligam samudyasya vieakam bhavati . tat yath go sakthani kare v krtam ligam samudyasya vieakam bhavati . yadi avayave krtam ligam samudyasya vieakam bhavati hryayati mahyayati atra api prpnoti . avayave krtam ligam kasya samudyasya vieakam bhavati . yam samudyam ya avayava na vyabhicarati . yakam ca na vyabhicarati . icam tu vyabhicarati . tat yath go sakthani kare v krtam ligam go eva vieakam bhavati na gomaalasya . (P_1,3.63) KA_I,289.23-290.6 Ro_II,274 krgrahaam kimartham . iha m bht . hmsa hmsatu hmsu . katham ca atra aste anuprayoga bhavati . pratyhragrahaam tatra vijyate . katham puna jyate tatra pratyhragrahaam iti . iha krgrahat . iha kasmt pratyhragrahaam na bhavati . iha eva krgrahat . atha iha kasmt na bhavati . udumbhm cakra udubjm cakra . nanu ca mpratyayavat iti ucyate na ca atra mpratyayt tmanepadam payma . na brma anena iti . kim tarhi . svaritaita kartrabhiprye kriyphale tmanepadam bhavati iti . na ea doa . iha niyamrtham bhaviyati . mpratyayavat eva iti . yadi niyamrtham vidhi na prakalpate . hm cakre hm cakre iti . vidhi ca praklpta . katham prvavat iti vartate . mpratyayavat prvavat ca iti . (P_1,3.64) KA_I,290.8-9 Ro_II,275 svardyupasrt iti vaktavyam . udyukte anuyukte . apara ha : svardyantopasrt iti vaktayam . prayukte niyukte niniyukte . (P_1,3.65) KA_I,290.11-13 Ro_II,275 kimartham videasthasya grahaam kriyate na sama gamdiu eva ucyeta . sama kuva sakarmakrtham . sakarmakrtha ayam rambha . akarmakt iti hi tatra anuvartate . (P_1,3.66) KA_I,290.15-17 Ro_II,275 anavanakauilyayo iti vaktavyam . iha api yath syt . prabhujati vsas nibhujati jnuiras iti . tat tarhi vaktavyam . na vaktavyam . yasya bhuje avanam anavanam ca artha tasya grahaam . na ca asya bhuje avanam anavanam ca artha . (P_1,3.67.1) KA_I,290.19-292.8 Ro_II,276-284 e tmanepadavidhne ayantasya karmaa tatra upalabdhi .e tmanepadavidhne ayantasya yat karma yad yante tat eva karma bhavati tad tmanepadam bhavati iti vaktavyam . itarath hi sarvaprasaga . itarath hi sarvatra prasaga syt . iha api prasajyeta : rohanti hastinam hastipak . rohama haststhalam rohayati manuyn . tat tarhi vaktavyam . na vaktavyam . kasmt na bhavati : rohanti hastinam hastipak . rohama haststhalam rohayati manuyn iti . evam vakymi . e tmanepadam bhavati . tata aau yat karma au cet . ayante yat karma au yadi tat eva karma bhavati . tata sa kart . kart cet sa bhavati au iti . yadi evam karmakryam bhavati . tatra karmakartrtvt siddham . karmakartrtvt siddham iti cet yakcio nivrttyartham vacanam . karmakartrtvt siddham iti cet yakcio nivrttyartham idam vaktavyam . karmpadiau yakciau m bhtm iti . na v yakcio pratiedht . na v ea
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (155 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

doa . kim kraam . yakcio pratiedht . pratiidhyete atra yakciau . yakcio pratiedhe hetumairibrm upasakhynam iti . ya tarhi na hetumaic tadartham idam vaktavyam . tasya karmpadiau yakciau m bhtm iti : utpucchayate puccham svayam eva . udapuppucchata puccham svayam eva . atra api yath bhradvjy pahanti tath bhavitavyam pratiedhena : yakcio pratiedhe irigranthibrtmanepadkarmakm upsakhynam iti . sa ca avayam pratiedha rayitavya . itarath hi yatra niyama tata anyatra pratiedha . anucyamne hi etasmin yatra niyama tata anyatra tena yakcio pratiedha vaktavya syt . gaayati gaam goplaka . gaayati gaa svayam eva . tmanepadasya ca . tmanepadasya ca pratiedha vaktavya : gaayati gaa svayam eva . tmanepadapratiedhrtham tu . tmanepadapratiedhrtham idam vaktavyam . gaayati gaa svayam eva . iyate eva atra tmanepadam . kim iyate eva hosvit prpnoti api . iyate ca prpnoti ca . katham . aau it kasya idam e grahaam . yamt e prk karma kart v vidyate . na ca etasmt e prk karma kart v vidyate . idam tarhi prayojanam : andhyne iti vakymi iti . iha m bht . smarati vanagulmasya kokila . smarayati enam vanagulma svayam eva . etat api na asti prayojanam . karmpadi vidhaya karmasthabhvaknm karmasthakriym bhavanti kartrsthabhvaka ca ayam . evam tarhi siddhe sati yat andhyne iti pratiedham sti tat jpayati crya bhavati evajtyaknm tmanepadam iti . kim etasya jpane prayojanam . payanti bhrty rjnam . darayate bhrtyn rj . darayate bhrtyai rj . atra tmanepadam siddham bhavati . (P_1,3.67.2) KA_I,292.9-16 Ro_II,285 tmana karmatve pratiedha . tmana karmatve pratiedha vaktavya . hanti tmnam . ghtayati tm iti . sa tarhi vaktavya . na v yante anyasya kartrtvt . na v vaktavya . kim kraam . yante anyasya kartrtvt . anyat atra ayante karma anya yantasya kart . katham . dvau tmanau antartm arrtm ca . antartm tat karma karoti yena arrtm sukhadukhe anubhavati . arrtm tat karma karoti yena antartm sukhadukhe anubhavati iti . (P_1,3.72) KA_I,292.18-293.9 Ro_II,286-290 svaritaita iti kimartham . yti vti drti psti . svaritaita iti akyam akartum . kasmt na bhavati yti vti drti psti iti . kartrabhiprye kriyphale iti ucyate sarvem ca kartrabhipryam kriyphalam asti . te evam vijsyma . yem kartrabhipryam akartrabhiprayam ca kriyphalam asti tebhya tmanepadam bhavati iti . na ca etem kartrabhipryam akartrabhiprayam ca kriyphalam asti . tathjtyak khalu cryea svaritaita pahit yem kartrabhipryam akartrabhiprayam ca kriyphalam asti . atha abhipryagrahaam kimartham . svaritaita kartrye kriyphale iti iyati ucyamne yam eva samprati eti kriyphalam tatra eva syt . l lunte p punte . iha na syt . yaj yajate vap vapate . abhiprayagrahae puna kriyame na doa bhavati . abhi bhimukhye vartate pra dikarmai . tena yam ca abhipraiti yam ca abhipraiyati yam ca abhiprgt tatra sarvatra bhimukhyamtre siddham bhavati . kartrabhiprye kriyphale iti kimartham . pacanti bhaktakr . kurvanti karmakr . yajanti yjak . kartrabhiprye kriyphale iti ucyamne api atra prpnoti . atra api hi kriyphalam kartram abhipraiti . yjak yajanti g lapsymahe iti . karmakar kurvanti pdikam aha lapsymahe iti . evam tarhi kartrabhipraye kriyphale iti ucyate sarvatra ca kartram kriyphalam abhipraiti . tatra prakaragati vijsyate . sdhya yatra kartram kriyphalam abhipraiti iti . na ca antarea yajim yajiphalam vapim va
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (156 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

vapiphalam labhante . yjak puna antarea api yajim g labhante bhrtak ca pdikam iti . (P_1,3.78) KA_I,293.11-25 Ro_II,291-292 eavacanam pacamy cet arthe pratiedha . eavacanam pacamy cet arthe pratiedha vaktavya . bhidyate kula svayam eva . chidyate rajju svayam eva . evam tarhi ee iti vakymi . saptamy cet prakrte . saptamy cet prakrte pratiedha vaktavya . ste ete cyavante plavante . siddham tu ubhayanirdet . siddham etat . katham . ubhayanirdea kartavya . et ee iti vaktavyam . kartrgrahaam idnm kimartham syt . kartrgrahaam anupardyartham . anupardyartham etat syt . iha m bht . anukriyate svayam eva . parkriyate svayam eva iti . sidhyati . sutram tarhi bhidyate . yathnysam eva astu . nanu ca uktam eavacanam pacamy cet arthe pratiedha iti . na ea doa . kartari karmavyatihre iti atra kartrgrahaam pratykhyyate . tat prakrtam iha anuvartiyate . et kartari kartari iti . kim idam kartari kartari iti . kart eva ya kart tatra yath syt . kart ca anya ca ya kart tatra m bht iti . (P_1,3.79) KA_I,294.2-19 Ro_II,292-293 kimartham idam ucyate . parasmaipadapratiedht krdiu vidhnam . parasmaipadapratiedht krdiu parasmaipadam vidhyate . pratiidhyate tatra parasmaipadam svaritaita kartrabhiprye kriyphale tmanepadam bhavati iti . asti prayojanam etat . kim tarhi iti . tatra tmanepadapratiedha apratiiddhatvt . tatra tmanepadasya pratiedha vaktavya . kim kraam . apratiiddhatvt . na hi tmanepadam pratiidhyate . kim tarhi . parasmaipadam anena vidhyate . na v dyutdibhya vvacant . na v ea doa . kim kraam . dyutdibhya vvacant . yat ayam dyutdibhya vvacanam karoti tat jpayati crya na parasmaipadaviaye tmanepadam bhavati iti . tmanepadaniyame v pratiedha . tmanepadaniyame v pratiedha vaktavya . svaritaita kartrabhiprye kriyphale tmanepadam bhavati kartari . anuparbhym kra na iti . sidhyati . stram tarhi bhidyate . yathnysam eva astu . nanu ca uktam tatra tmanepadapratiedha apratiiddhatvt iti . parihrtam etat na v dyutdibhya vvacant . atha v idam tvat ayam praavya . svaritaita kartrabhiprye kriyphale tmanepadam bhavati iti parasmaipadam kasmt na bhavati . tmanepadena bdhyate . yath eva tarhi tmanepadena parasmaipadam bdhyate evam parasmaipadena tmanepadam bdhiyate . (P_1,3.86) KA_I,294.21 Ro_II,294 budhdiu ye akarmak tem grahaam kimartham . sakarmakrtham acittavatkartrkrtham v . (P_1,3.88) KA_I,294.23-295.10 Ro_II,294-295 aau akarmakt iti curdiica yantt parasmaipadavacanam . aau akarmakt iti curdiica yantt parasmaipadam vaktavyam . iha api yath syt : cetayamam prayojayati cetayati iti . yadi tarhi atra api iyate aigrahaam idnm kimartham syt . akarmakagrahaam ayantavieaam yath vijyeta . atha akriyame aigrahaam kasya akarmakgrahaam vieaam syt . e iti vartate . yantavieaam . tatra ka doa . iha eva syt : cetayamnam prayojayati cetayati iti . iha na syt : sayati yayati iti . siddham tu atasmin au iti vacant . siddham etat . katham . atasmin au ya akarmaka tatra iti vaktavyam . sidhyati . stram tarhi bhidyate . yathnysam eva astu . nanu ca uktam aav akarmakt iti curdiica yantt
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (157 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

parasmaipadavacanam iti . na ea doa . aau iti kasya idam e grahaam . yasm e prk karma kart v vidyate . na ca etasm ea prk karma kart v vidyate . (P_1,3.89) KA_I,295.13-14 Ro_II,295-296 pdiu dhea upasakhynam . pdiu dhea upasakhynam kartavyam . dhpayate iumeka samc . (P_1,3.93) KA_I,295.16-19 Ro_II,296. kimartha cakra . syasano iti etat anukryate . yadi tarhi na antarea cakram anurtti bhavati dyudbhya lui iti atra api cakra kartavya vibh iti anukarartha . atha idnm antarea api cakram anuvrtti bhavati iha api na artha cakrea . evam sarve cakr pratykhyyante. (P_1,4.1.1) KA_I,296.2-10 Ro_II,297-298 kimartham idam ucyate . anyatra sajsamvenniyamrtham vacanam . anyatra sajsamvea bhavati . kvnyatra . loke vykarae ca . loke tvat . indra akra puruhta purandara . kandu koha kula iti . ekasya dravyasya bahvya saj bhavanti . vykarae api kartavyam hartavyam iti atra pratyayakrtkrtyasajnm samvea bhavati . pcla vaideha vaidarbha iti atra pratyayataddhitatadrjasajn samvea bhavati . anyatra sajsamvet etasmt krat kart api sajnm samvea prpnoti . iyate ca ek eva saj syt iti . tat ca antarea yatnam na sidhyati iti niyamrtham vacanam . evamartham idam ucyate . asti prayojanam etat . kim tarhi iti . (P_1,4.1.2) KA_I,296.11-299.20 Ro_II,298-308 katham tvetatstram pahitavyam . kim kart ek saj iti hosvit prk kart param kryam iti . kuta puna ayam sandeha . ubhayath hi cryea iy stram pratipdit : kecit kart ek saj iti , kecit prk kart param kryam iti . ka ca atra viea . tatra ekasajdhikre tadvacanam . tatra ekasajdhikre tat vaktavyam . kim . ek saj bhavati iti . nanu ca yasya api parakryatvam tena api paragrahaam kartavyam . parrtham mama bhaviyati . vipratiedhe ca iti . mama api tarhi ekagrahaam parrtham bhaviyati . sarpm ekaea ekavibhaktau iti . sajdhikra ca ayam . tatra kim anyat akyam vijtum anyat ata sajy . tatra etvat vcyam . kart ek . kim . ek saj bhavati iti . agasajay bhapadasajayo asamvea . agasajay bhapadasajayo samvea na prpnoti . srpika brhika yjuka dhnuka . bbhravya mavya iti . anavake bhapadasaje agasaj bdheytm . paravacane hi niyamnupapatte ubhayasajbhva . yasya puna parakryatvam niyamnupapatte tasya ubhayo sajayo bhva siddha . katham . prve tasya bhapadasaje par agasaj . katham . evam sa vakyati . yasmtpratyayavidhi taddi suptianta padam na kye siti ca . svdiu asarvanmasthne yaci bham . tasya ante pratyaye agamiti . tatra rambhasmarthyc ca bhapadasaje parakryatvt ca agasaj bhaviyati . nanu ca yasya api ekasajdhikra tasya api agasajprvike bhapadasaje . katham .anuvrtti kriyate . paryya prasajyeta. ek saj iti vacant na asti yaugapadyena sabhava . karmadhrayatve tatpuruagrahaam . karmadhrayatve tatpuruagrahaam kartavyam . tatpurua samndhikaraa karmadhraya iti . ekasajdhikra iti coditam . akriyame hi anavak karmadhrayasaj tatpuruasajm bdheta . paravacane hi niyamnupapatte ubhayasajbhva . yasya puna parakryatvam niyamnupapatte
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (158 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

tasya ubhayo sajayo bhva siddha . katham . prv tasya karmadhrayasaj par tatpuruasaj . katham . evam sa vakyati . prvaklaikasarvajaratpuranavakeval samndhikaraena karmadhraya iti . evam sarvam karmadhrayaprakaraam anukramya tasya ante ritdi tatpurua iti . tatra rambhasmarthyt ca karmadhrayasaj parakryatvt ca tatpuruasaj bhaviyati . nanu ca yasya api ekasajdhikra tasya api tatpuruasajprvik karmadhrayasaj . katham . anuvrtti kriyate . paryya prasajyeta . ek saj iti vacant na asti yaugapadyena sambhava . tatpuruatve dvigucagrahaam . tatpuruatve dvigucagrahaam kartavyam . tatpurua dvigu ca iti cakra kartavya . akriyame hi cakre anavak dvigusaj tatpuruasajm bdheta . paravacane hi niyamnupapatte ubhayasajbhva . yasya puna parakryatvam niyamnupappate tasya ubhayo sajayo bhva siddha . katham . prv tasya dvigusaj par tatpuruasaj. katham . eva sa vakyati . taddhitrthottarapadasamhre ca sakhyprva dvigu iti . evam sarvam dviguprakaraam anukramya tasya ante ritdi tatpurua iti . tatra rambhasmarthyt ca dvigusaj parakryatvt ca tatpuruasaj bhaviyati . nanu ca yasya api ekasajdhikra tasya api tatpuruasajprvik dvigusaj . katham . anuvrtti kriyate . paryya prasajyeta . ek saj iti vacant na asti yaugapadyena sabhava . gatidivakarmahetumatsu cagrahaam . gatidivakarmahetumatsu cagrahaam kartavyam . upasarg kriyyoge gatica iti cakra kartavya . akriyame hi cakre anavaka pasargasaj gatisajm bdheta . paravacane hi niyamnupapatte ubhayasajbhva . yasya puna parakryatvam niyamnupapatte tasya ubhayo sajayo bhva siddha . katham . prv tasya upasargasaj par gatisaj . atra rambhasmarthyt ca upasargasaj parakryatvt ca gatisaj bhaviyati . nanu ca yasya api ekasajdhikra tasya upasargasajprvik gatisaj . katham . anuvrtti kriyate . paryya prasajyeta . ek saj iti vacant na asti yaugapadyena sabhava . gatisaj api anavak s vacant bhaviyati . svak gatisaj . ka avaka . rydni avaka . prdn y gatisaj s anavak . gati . diva karma . sdhakatamam karaam diva karma ca iti cakra kartavya . akriyame hi cakre anavak karmasaj karaasajm bdheta . paravacane hi niyamnupapatte ubhayasajbhva . yasya puna parakryatvam niyamnupapatte tasya ubhayo sajayo bhva siddha . katham . prv tasya karmasaj par karaasaj . katham . evam sa vakyati . diva sdhakatamam karma . tata karaam . karaasajm ca bhavati sdhakatamam . diva iti nivrttam . tatra rambhasmarthyt ca karmasaj parakryatvt ca karaasaj bhaviyati . nanu ca yasya api ekasajdhikratasya api karaasajprvik karmasaj . katham . anuvrtti kriyate . paryya prasajyeta . ek saj iti vacant na asti yaugapadyena sabhava . diva karma . hetumat . svatantra kart tatprayojako hetu ca iti cakra kartavya . akriyame hi cakre anavak hetusaj kartrsajm bdheta . paravacane hi niyamnupapatte ubhayasajbhva . yasya puna parakryatvam niyamnupapatte tasya ubhayo sajayorbhva siddha . katham . prv tasya hetusaj par kartrsaj . katham . evam sa vakyati . svatantra prayojaka hetu iti . tata kart . kartrsaja ca bhavati svatantra . prayojaka iti nivrttam . tatra rambhasmarthyt ca hetusaj parakryatvt ca kartrsaj bhaviyati . nanu ca yasya api ekasajdhikra tasya api kartrsajprvik hetusaj . katham . anuvrtti kriyate . paryya prasajyeta . ek saj iti vacant na asti yaugapadyena sabhava . gurulaghusaje nadghisaje .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (159 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

gurulaghusaje nadghisaje bdheytm . grgibandhu vtsbandhu vaitram viviniyya . paravacane hi niyamnupatte ubhayasajbhva . yasya puna parakryatvam niyamnupatte tasya ubhayo sajayo bhva siddha . katham . prve tasya nadghisaje pare gurulaghusaje . tatra rambhasmarthyt ca nadghisaje parakryatvt ca gurulaghusaje bhaviyata . nanu ca yasya api ekasajdhikra tasya api nadghisaghisajprvike gurulaghusaje . katham . anuvrtti kriyate . paryya prasajyeta . ek saj iti vacant na asti yaugapadyena sambhava . parasmaipadasajm puruasaj . parasmaipadasajm puruasaj bdheta . paravacane hi niyamnupapatte ubhayasajbhva . yasya puna parakryatvam niyamnupapatte tasyobhayo sajayo bhva siddha . katham . prv tasya puruasaj par parasmaipadasaj . katham . eva sa vakyati . tia tri tri prathamamadhyottam iti . evam sarvam puruaniyamam anukramya tasya ante la parasmaipadam iti . tatra rambhasmrthyt ca puruasaj parakryatvt ca parasmaipadasaj bhaviyati . nanu ca yasya api ekasajdhikara tasya api parasmaipadasajprvik puruasaj . katham . anuvrtti kriyate . paryya prasajyeta. ek saj iti vacant na asti yaugapadyena sambhava . parasmaipadasaj api anavak s vacant bhaviyati . svak parasmaipadasaj . ka avaka . atrkvas avaka . (P_1,4.1.3) KA_I,299.21-301.20 Ro_II,308-313 paravacane siti pada bham . paravacane siti padam bhasajamapi prpnoti . ayam te yoni rtviya . prajam vindma rtvijaym . rambhasmarthyt ca padasaj parakryatvt ca bhasaj prpnoti . gatibuddhydnm yantnm karma kartrsajam . gatibuddhyd yantnm karma kartrsajam api prpnoti . rambhasmarthyt ca karmasaj padasaj parakryatvt ca kartrsaj prpnoti . na ea doa . cryapravrtti jpayati na karmasajym kartrsaj bhavati iti yat ayam hrkro anyatarasym iti antarasygrahaam karoti . eavacanam ca ghisajnivrttyartham . eagrahaam ca kartavyam . ea ghi asakhi iti . kim prayojanam . ghisjnivrttyartham . nadsajym ghisaj m bht iti . akayai paddhatyai buddhayai dhenvai . itarath hi parakryatvt ca ghisaj rambhasmarthyt ca iti hrasva ca iti nadsaj . na v asambhavt . na v asambhavt . na v kartavyam . nadsajym ghisaj kasmt na bhavati . asambhavt . ka asau asambhava . hrasvalaka hi nadsaj ghisajym ca gua . hrasvalaka hi nadsaj ghisajym ca guena bhavitavyam . tatra vacanaprmyt nadsajym ghisajbhva . tatra vacanaprmyt nadsajym ghisaj na bhaviyati . kim kraam . raybhvt . raybhvt nadsajym ghisajnivrtti iti cet yadebhva . raybhvt nadsajym ghisajnivrtti iti cet evam ucyate yadea api na prpnoti . na ea doa . nadyrayatvt yadeasya hrasvasya nadsajbhva . nadyraya yadea . yad nadsajay ghisaj bdhit tata uttaraklam yadeena bhavitavyam . nadyrayatvt yadeasya hrasvasya nadsaj bhaviyati . bahuvrhyartham tu . bahvrhipratiedhrtham tu eagrahaam kartavyam . ea bavuvrhi iti . ki prayojanam . prayojanamavyaybhvopamnadvigukrllopeu . avyaybhve . unmattagagam lohitagagam . upamne . astrym kumudayen . dvigu . pacagavam daagavam . krllope . nikaumbi nirvrasi . tatra eavacant doa sakhysamndhikaraasamseu bahuvrhipratiedha . tatra eavacant doa
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (160 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

bhavati . sakhysamndhikaraasamseu bahuvrhe pratiedha prpnoti . sakhy . dvrvatka dea trrvatka dea . samndhikaraa . vrpuruaka grma . nasamse . abrhmaaka dea avralaka dea . krllope ca eavacant prdibhi na bahuvrhi . krllope ca eavacant prdibhi na prpnoti . prapatitapara praparaka prapatitapala prapalaka iti . atha ekasajdhikre katham sidhyati . ekasajdhikre vipratiedhd bahuvrhi . ekasajdhikre vipratiedht bahuvrhi bhaviyati . ekasajdhikre vipratiedht bahuvrhi iti cet ktrthe pratiedha . ekasajdhikre vipratiedht bahuvrhi iti cet ktrthe pratiedha vaktavya . nikaumbi nirvrasi . tatpurua atra bdhaka bhaviyati . tatpurua iti cet anyatra ktrtht pratiedha . tatpurua iti cet anyatra ktrtht pratiedha vaktavya . prapatitapara praparaka pratitatpala prapalaka iti . siddham tu prdnm ktrthe tatpuruavacant . siddhametat . katham . prdnm ktrthe tatpurua bhavati iti vaktavyam . (P_1,4.1.4) KA_I,301.21-303.14 Ro_II,313-317 kni puna asya yogasya prayojanni . prayojanam hrasvasajm drghaplutau . hrasvasajm drghaplutasaje bdhete . tisrvadhtukam lilio rdhadhtukam . tia srvadhtukasajm liliordhadhtusaj bdhate . apatyam vrddham yuv . apatyam vrddham yavusaj bdhate . ghim nad . ghisajm nadsaj bdhate . laghu guru . laghusajm gurusaj bdhate . padam bham . padasajm bhasaj bdhate . apddnam uttari dhanu vidhyati kasaptrym bhukte gm dogdhi dhanu vidhyati iti . apdnasajm uttari kraki bdhante . kva . dhanu vidhyati . kasaptrym bhukte . gm dogdhi . dhanu vidhyati . dhanu vidhyati iti apyayuktatvt ca dhruvamapye apdnam iti apdnasaj prpnoti sdhakatamam karaam iti ca karaasaj . karaasaj par s bhavati . kasaptrym bhukte iti atra apyuktatvt ca dhruvamapye apdnamiti apdnasaj prpnoti dhra adhikaraam iti ca adhikaraasaj . adhikaraasaj par s bhavati . gm dogdhi iti atra apyuktatvt ca apdnasaj prpnoti karturpsitatamam karma . iti ca karmasaj . karmasaj par s bhavati . dhanu vidhyati iti atra apyayuktatvt ca apdnasaj prpnoti svatantra kart iti ca . kartrsaj par s bhavati . krudhadruho upsrayo karma sapradnam . krudhadruho upsrayo karmasaj sapradnasajm bdhate . karaam pari sdhu asi chinatti . karaasajm pari i bdhante . kva . dhanu vidhyati . asi chinatti iti . adhikaraam karma geham praviati . adhikaraasajm karmasaj bdhate . kva . geham praviati iti . adhikaraam kart sthl pacati . adhikaraasajm karmasaj bdhate . kva . sthl pacati iti . adhyupasram karma . adhyupasram karma adhikaraasajm bdhate . gatyupasargasaje karmapravacanyasaj . gatyupasargasaje karmapravacanyasaj bdhate . parasmaipadam tmanepadam . parasmaipadasajm tmanepadasaj bdhate . samsasaj ca . samsasaj ca y y par anavak ca t t prv svak ca bdhante . (P_1,4.1.5) KA_I,303.15-304.9 Ro_II,317-319 arthavat prtipadikam . arthavat prtipadikasajam bhavati . guavacanam ca . guavacanasajam ca bhavati arthavat . samsakrttaddhitvyayasarvanma asarvalig jti . 41||samsa | samsasaj ca vaktavy . krt . krtsaj ca vaktavy . taddhita . taddhitasaj ca vaktavy . avyaya .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (161 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

avyayasaj ca vaktavy . sarvanma . sarvanmasaj ca vaktavy . asarvalig jti iti etat ca vaktavyam . sakhy . sakhysaj ca vaktavy . u ca . usaj ca vaktavy . k puna usaj . asaj . ekadravyopanivein saj . ekadravyopanivein saj iti etat ca vaktavyam . kimartham idamucyate . yathnyse eva bhyih saj kriyante . santi ca eva atra k cit aprv saj . api ca etena nuprvyea sannivinm bdhanam yath syt . guavacanasajy ca etbhi bdhanam yath syt iti . (P_1,4.2.1) KA_I,304.11-306.10 Ro_II,319-325 vipratiedha iti ka ayam abda . vipratiprvt siddhe karmavyatihre karmavyatihre gha . itaretarapratiedha vipratiedha . anyonyapratiedha vipratiedha . ka puna vipratiedha . dvau prasagau anyrthau ekasmin sa vipratiedha . dvau prasagau yad anyrthau bhavata ekasmin ca yugapat prptnuta sa vipratiedha . kva puna anyrthau kva ca ekasmin yugapat prpnuta . vrkbhym , vrkeu iti anyrthau vrkebhya iti atra yugapat prpnuta . kim ca syt . ekasmin yugapadasambhavt prvaparaprpte ubhayaprasaga . ekasmin yugapadasambhavtprvasy ca parasy ca prpte ubhayaprasaga . idam vipratiiddham yat ucyate ekasmin yugapadasambhavtprvaparaprpte ubhayaprasaga iti . katham hi ekasmin ca nma yugapadasambhava syt prvasy ca parasyca prpte ubhayaprasaga ca syt . na etat vipratiiddham . yat ucyate ekasmin yugapadasambhavt iti kryayo yugapadasambhava strayo ubhayaprasaga . trjdibhi tulyam . trjdibhi tulyam paryya prpnoti . tat yath trjdaya paryyea bhavanti . kim puna kraam trjdaya paryyea bhavanti . anavayaprasagt pratipadam vidhe ca . anavayavena prasajyante pratipadam ca vidhyante . apratipatti v ubhayo tulyabalatvt . apratipatti v puna ubhayo strayo syt . kim kraam . tulyabalatvt . tulyabale hi ubhe stre . tat yath . dvayo tulyabalayo eka preya bhavati . sa tayo paryyea kryam karoti . yad tam ubhau yugapat preayata nndiku ca krye bhavata tad yadi asau avirodhrth bhavati tata ubhayo na karoti . kim puna kraam ubhayo na karoti . yaugapadysambhavt . na asti yaugapadyena sambhava . tatra pratipattyartham vacanam . tatra pratipattyartham idam vaktavyam . tavyaddnm tu aprasiddhi . tavyaddnm tu kryasya aprasiddhi . na hi kim cit tavyaddiu niyamakri stram rabhyate yena tavyaddaya syu . ya ca bhavat hetu vyapadia apratipatti v ubhayo tulyabalatvt iti tulya sa tavyaddiu . na ea doa . anavak tavyaddaya ucyante ca . te vacant bhaviyanti . ya ca bhavat hetu vyapadia trjdibhi tulyam paryya prpnoti iti tulya sa tavyaddiu . etvat iha stram vipratiedhe param iti . pahiyati hi crya sakrdgatau virpratiedhe yat bdhitam tat bdhitam eva iti . puna ca pahiyati puna prasagavijnt siddham iti . kim puna iyat strea ubhayam labhyam . labhyam iti ha . katham . iha bhavat dvau het vyapadiau . trjdibhi tulyam paryya prpnoti iti ca apratipatti v ubhayo tulyabalatvt iti ca . tat yad tvat ea hetu trjdibhi tulyam paryya prpnoti iti tad vipratiehe param iti anena kim kriyate . niyama . vipratiedhe param eva bhavati iti . tad etat upapannam bhavati sakrdgatau vipratiedhe yat bdhitam tat bdhitam eva iti . yad tu ea hetu apratipatti v ubhayo tulyabalatvt iti tad vipratiedhe param iti anena kim kriyate . dvram . vipratiedhe param tvat bhavati tasmin kre yadi prvam api prpnoti tat api bhavati . tad etat upapannam bhavati punaprasagavijnt siddham iti . vipratiedhe param iti uktv agdhikre prvam iti vaktavyam . kim krtam bhavati . prvavipratiedh na
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (162 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

pahitavy bhavanti . guavrddhyautvatrjvadbhvebhya num prvavipratiiddham . numaciratrjvadbhvebhya nu iti . katham ye paravipratiedh . ittvottvbhym guavrddh bhavata vipratiedhena iti . stram ca bhidyate . yathnysam eva astu . katham ye prvavipratiedh . vipratiedhe param iti eva siddham . katham . paraabda ayam bahvartha . asti eva vyavasthym vartate . tat yath prva para iti . asti anyrthe vartate . paraputra parabhry . anyaputra anyabhry iti gamyate . asti prdhnye vartate . tat yath param iya brhm asmin kuumbe . pradhnam iti gamyate . asti iavc paraabda . tat yath . param dhma gata iti . iam dhma iti gamyate . tat ya iavc paraabda tasya idam grahaam . vipratiedhe param yat iam tat bhavati . (P_1,4.2.2) KA_I,306.11-309.23 Ro_II,325-335 antaragam ca . antaragam ca balya bhavati iti vaktavyam . kim prayojanam . prayojanam yaekdeettvottvni guavrddhidvirvacanllopasvarebhya . gut yadea : syona , syon . gua ca prpnoti yade ca . paratvt gua syt . yadea bhavatyantaragata . vrddhe yadea . dyaukmi syaukmi . vrddhi ca prpnoti yade ca . paratvt vrddhi syt . yadea bhavati antaragata . dvirvacant yadea . dudyati susyati . dvirvacanam ca prpnoti yade ca . nityatvt dvirvacanam syt . yadea bhavati antaragata . allopasya ca yadeasya ca na asti sampradhra . svart yadea . dyaukmi syaukmi . svara ca prpnoti yade ca . paratvt svara syt . yadea bhavati antaragata . gut ekdea . kdraveya mantram apayat . gua ca prpnoti ekdea ca . paratvt gua syt . ekdea bhavati antaragata . vrddhe ekdea . vaikmi sausthiti . vrddhi ca prpnoti ekdea ca . paratvt vrddhi syt . ekdea bhavati antaragata . dvirvacant ekdea . jy odana jaudana . jaudanam icchati jaudanyati . jaudanyate san jujaudanyiati . dvirvacanam ca prpnoti ekdea ca . nityatvt dvirvacanam syt . ekdea bhavati antaragata . allopt ekdea . un une . allopa ca prpnoti ekdea ca . paratvt allopa syt . ekdea bhavati antaragata . na etat asti prayojanam . na asti atra viea allopena v nivrttau satym prvatvena v . ayam asti viea . allopena nivrttau satym udttanivrttisvara prasajyeta . na atra udttanivrttisvara prpnoti . kim kraam . na govansvavara iti pratiedht . na ea udttanivrttisvarasya pratiedha . kasya tarhi . trtydisvarasya . yatra tarhi trtydisvara na asti . una paya iti . evam tarhi na lkaikasya pratiedham ima . kim tarhi . yena kena cit lakaena prptasya vibhaktisvarasya pratiedha . yatra tarhi vibhakti na asti . bahhuun iti . yadi puna ayam udttanivrttisvarasya api pratiedha vijyeta . na evam akyam . iha api prasajyeta : kumr iti . evam tarhi cryapravrtti jpayati nodttanivrttisvara uni avatarati iti yat ayam vanabdam gaurdiu pahati . antodttrtham yatnam karoti . siddham hi syn p eva . svart ekdekdea . sautthiti vaikmi . svara ca prpnoti ekdea ca . paratvtsvara syt . ekdea bhavati antaragata . guasya ca ittvottvayo ca na asti sampradhra . vrddhe ittvottve . stauri paurti . vrddhi ca prpnoti ittvottve ca . paratvt vrddhi syt . ittvottve bhavata antaragata . dvirvacant ittvottve . testryate popryate . dvirvacanam ca prpnoti ittvottve ca . nityatvt dvirvacanam syt . ittvottve bhavata antaragata . allopasya ca ittvottvayo ca na asti sampradhra . svare nsti viea . iinm t gua savaradrghatvt . iinm t gua savaradrghatvt prayojanam . ayaje indram avape indram . vrke indram plake indram . ye indram te indram . t gua ca
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (163 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prpnoti savaradrghatvam ca . paratvt savaraadrghatvam syt . t gua bhavati antaragata . na v savaradrghatvasya anavakatvt . na v etat antaragea api sidhyati . kim kraam . savaradrghatvasya anavakatvt . anavakam savaradrghatvam t guam bdheta . na etat antarage asti anavakam param iti . iha api syona , syon iti akyam vaktum na v paratvt guasya iti . po ekdea tvalopbhym . po ekdea tvalopbhym bhavati antaragata prayojanam . tvt ekdea . khavyati mlyati . tvam ca prpnoti ekdea ca . paratvt tvam syt . ekdea bhavati antaragata . lopt ekdea . kmaaleya bhdrabheya . lopa ca prpnoti ekdea ca . paratvt lopa syt . ekdea bhavati antaragata . atha kimartham tvalopbhym iti ucyate na lopetvbhymiti eva ucyeta . sakhytnudea m bht iti . pa api ekdea lope prayojayati . caui blki . ttvanapusakopasarjanahrasvatvni ayavyvekdeatugvidhibhya . ttvanapusakopasarjanahrasvatvni ayavyvekdeatugvidhibhya bhavanti antaragata . ve vnyam o nyam glai glnyam mlai mlnyam glcchattram clcchatram . ttvam ca prpnoti ete ca vidhaya . paratvt ete vidhaya syu . ttvam bhavati antaragata . napusakopasarjanahrasvatvam ca prayojanam . atiri atra atinu atra atiricchattram atinucchatram rastri idam dhnakuli idam nikaumbi idam nirvrasi idam nikaumbicchatram nirvrsicchatram . napusakopasarjanahrasvatvam ca prpnoti ete ca vidhaya . paratvt ete vidhaya syu . napusakopasarjanahrasvatvam bhavati antaragata . tuk yaekdeaguavrddhyauttvadrghatvetvamumetttvarvidhibhya . yaekdeaguavrddhyauttvadrghatvetvamumetttvarvidhibhya tuk bhavati antaragata . yadet . agnicit atra somasut atra . ekdet . agnicit idam somasut udakam . gut . agnicite somasute . vrddhe . prarcchaka prrcchaka . auttvt . agniciti somasuti . drghatvt . jagadbhym janagadbhym . tvt . jagatyati janagatyati . muma . agnicinmanya somasunmanya . etvt . jagadbhya janagadbhya . rvidhe . sukrtyati ppakryati . ananabhym ca iti vaktavyam . sukrt sukrtddukrau . tuk ca prpnoti ete ca vidhaya . paratvt ete vidhaya syu . tuk bhavati antaragata . iyadea gut . iyadea gut bhavati antaragata prayojanam . dhiyati riyati . iyadea ca prpnoti gua ca . paratvt gua syt . iyadea bhavati antaragata . uvadea ca iti vaktavyam . prdudruvat prsusruvat . ve samprasraaprvatvam yadet . ve samprasraaprvatvam yadet bhavati antaragata prayojanam . uuvatu uuvu . prvatvam ca prpnoti yadea ca . paratvt yadea syt . prvatvam bhavati antaragata . hva kralopt . hva kralopt prvatvam bhavati antaragata prayojanam . juhuvatu juhuvu . prvatvam ca prpnoti kralopa ca paratvt kralopa syt . prvatvam bhavati antaragata . svara lopt . svara lopt bhavati antaragata prayojanam . aupagav saudman . svara ca prpnoti lopa ca . paratvt lopa syt . svara bhavati antaragata . pratyayavidhi ekdet . pratyayavidhi ekdet bhavati antaragata prayojanam . agni indra vyu udakam . pratyayavidhi ca prpnoti ekdea ca . paratvt ekdea syt . | pratyayavidhi bhavati antaragata . yadet ca iti vaktavyam . agni atra vyu atra . ldea varavidhe . ldea varavidhe bhavati antaragata prayojanam . pacatu atra pahtu atra . ldea ca prpnoti yadea ca .paratvt yadea syt . ldea bhavati antaragata . tatpuruntodttatvam prvapadaprakrtisvart . tatpuruntodttatvam prvapadaprakrtisvart bhavati antaragata prayojanam . prvalpriya aparalpriya
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (164 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

atpuruntodttatvam ca prpnoti prvapadaprakrtisvaratvam ca . paratvt prvapadaprakrtisvaratvam syt . tatpuruntodttatvam bhavati antaragata . etni asy paribhy prayojanni yadartham e paribh kartavy . (P_1,4.2.3) KA_I,309.23-311.11 Ro_II,335-339 yadi santi prayojanni iti e paribh kriyate nanu ca iyam api kartavy asiddham bahiragalakaam antaragalakae iti . kim prayojanam . pacvedam pacmedam . asiddhatvt bahiragalakaasya guasya antaragalakaam aitvam m bht iti . ubhe tarhi kartavye . na iti ha . anay eva siddham . iha api syona syon iti asiddhatvt bahiragalakaasya guasya antaragalakaa yadeo bhaviyati . yadi asiddham bahiragalakaam antaragalakae iti ucyate akady hirayady asiddhatvt asiddhatvt bahiragalakaasya ha antaragalakaa yadea na prpnoti . na ea doa . asiddham bahiragalakaam antaragalakae iti uktv tata vakymi na ajnantarye bahivapraklpti iti . s tarhi e paribh kartavy . na kartavy . cryapravrtti jpayati bhavati e paribh iti yat ayam atvatuko asiddha iti ha . iyam tarhi paribh kartavy asiddham bahiragalakaamantaragalakae iti . e ca na kartavy . cryapravrtti jpayati bhavati e paribh iti yat ayam vha h iti ham sti . tasya doa prvapadottarapadayo vrddhisvarau ekdet . tasya etasya lakaasya doa prvapadottarapadayo vrddhisvarau ekdet antaragata abhinirvrttt na prpnuta . prvaiukmaama aparaiukmaama guodakam tilodakam . udake akevale iti prvottarapadayo vyapavargbhvt na syt . na ea doa . cryapravrtti jpayati prvottarapadayo tvat kryam bhavati na ekdea iti yat ayam na indrasya parasya iti pratiedham sti . katham krtv jpakam . indre dvau acau . tatra eka yasya ti ca iti lopena hriyate apara ekdeena . tata anacka indra sampanna . tatra ka prasaga vrddhe . payati tu crya prvapadottarapadyo tvatkryam bhavati na ekdea iti tata na indrasya parasya iti pratiedham sti . yadet iyuvau . yadet iyuvau antaragata abhinirvrttt na prpnuta . vaiykaraa sauvava iti . lakaam hi bhavati yvo vrddhiprasage iyuvau bhavata iti . na ea doa . anavakau iyuvau . aci iti ucyate . kim puna kraam aci ti ucyate . iha m bhtm . aitikyana aupagava iti . stm atra iyuvau lopa vyo vali iti lopa bhaviyati . yatra tarhi lopa na asti . praiyamedha praiyamgava iti . usi pararpt ca . usi pararpt ca antaragata abhinirvrttt iydea na prpnoti . paceyu yajeyu . na ea doa . na evam vijyate y iti etasya iy bhavati iti . katham tarhi . ys iti etasya iy bhavati iti . luk lopayaayavyvekdeebhya . lopayaayavyvekdeebhya luk balyn iti vaktavyam . lopt . gomn priya asya gomatpriya yavamatpriya . gomn iva carati gomatyate yavamatyate . yadet . grmaya kulam grmaikulam sennya kulam sennikulam . ayavyvekdeebhya . gave hitam gohitam rya kulam raikulam nva kulam naukulam vrkdbhayam vrkabhayam . luk ca prpnoti ete ca vidhaya . paratvt ete vidhaya syu . luk balyn iti vaktavyam luk yath syt . (P_1,4.3.1) KA_I,312.2-313.23 Ro_II,340-344 y iti kimartham . khav ml . kim ca syt . khavbandhu mlbandhu . nad bandhuni iti ea svara prasajyeta . iha ca bahukhavaka iti nadyrta ca iti nitya kap prasajyeta . na ea doa . cryapravrtti jpayati na pa nadsaj bhavati iti yat ayam e m nadymnbhya iti prthak
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (165 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

bgrahaam karoti . iha tarhi mtre mtu iti nady iti prasajyeta . kim puna idam drghayo grahaam hosvid hrasvayo . kim cta . yadi drghayo grahaam y iti nirdea na upapadyate . drght hi prvasavara pratiidhyate . uttaratra ca vieaam na prakalpeta y hrasvau iti . yadi y na hrasvau . atha hrasvau na y . y hrasvau ceti vipratiiddham . atha hrasvayo he akae atra api prasajyeta . na ea doa . avayam atra vibh nadsaj eitavy . ubhayam hi iyate : he akai he akae iti . iha tarhi akaibandhu iti nad bandhuni iti ea svara prasajyeta . iha ca bahuakai iti nadyrta ceti nitya kap prasajyeta . na ea doa . iti hrasva ca iti ayam niyamrtha bhaviyati . iti eva y hrasvau nadsajau bhavata na nyatra iti . kaimarthakyt niyama bhavati . vidheyam na asti iti krtv . iha ca asti vidheyam . kim . nity nadsaj prpt s vibh vidhey . tatra aprva vidhi astu niyama astu iti aprva eva vidhi bhaviyati na niyama . atha ayam nitya yoga syt prakalpeta niyama . bham prakalpeta . nitya tarthi bhaviyati | tat katham . yogavibhga kariyate . idam asti . y strykhyau nad na iyauvasthnau astr vmi . tata iti . iti ca iyauvasthnau y v astr nadsajau na bhavata . tata hrasvau . hrasvau ca y strykhyau iti nadsajau bhavata . iyauvasthnau v na iti ca nivrttam . yadi evam akaaye atra gua na prpnoti . dvitya yogavibhga kariyate . eagrahaam na kariyate . katham . idam asti . y strykhyau nad na iyauvasthnau astr vmi . tata iti . iti ca iyauvasthnau y v astr nadsajau na bhavata . tata hrasvau . hrasvau ca y strykhyau iti nadsajau bhavata . tata hrasvau . hrasvau ca y strykhyau iti nadsajau bhavata . iyauvasthnau v na iti ca nivrttam . tata ghi . ghisajau ca bhavata strykhyau y hrasvau iti . tata asakhi . sakhivarjitau ca y hrasvau ghisajau bhavata . strykhyau iti iti ca nivrttam . yadi tarhi eagrahaam na kriyate na artha ekena api yogavibhgena . avieea nadsaj utsarga . tasy hrasvayo ghisaj bdhik . tasym nityym prptym iti vibh rabhyate . atha v puna astu drghayo . nanu ca uktam nirdea na upapadyate . drght hi prvasavara pratiidhyate . v chandasi iti evam bhaviyati . chandasi iti ucyate na ca idam chanda . chandovat stri bhavanti iti . yat api ucyate uttaratra vieeam na prakalpeta y hrasvau iti . yadi y na hrasvau atha hrasvau na y . y hrasvau iti vipratiiddham iti . na etat vipratiiddham . ha ayam y hrasvau iti . yadi y na hrasvau . atha hrasvau na y . te evam vijsyma yvo yau hrasvau iti . kau ca yvo hrasvau . savarau . atha strykhyau iti ka ayam abda . striyam cakte strykhyau . yadi evam strykhyyau iti prpnoti . anupasarge hi ka vidhyate . na tarhi idnm idam bhavati yasmin daa sahasri putre jte gavm dadau . brhmaebhya priykhyebhya sa ayam uchena jvati . chandovat kavaya kurvanti . na hi e ii . evam tarhi karmasdhana bhaviyati : striym khyyete strykhyau . yadi karmasdhana krtstriy dhtustriy ca na sidhyati . tantryai lakmyai riyai bhruvai . evam tarhi bahuvrhi bhaviyati . striym khy anayo strykhyau . evam api krtstriy dhtustriy ca na sidhyati . tantryai lakmyai riyai bhruvai . evam tarhi vic bhaviyati . atha v puna astu ka eva . striyam cakte strykhyau iti . nanu ca uktam strykhyyau iti prpnoti . anupasarge hi ka vidhyate . mlavibhujdipht ka bhaviyati . evam ca krtv sa api adoa bhavati yat uktam yasmin daa sahasri putre jte gavm dadau . brhmaebhya priykhyebhya sa ayam uchena jvati . (P_1,4.3.2) KA_I,313.23-315.3 Ro_II,345-349 atha khygrahaam kimartham .

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (166 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

nadsajym khygrahaam strviayrtham . nadsajym khygrahaam strviayrtham . strviayau eva yau nityam tayo eva nadsaj yath syt . iha m bht grmaye sennye striyai iti . prathamaligagrahaam ca . prathamaligagrahaam ca kartavyam . prathamalige yau strykhau iti vaktavyam . kim prayojanam . prayojanam kviblupsams . kumryai brhmaya . lup . kharakuyai brhmaya . atitantryai brhmaya atilakmyai brhmaya . tat tarhi vaktavyam . na vaktavyam . avayavastrviayatvt siddham . avayava atra strviaya tadray nadsaj bhaviyati . avayavastrviayatvt siddham iti cet iyauvasthnapratiedhe yasthnapratiedhaprasaga avayavasya iyauvasthnatvt . avayavastrviayatvt siddham iti cet iyauvasthnapratiedhe yasthnayo api yvo pratiedha prasajyeta . dhyai pradhyai brhmayai . kim kraam . avayavasya iyauvasthnatvt . avayava atra iyauvasthna . siddham tvagarpagrahat yasya agasya iyuvau tatpratiedht . siddham etat . katham . agarpam grhyate . yasya agasya iyuvau bhavata tasya idam grahaam . na ca etasya agasya iyuvau bhavata . hrasveyuvsthnapravrttau ca strvacane . hrasvau ca iyuvsthnau ca pravrttau ca prk ca pravrtte strvacanau eva nadsajau bhavata iti vaktavyam . akayai atiakayai brmayai . kva m bht . akaaye atiakaaye brhmaya . dhenvai atidhenvai brhmayai . kva m bht . dhenave atidhenave brhmaya . riyai atiriyai brhmayai . kva m bht . riye atiriye brhmaya . bhruvai atibhruvai brhmayai . kva m bht . bhruve atibhruve brhmaya . apara ha : hrasvau ca iyuvsthnau ca pravrttau api strvacanau eva nadsajau bhavata iti vaktavyam : akayai , atiakayai brmayai . kva m bht . akaaye atiakaaye brhmaya . dhenvai atidhenvai brhmayai . kva m bht . dhenave atidhenave brhmaya . riyai atiriyai brhmayai . kva m bht . riye atiriye brhmaya . bhruvai atibhruvai brhmayai . kva m bht . bhruve atibhruve brhmaya . kimartham puna idam ucyate . prathamaligagrahaam coditam . tat dveyam vijnyt : sarvam etat vikalpate iti . tat crya suhrt bhtv anvcae hrasvau ca iyuvsthnau ca pravrttau ca prk ca pravrtte strvacanau eva iti . (P_1,4.9) KA_I,315.5-15 Ro_II,349-350 yogavibhga kartavya . athyukta chandasi . athyukta patiabda chandasi ghisaja bhavati . tata v . v chandasi sarve vidhayo bhavati . supm vyatyaya . tim vyatyaya . varavyatyaya . ligavyatyaya . klavyatyaya . puruavyatyaya . tmanepadavyatyaya . parasmaipadavyatyaya . supm vyatyaya . yukta mta ast dhuri dakiy . dakiym iti prpte . tim vyatyaya . caalam ye avaypaya takati . takanti iti prpte . varavyatyaya . triubhauja ubhitam ugravram . suhitamiti prpte . ligavyatyaya . madho grhti madho trpt iva sate . madhuna iti prpte . klavyatyaya . va agnn dhsyamnena va somena yakamena . va dht va ya iti prpte . puruavyatyaya . adh sa vrai daabhi viyy . viyyt iti prpte . tmanepadavyatyaya . brahmacriam icchate . icchati iti prpte . parasmaipadavyatyaya . pratpam anya rmi yudhyati | anvpam anya rmi yudhyati . yudhyate iti prpte . (P_1,4.13.1) KA_I,315.17-317.4 Ro_II,351-356 yasmt iti vyapadeya . atha pratyayagrahaam kimartham . yasmt vidhi taddi pratyaye agam iti iyati ucyamne str
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (167 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

iyat stryati iti atra api prasajyeta . pratyayagrahae puna kriyame na doa bhavati . atha vidhigrahaam kimartham . yasmt pratyaya taddi pratyaye agam iti iyati ucyamne dadhi adhun madhu adhun atrpi prasajyeta . vidhigrahaea puna kriyame na doa bhavati . tat etat pratyayagrahaena vidhigrahaena ca samuditena kriyate sanniyoga . yasmt ya pratyaya vidhyate taddi tasmin agasajam bhavati iti . atha taddigrahaam kimartham . agasajym taddivacanam sydinumartham . agasajym taddigrahaam kriyate sydyartham numartham ca . sydyartham tvat . kariyva kariyma . numartham . kuni vanni . mitsuo upasamkhynam . mitvata suvata ca pasamkhynam kartavyam . mitvata . bhinatti chinatti abhinat acchinat . suvata . sacarakastu sacaskaru . kim puna kraam na sidhyati . sua bahiragatvt . bahiraga su . antaraga gua . asiddham bahiragam antarage . vakyati etat sayogde guavidhne sayogopadhagrahaam krartham . yadi sayogopadhagrahaam kriyate na artha sayogdigrahaena . iha api sasvaratu sasvaru iti sayogopadhasya iti eva siddham . bhavet evamarthena na artha . idam tu na sidhyati sacakaratu sacaskaru . kim puna kraam na sidhyati . iha tasya v grahaam bhavati tadde v na cedam tat na api taddi . siddham tu taddydivacant . siddham etat . katham . taddydi agasajam bhavati iti vaktavyam . kim idam taddydi iti . tasya di taddi , taddi di yasya tadidam taddydi iti . sa tarhi tath nirdea kartavya . na kartavya . uttarapadalopa atra draavya . tat yath : uramukham iva mukham asya uramukha , kharamukha , evam taddydi taddi iti . tadekadeavijnt v siddham . tadekadeavijnt v siddham etat . tadekadeabhtam tadgrahaena grhyate. tad yath . gag yamun devadatt iti . anek nad gagm yamunm ca pravi gagyamungrahaena grhyate . tath devadattstha garbha devadattgrahaena grhyate . viama upanysa . iha ke cit abd aktaparimnm arthnm vcak bhavanti ye ete sakhyabd parimaabd ca . paca sapta iti : ekena api apye na bhavanti . droa khr hakam iti : naiv adhike bhavanti na ca nyne . ke cit yvat eva tat bhavati tvat eva hu ye ete jtiabd guaabd ca . tailam ghrtam iti : khrym api bhavanti droe api . ukla nla kra iti : himavati api bhavati vaakaikmtre api dravye . agasaj ca api aktaparimnm kriyate . s kena adhikasya syt . evam tarhi cryapravrtti jpayati tadekadeabhtam tadgrahaena grhyate iti yat ayam na idamadaso ako iti sakakrayo pratiedham sti . katham krtv jpakam . idamadaso kryam ucyamnam ka prasago yat sakakrayo syt . payati tu crya tadekadeabhtam tadgrahaena grhyate iti tata sakakrayo pratiedham sti . (P_1,4.13.2) KA_I,317.5-318.4 Ro_II,356-359 atha dvityam pratyayagrahaam kimartham . pratyayagrahaam paddau aprasagrtham . pratyayagrahaam kriyate paddau agasaj m bht iti . kim ca syt . stryartham , ryartham , bhvartham : agasya iti iyauvaau sytm . parimrtham ca . parimrtham ca dvityam pratyayagrahaam kriyate . yasmt pratyayavidhi taddi agam iti iyati ucyamne datayasya api agasaj prasajyeta . tat tarhi kartavyam . na kartavyam . kena idnm agakryam bhaviyati . pratyaye iti prakrtya agakryam adhyeye . pratyaye iti prakrtya agakryam adhe prkarot upaihia upasargt prvau aau prpnuta . siddham tu pratyayagrahae yasmt sa tadditadantavijnt . siddham etat . katham . pratyayagrahae yasmt sa pratyaya vihita
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (168 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

tadde tadantasya ca grahaam bhavati iti e paribh kartavy . ka puna atra viea e paribh kriyeta pratyayagrahaam v . avayam e paribh kartavy . bahni etasy paribhy prayojanni . prayojanam dhtuprtipadikapratyayasamsataddhitavidhisvar . dhtu . devadatta cikrati . saghtasya dhtusaj prpnoti . prtipadika . devadatt grgya . saghtasya prtipadikasaj prpnoti . pratyaya . mahntam putram icchati . samghtt pratyayotpatti prpnoti . samsa . rddhasya rja purua . samghtasya samsasaj prpnoti . taddhitavidhi . devadatta grgyyaa . samghtt taddhitotpatti prpnoti . svara . devadatta grgya . samghtsya nitydi nityam iti dyudttatvam prpnoti . pratyayagrahae yasmt sa tadde tadantasya grahaam bhavati iti na doa bhavati . s tarhi e paribh kartavy . na kartavy . evam vakymi : yasmt pratyayavidhi taddi pratyaye grhyame grhyate . tata agam . agasajam ca bhavati yasm tpratyayavidhi taddi pratyaye . (P_1,4.13.3) KA_I,318.5-18 Ro_II,359-360 yadi pratyayagrahae yasmt sa tadde grahaam bhavati iti ucyate avatapenakulasthitam te etat udakeviram te etat sagatikena sanakulena ca samsa na prpnoti . evam tarhi pratyayagrahae yasmt sa tadde grahaam bhavati iti uktv tata vakymi : krdgrahae gatikrakaprvasya api . krdgrahae gatikrakaprvasya api grahaam bhavati ti e paribh kartavy . kni etasy paribhy prayojanni . prayojanam samsataddhitavidhisvar . samsa . avatapenakulasthitam te etat udakeviram te etat sagatikena sanakulena ca samsa siddha bhavati . samsa . taddhitavidhi . skinam vyvakro . samghtt taddhitopatti siddh bhavati . taddhitavidhi . svara . drt gata drdgata iti . anta ththaghaktjabitrakm iti ea svara siddha bhavati . krdgrahae gatikrakaprvasya api grahaam bhavati iti na doa bhavati . s tarhi e paribh kartavy . na kartavy . cryapravrtti jpayati bhavati e paribha iti yat ayam gati anantara iti anantaragrahaam karoti . (P_1,4.14) KA_I,318.20-319.6 Ro_II,361-362 antagrahaam kimartham na supti padam iti eva ucyate . kena idnm tadantnm bhaviyati . tadantavidhin . ata uttaram pahati . padasajym antavacanam anyatra sajvidhau pratyayagrahae tadantavidhipratiedhrtham . padasajym antagrahaam kriyate jpakrtham . kim jpyam . etat jpayati crya anyatra sajvidhau pratyayagrahae tadantavidhi na bhavati iti . kim etasya jpane prayojanam . taraptamau gha . taraptamabantasya ghasaj na bhavati . kim ca syt . kumr gauritar . ghdiu nady hrasva bhavati iti hrasvatvam prasajyeta . yadi etat jpyate sandyant dhtava iti antagrahaam kartavyam . krttaddhitasams ca iti antagrahaam kartavyam . idam trtyam jpakrtham . dve tvat kriyete nyse eva . yat api ucyate krttaddhitasams ca iti antagrahaam kartavyam iti . na kartavyam . arthavat iti vartate krttaddhntam ca eva arthavat na keval krta taddhit v . (P_1,4.15) KA_I,319.8-9 Ro_II,363 kimartham idam ucyate na subantam padam iti eva siddham . niyamrtha ayamrambha . nntameva kye padasajam bhavati na anyat . kva m bht . vcyati srucyati .

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (169 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(P_1,4.17) KA_I,319.11-22 Ro_II,363-364 asarvanmasthne iti ucyate . tatra te rj tak asarvanmasthne iti padasajy pratiedha prasajyeta . na apratiedht . na ayam prasajyapratiedha sarvanmasthne na iti . kim tarhi . paryudsa ayam yat anyat sarvanmasthnt iti . sarvanmasthne avypra . yadi kena citprpnoti tena bhaviyati . prvea ca prpnoti . aprpte v . atha v anantar y prpti s pratiidhyate . kuta etat . antarasya vidhi v bhavati pratiedha v iti . prv prpti apratiiddh tay bhaviyati . nanu ca iyam prpti prvm prptim bdhate . na utsahate pratiiddh sat bdhitum . atha v yogavibhga kariyate . svdiu prvam padasajam bhavati . tata sarvanmasthne ayaciprvam padasajam bhavati . tato bham . bhasajam ca bhavati yajdau asarvanmasthne iti . yadi tarhi sau api padam bhavati eca plutavikre padntagrahaam coditam iha m bht bhadram karoi gau iti tasmin kriyame api prpnoti . vkyapadayo antyasya iti evam tat . bhuvadvadbhya dhrayadbhya etayo padasaj vaktavy . bhuvadvadbhya dhrayadvadbhya . (P_1,4.18) KA_I,320.2-14 Ro_II,365-366 bhasajym uttarapadalope aa pratiedha . bhasajym uttarapadalope aa pratiedha vaktavya . anukampita aaguli aika . siddham aca sthnivattvt . siddham etat . katham . aca sthnivadbhvt bhasaj na bhaviyati . iha api tarhi prpnoti . vgrdatta vcika iti . vakyati etat : siddham ekkaraprvapadnm uttarapadalopavacant iti . iha api tarhi prpnoti aaguli aika iti . vakyati etat : aa hjdivacant siddham iti . nabhogiromanum vati upasamkhynam . nabhogiromanum vati upasamkhynam kartavyam . nabhasvat agirasvat manuvat . vra vasvavayo . vra iti etasya vasvaayo bhasaj vaktavy . vravasu vraavasya yat ira vraavasya mene . (P_1,4.19) KA_I,320.16-21 Ro_II,366-367 arthagrahaam kimartham na tasau matau iti eva ucyeta . tasau matau iti iyati ucyamne ihaiva syt payasvn yaasvn . iha na syt payasv yaasv . arthagrahae puna kriyame matupi ca siddham bhavati ya ca nya tena samnrtha tasmin ca . yadi arthagrahaam kriyate payasvn yaasvn atra na prpnoti . kim kraam . na hi matup matvarthe vartate . matup api matvarthe vartate . tat yath devadattalym brhma nyantm iti ukte yadi devadatta pi brhmaa bhavati sa api nyate . (P_1,4.20) KA_I,320.23 Ro_II,367 rkvat gaena . ubhayasajnyapi iti vaktavyam . sa suhubh sa

(P_1,4.21.1) KA_I,321.2-27 Ro_II,368-372 bahuu bahuvacanam iti ucyate . keu bahuu . artheu . yadi evam vrka plaka atra api prpnoti . bahava te arth mlam skandha phalam palam iti . evam tarhi ekavacanam dvivacanam bahuvacanamiti abdasaj et . yeu artheu svdaya vidhyante teu bahuu . keu ca artheu svdaya vidhyante . karmdiu . na vai karmdaya vibhaktyarth . ke tarhi . ekatvdaya . ekatvdiu api vai vibhakyartheu avayam karmdaya nimittatvena updey . karmaa ekatve karmaa dvitve karmaa bahutve iti . sa tarhi tath nirdea kartavya . na hi antarea bhvapratyayam guapradhna bhavati nirdea . iha ca : iti eke manyante , tat eke manyante iti paratvt ekavacanam prpnoti . bahuu bahuvacanam iti ea yoga para
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (170 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

kariyate . straviparysa krta bhavati . iha ca : bahu odana , bahu spa iti paratvt bahuvacanam prpnoti . na ea doa . yat tvat ucyate na hi antarea bhvaprayayam guapradhna bhavati nirdea iti tan na . antarea api bhvapratyayam guapradhna bhavati nirdea . katham . iha kad cit gua guivieaka bhavati . tat yath paa ukla iti . kad cit ca guin gua vypadiyate . pahasya ukla iti . tat yad tvat gua guivieaka bhavati paa ukla iti tad smndhikarayam guaguino . tad na antarea bhvapratyayam guapradhna bhavati nirdea . yad tu guin gua vyapadiyate paasya ukla iti svapradhna tad gua bhavati . tad dravye ah . tad antarea bhvapratyayam guaapradhna bhavati nirdea . na ca iha vayam ekatvdibhi karmdn vieayiyma . kim tarhi . karmdibhi ekatvdn vieayiyma . katham . ekasmin ekavacanam . kasyaikasmin . karmaa . dvayo dvivacanam . kayo dvayo . karmao . bahuu bahuvacanam . kem bahuu . karmam iti . katham bahuu bahuvacanamiti . etat eva jpayati crya nndhikaraavc ya bahuabda tasya idam grahaam na vaipulyavcina iti . kim etasya jpane prayojanam . yat uktam bahu odana bahu spa iti paratvt bahuvacanam prpnoti iti sa doa na bhavati . yat apyucyate iti eke manyante tat eke manyanta iti paratvt ekavacanam prpnoti iti na ea doa . ekaabda ayam bahvartha . asti eva samkhyvc . tat yath eka dvau bahava iti . asti asahyavc . tat yath ekgnaya ekahalni ekkibhi kudrakai jitam iti . asti anyrthe vartate . tat yath sadhamda dyumna ek t . any iti artha . tat ya anyrthe vartate tasya ea prayoga . (P_1,4.21.2) KA_I,322.1-25 Ro_II,372-375 kimartham puna idam ucyate . suptim avieavidhnt drtaviprayogatvt ca niyamrtham vacanam . supa avieea prtipadikamtrt vidhyante . tia avieea dhtumtrt vidhyante . tatra etat syt yadi apyavieea vidhyante na eva viprayoga lakyate iti . draviprayogatvt ca . dryate khalu api viprayoga . tadyath : aki me daranyni , pd me sukumr iti . suptio avieavidhnt draviprayogatvt ca vyatikara prpnoti . iyate ca avyatikara syt iti . tat ca antarea yatnam na sidhyati iti niyamrtham vacanam . evamartham idam ucyate . atha etasmin niyamrthe sati kim puna ayam pratyayaniyama : ekasmin eva ekavacanam , dvayo eva dvivacanam , bahuu eva bahuvacanam iti . hosvit arthaniyama : ekasmin ekavacanam eva , dvayo dvivacanam eva , bahuu bahuvacanam eva iti . ka ca atra viea . tatra pratyayaniyame avyaynm padasajbhva asubantatvt . tatra pratyayaniyame avyaynm padasaj na prpnoti . uccai ncai iti . kim kraam . asubantatvt . arthaniyame siddham . arthaniyame siddham bhavati . astu arthaniyama . atha v puna astu pratyayaniyama . nanu ca uktam : tatra pratyayaniyame avyaynm padasajbhva asubantatvt iti . na ea doa . supm karmdaya api arth sakhy ca eva tath tim . supm sakhy ca eva artha karmdaya ca . tath tim . prasiddha niyama tatra . prasiddha tatra niyama . niyama prakrteu v . atha v prakrtn arthn apekya niyama . ke ca prakrt . ekatvdaya . ekasmin eva ekavacanam na dvayo na bahuu . dvayo eva dvivacanam naikasmin na bahuu . bahuu eva bahuvacanam na dvayo na ekasmin iti . atha v cryapravrtti jpayati utpadyante avyayebhya svdaya iti yat ayam avyayt psupa iti avyayt lukam sti .

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (171 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(P_1,4.23.1) KA_I,323.2-324.5 Ro_II,376-379 kim idam krake iti . sajnirdea . kim vaktavyam etat . na hi . katham anucyamnam gasyate . iha hi vykarae ye v ete loke prattapadrthak abd tai nirde kriyante pau apatyam devat iti y v et krtrim ighughabhasaj tbhi . na ca ayam loke dhruvdnm prattapadrthaka abda na khalu api krtrim saj anyatra avidhnt . sajdhikra ca ayam . tatra kim anyat akyam vijtum anyat ata sajy . krake iti sajnirdea cetsajina api nirdea . krake iti sajnirdea cetsajina api nirdea kartavya . sdhakam nirvartakam krakasajam bhavati iti vaktavyam . itarath hi aniaprasaga grmasya sampt gacchati iti akrakasya . itarath hi aniam prasajyeta . akrakasya api apddanasaj prasajyeta . kva . grmasya sampt gacchati iti . na ea doa . na atra grma apyayukta . kim tarhi . sampam . yad ca grma apyayukta bhavati bhavati tad apdnasaj . tat yath grmt gacchati iti . karmasajprasaga akathitasya brhmaasya putram panthnam prcchati iti . karmasaj ca prpnoti akathitasya. kva . brhmaasya putram panthnam prcchati iti . na ea doa . ayam akathitaabda asti eva sakrtite vartate . tat yath ka cit kam cit sacakya ha asau atra akathita . asakrtita iti gamyate . asti aprdhnye vartate . tat yath akathita asau grme akathita asau nagare iti ucyate ya yatra apradhna bhavati . tat yad aprdhnye akathitabda vartate tad ea doa karmasajprasaga akathitasya brhmaasya putram panthnam prcchati iti . apdnam ca vrkasya param patati iti . apdnasaj ca prpnoti . kva . vrkasya param patati . kuyasya pia patati iti . n v apyasyvivakitatvt . na v ea doa . kim kraam . apyasya avivakitatvt . na atra apya vivakita . kim tarhi . sambandha . yad ca apya vivakita bhavati bhavati tad apdnasaj . tat yath . vrkt param patati iti . sambandhastu tad na vivakita bhavati . na jyate kakasya v kurarasya v iti . (P_1,4.23.2) KA_I,324.6-326.17 Ro_II,379-386 ayam tarhi doa karmasajprasaga ca akathitasya brhmaasya putram panthnam prcchati iti . na ea doa . kraka iti mahat saj kriyate . saj ca nma yata na laghya . kuta etat . laghvartham hi sajkraam . tatra mahaty sajy karae etatprayojanam anvarthasaj yath vijyeta . karoti iti krakam iti . anvartham iti cet akartari kartrabdnupapatti . anvartham iti cet akartari kartrabda na upapadyate . karaam krakam adhikaraam krakam iti . siddham tu pratikrakam kriybhedt pacdnm karadhikaraayo kartrbhva . siddha karadhikaraayo kartrbhva . kuta . pratikrakam kriybhedt pacdnm . pacdnm hi pratikrakam kriy bhidyate . kim idam pratikrakam iti . krakam krakam prati pratikrakam . ka asau pratikrakam kriybheda pacdnm . adhirayaodaksecanataulvapanaidhopadakaraikriy pradhnasya kartu pka . adhirayaodaksecanataulvapanaidhopakaradikriy kurvan eva devadatta pacati iti ucyate . tatra tad paci vartate . ea pradhnakartu pka . etat pradhnakartu kartrtvam . droam pacati hakam pacati ti sambhavanakriy dhraakriy ca adhikaraasya pka . droam pacati hakam pacati iti sambhavanakriym dhraakriym ca kurvat sthl pacati iti ucatye . tatra tad paci vartate . ea dhikaraasya pka . etat adhikaraasya kartrtvam . edh pakyanti viklitte jvaliyanti iti jvalvanakriy karaasya pka . edh pakyanti viklitte jvaliyanti iti kurvanti khni pacanti iti ucyante . tatra tad paci vartate . ea karaasya pka .etat karaasya kartrtvam . udyamananiptanni kartu chidikriy .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (172 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

udyamananiptanni kurvan devadatta chinatti iti ucyate . tatra tad chidi vartate . ea pradhnakartu cheda . etat pradhnakartu kartrtvam . yat tat na trena tatparao chedanam . yat tat samne udyamane niptane ca paraun chidyate na trena tat parao chedanam . avayam ca etat evam vijeyam . itarath hi asitrayo chedane aviea syt . ya hi manyata udyamananiptant eva etat bhavati chinatti iti asitrayo chedane na tasya viea syt . yat asin chidyate trena api tat chidyeta . apdndnm tu aprasiddhi . apdndnm kartrtvasya aprasiddhi . yath hi bhavat karadhikaraayo kartrtvam nirdaritam na tath apdndnm kartrtvam nidaryate . na v svatantraparatantratvt tayo paryyea vacanam vacanray ca saj . na v ea doa . kim kraam . svatantraparatantratvt . sarvatra eva atra svtantryam pratantryam ca vivakitam . tayo paryyea vacanam . tayo svtantryapratantryayo paryyea vacanam bhaviyati . vacanray ca saj bhaviyati . tat yath . balhakt vidyotate . balhake vidyotate . balhaka vidyotate iti . kim tarhi ucyate apdndnm tu aprasiddhi iti . evam tarhi na brma apdndnm kartrtvasya aprasiddhi iti . paryptam karadhikaraayo kartrtvam nidaritam apdnnm kartrtvanirdaranya . parypta hyeka pulka sthly nirdaranya . kim tarhi . sajy aprasiddhi . yvat sarvatra eva atra svtantryam vidyate pratantryam ca tatra paratvt kartrsaj eva prpnoti . atra api na v svatantryaparatantratvt tayo paryyea vacanam vacanray ca saj iti eva . yath puna idam sthly svtantryam nidaritam sambhavanakriym dhraakriym ca kurvat sthl svatantr iti kva idnm paratantr syt . yat tat praklanam parivartanam v . na vai evamartham sthl updiyate praklanam parivartanam ca kariymi iti . katham tarhi . sambhavanakriym dhraakriym ca kariyati iti . tatra ca sau svatantr . kva idnm paratantr . evam tarhi sthlsthe yatne kathyamne sthl svatantr kartrsthe yatne kathyamne paratantr . nanu ca bho kartrsthe api vai yatne kathyamne sthl sambhavanakriym dhraakriym ca karoti . tatra asau svatantr . kva idnm paratantr . evam tarhi pradhnena samavye sthl paratantr vyavye svatantr . tat yath amtydnm rj saha samavye pratantryam vyavye svtantryam . kim puna pradhnam . kart . katham puna jyate kart pradhnam iti . yat sarveu sdhaneu samnihiteu kart pravartayit bhavati . nanu ca bho pradhnena api vai samavye sthly anenrtha adhikaraam krakam iti . na hi krakam iti anena adhikaraatvam uktam adhikaraamiti v krakatvam . ubhau ca anyonyavieakau bhavata . katham . ekadravyasamavyitvt . tat yath grgya devadatta iti . na hi grgya iti anena devadattatvam uktam devadatta iti anena v grgyatvam . ubhau ca anyonyavieakau bhavata ekadravyasamavyitvt . evam tarhi smnyabht kriy vartate tasy nirvartakam krakam . atha v yvat bryt kriyymiti tvat krake iti . evam ca krtv nirdea upapanna bhavati krake iti . itarath hi krakeu iti bryt . (P_1,4.24.1) KA_I,326.19-19-327.21 Ro_II,387-392 dhruvam iti kimartham . grmt gacchati akaena . na etat asti . karaasaj atra bdhik bhaviyati . idam tarhi grmt gacchan kasaptrym pin odanam bhukte iti . atra api adhikaraasaj bdhik bhaviyati . idam tarhi vrkasya param patati . kuyasya pia patiti iti . jugupsvirmapramdrthnm upasamkhynam . jugupsvirmapramdrthnm upasamkhynam kartavyam . jugups . adharmt jugupsate. adharmt bbhatsate . virma |
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (173 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

dharmt viramati. dharmt nivartate . pramda . dharmt pramdyati . dharmt muhyati . iha ca upasamkhynam kartavyam . smkyakebhya paliputrak abhirpatar iti . tat tarhi idam vaktavyam . na vaktavyam . iha tvat adharmt jugupsate adharmt bbhatsate iti . ya ea manuya prekprvakr bhavati sa payati dukha adharma na anena krtyam asti iti . sa buddhy samprpya nivartate . tatra dhruvamapye apdnam iti eva siddham . iha ca dharmt viramati dharmt nivartate iti dharmt pramdyati dharmt muhyati iti . ya ea manuya sambhinnabuddhi bhavati sa payati na idam kim cit dharma nma na enam kariymi iti . sa buddhy samprpya nivartate . tatra dhruvamapye apdnam iti eva siddham . iha ca smkyakebhya paliputrak abhirpatar iti . ya tai smyam gatavn bhavati sa etatprayukte . gatiyukteu apdnasaj na papadyate adhruvatvt . gatiyukteu apdnasaj na upapadyate . avt trastt patita . ratht pravtt patita . srtht gacchata hna iti . kim kraam . adhruvatvt . na v adhrauvyasya avivikitatvt . na v ea doa . kim kraam . adhrauvyasya avivakitatvt . na atra adhrauvyam vivakitam . kim tarhi . dhrauvyam . iha tvat avt trastt patita iti . yat tadave avatvam ugmitvam tat dhruvam tat ca vivakitam . ratht pravtt patita iti yat tat rathe rathatvam ramante asmin ratha iti tat dhruvam tat ca vivakitam . srtht gacchata hna iti yat tatsrthe srthatvam sahrthbhva tat dhruvam tat ca vivakiktam . yadi api tvat atra etat akyate vaktum ye tu ete atyantagatiyukt tatra katham . dhvata patita . tvaramt patita iti . atra api na v adhrauvyasya avivakitatvt iti eva siddham . katham puna sata nma avivak syt . sata api avivak bhavati . tat yath alomik eak . anudar kanya iti . asata ca vivak bhavati . samudra kuik . vindhya vardhitakam iti . (P_1,4.24.2) KA_I,327.23-328.3 Ro_II,392-393 ayam yoga akya avaktum . katham vrkebhya bibheti dasyubhya bibheti caurebhya tryate dasyubhya tryate iti . iha tvat vrkebhya bibheti dasyubhya bibheti iti . ya ea manuya prekprvakr bhavati sa payati yadi mm vrk payanti dhruva me mrtyu iti . sa buddhy samprpya nivartate . tatra dhruvam apye apdnam iti eva siddham . iha caurebhya tryate dasyubhya tryate iti . ya ea manuya prekprvakr bhavati sa payati yadi imam payanti dhruvam asya vadhabandhaparikle iti . sa buddhy samprpya nivartate . tatra dhruvam apye apdnam iti eva siddham . (P_1,4.26) KA_I,328.5-8 Ro_II,393 ayam api yoga akya avaktum . katham adhyayant parjayate iti . ya ea manuya prekprvakr bhavati sa payati dukham adhyayanam durdharam ca gurava ca durupacr iti . sa buddhy samprpya nivartate . tatra dhruvam apye apdnam iti eva siddham . (P_1,4.27) KA_I,328.10-24 Ro_II,393-395 kim udharaam . mebhya g vrayati . bhaved yasya m na gva tasya m psit syu . yasya tu khalu gva na m katham tasya m psit syu . tasya api m eva psit . ta ca psit yavebhy g vrayati . iha kpt andham vrayati iti kpe apdnasaj na prpnoti . na hi tasya kpa psita . ka tarhi . andha . tasya api kpa eva psita . payati ayam andha kpam m prpat iti . atha v yath eva asya anyatra apayata ps evam kpe api . iha agne mavakam vrayati iti mavake apdnasaj prpnoti . karmasajtra bdhik bhaviyati . agnau api tarhi bdhik syt . tasmt vaktavyam karmaa yat psitam iti
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (174 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

psitepsitam iti v . vraartheu karmagrahanarthakyam kartu psitatamam karma iti vacant . vrartheu karmagrahaam anarthakam . kim kraam . kartu psitatamam karma iti vacant . kartu psitatamam karma iti eva siddham . ayam api yoga akya avaktum . katham mebhya g vrayati iti . payati ayam yadi im gva tatra gacchanti dhruvam sasyavina sasyavine adharma ca eva rjabhayam ca . sa buddhy samprpya nivartate . tatra dhruvam apye apdnam iti eva siddham . (P_1,4.28) KA_I,329.2-4 Ro_II,396 ayam api yoga akya avaktum . katham updhyyt antardhatte iti . payati ayam yadi mm updhyya payati dhruvam preaam uplambha v iti . sa buddhy samprpya nivartate . tatra dhruvam apye apdnam iti eva siddham . (P_1,4.29) KA_I,329.6-22 Ro_II,396-398 upayoge iti kimartham . naasya roti . granthikasya roti . upayoge iti ucyamne api atra prpnoti . ea api hi upayoga . ta ca upayoga yat rambhak ragam gacchanti naasya royma , granthikasya royma iti . evam tarhi upayoge iti ucyate sarva ca upayoga . tatra prakaragati vijsyate : sdhya ya upayoga iti . ka ca sdhya . ya granthrthayo . atha v upayoga ka bhavitum arhati . ya niyamaprvaka . tat yath upayukt mavak iti ucyante ye ete niyamaprvakam adhtavanta bhavanti . kim puna khyt anupayoge krakam hosvit akrakam . ka ca atra viea . khyt anupayoge krakam iti cet akathitvt karmasajprasaga . khyt anupayoge krakam iti cet akathitvt karmasaj prpnoti . astu tarhi akrakam . akrakam iti cet upayogavacannarthakyam . yadi akrakam upayogavacanam anarthakam . astu tarhi krakam . nanu ca uktam khyt anupayoge krakam iti cet akathitatvt karmasajprasaga iti . na ea doa . parigaanam tatra kriyate . duhiycirudhipracchibhikicim iti . ayam api yoga akya avaktum . katham updhyyt adhte iti . apakrmati tasmt tadadhyayanam . yadi apakrmati kim na atyantya apakrmati . sattatatvt . atha v jyotirvat jnni bhavanti . (P_1,4.30) KA_I,329.24-330.2 Ro_II,399 ayam api yoga akya avaktum . katham gomayt vrcika jyate . golomvilomabhya durv jyante iti . apakrmanti t tebhya . yadi apakrmati kim na atyantya apakrmati . santatatvt . atha v any cany ca prdurbhavanti . (P_1,4.31) KA_I,330.4-6 Ro_II,399 ayam api yoga akya avaktum . katham himavata gag prabhavati iti . apakrmanti t tasmt pa . yadi apakrmati kim na atyantya apakrmati . santatatvt . atha v any cany ca prdurbhavanti . (P_1,4.32.1) KA_I,330.8-17 Ro_II,400-401 karmagrahaam kimartham . yam abhipraiti sa sampradnam iti iyati ucyamne karmaa eva sampradnasaj prasajyeta . karmagrahae puna kriyame na doa bhavati . karma nimittatvena ryate . atha yamsagrahaam kimartham . karma abhipraiti sampradnam iti iyati ucyamne abhiprayata eva sampradnasaj prasajyeta . yamsagrahae puna kriyame na doa bhavati . yamsagrahat abhiprayata sampradnasaj nirbhajyate . atha abhipragrahaam kimartham . karma yam eti sa sampradnam iti iyati ucyamne yam eva sampratyeti tatra eva syt . updhyyya gm dadti iti . iha na syt . updhyyya gm adt . updhyyya
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (175 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

gm dsyati iti . abhipragrahae puna kriyame na doa bhavati . abhi bhimukhye vartate praabda dikarmai . tena yam ca abhipraiti yam ca abhipraiyati yam ca abhiprgd bhimukhyamtre sarvatra siddham bhavati . (P_1,4.32.2) KA_I,330.18-331.4 Ro_II,401-403 kriygrahaam api kartavyam . iha api yath syt . rddhya nigarhate . yuddhya sannahyate . patye ete iti . tat tarhi vaktavyam . na vaktavyam . katham . kriym hi loke karma iti upacaranti . km kriym kariyasi . kim karma kariyasi iti . evam api kartavyam . krtrimkrtrimayo krtrime sampratyaya bhavati . kriy api krtrimam karma . na sidhyati . kartu psitatamam karma iti ucyate katham ca nma kriyay kriy psitatam syt . kriy api kriyay psitatam bhavati . kay kriyay . sandaranakriyay v prrthayatikriyay v adhyavasyatikriyay v . iha ya ea manuya prekprvakr bhavati sa buddhy tvat kamcidartham sampayati sandre prrthan prrthanym adhavasya adhyavasye rambha rambhe nirvrtti nirvrttau phalvpti . evam kriy api krtrimam karma . evam api karmaa karaasaj vaktavy sampradnasya ca karmasaj . paun rudram yajate . paum rudrya dadti iti artha . agnau kila pau prakipyate tat rudrya pahriyate iti . (P_1,4.37) KA_I,331.6-9 Ro_II,403-404 kimete ekrth hosvit nnrth . kim ca ata . yadi ekrth kimartham prthak nirdiyante . atha nnrth katham kupin akyante vieayitum . evam tarhi nnrth kupau tu em smnyam asti . na hi akupita krudhyate na v akupita druhyati na v akupita ryati na v akupita asyati . (P_1,4.42) KA_I,331.11-332.3 Ro_II,404-406 tamagrahaam kimartham na sdhakam karaam iti eva ucyeta dhakam karaam iti iyati ucyamne sarvem krakm karaasaj prasajyeta . sarvi hi kraki sdhakni . tamagrahae puna kriyame na doa bhavati . na etat asti prayojanam . prv tvat saj apavdatvt bdhik bhaviyanti par paratvt ca anavakatvt ca . iha tarhi dhanu vidhyati apyayuktatvt ca apdnasaj sdhakatvt ca karaasaj prpnoti . tamagrahae puna kriyame na doa bhavati . evam tarhi lokata etat siddham . tat yath . loke abhirpya udakamneyam abhirpya kany dey iti na ca anabhirpe pravrtti asti . tatra abhirpatamya iti gamyate . evam iha api sdhakam karaam iti ucyate sarvi ca kraki sdhakni na ca asdhake pravrtti asti . tatra sdhakatamam iti vijsyate . evam tarhi siddhe sati yat tamagrahaam karoti tat jpayati crya krakasajym taratamayoga na bhavati iti . kim etasya jpane prayojanam . apdnam crya kim nyyyam manyate . yatra samprpya nivrtti . tena iha eva syt grmt gacchati nagart gacchati iti . skyakebhya paliputrak abhirpatar iti atra na syt . krakasajym taratamayoga na bhavati iti atra api siddham bhavati . tath dhram crya kim nyyyam manyate . yatra krtsna dhrtm vypta bhavati . tena iha eva syt tileu tailam dadhni sarpi iti . gagym gva kpe gargarkulam iti atra na syt . krakasajym taratamayoga na bhavati iti atra api siddham bhavati . (P_1,4.48) KA_I,332.5-8 Ro_II,406-407 vase ayarthasya pratiedha . vase ayarthasya pratiedha vaktavya . grma upavasati iti . sa tarhi vaktavya . na vaktavya . na atra upaprvasya vase grma adhikaraam . kasya tarhi . anupasargasya . grme asau vasan trirtram upavasati iti .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (176 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(P_1,4.49.1) KA_I,332.10-13 Ro_II,407 tamagrahaam kimartham . kartu psitam karma iti iyati ucyamne iha: agne mavakam vrayati iti mavake apdnasaj prasajyeta . na ea doa . karmasaj tatra bdhik bhaviyati . agnau api tarhi bdhik syt . iha puna tamagrahae kriyame tat upapannam bhavati yat uktam vrartheu karmagrahanarthakyam kartu psitatamam karma iti vacant iti . (P_1,4.49.2) KA_I,332.14-25 Ro_II,408-409 iha ucyate odanam pacati iti . yadi odana pacyeta dravyntarama bhinirvarteta . na ea doa . tdarthyt tcchabdyam bhaviyati . odanrth taul odana iti . atha iha katham bhavitavyam tauln odanam pacati iti hosvit taulnm odanam pacati iti . ubhyath api bhavitavyam . katham . iha hi tauln odanam pacati iti dvyartha paci . tauln pacan odanam nirvartayati iti . iha idanm taulnm odanam pacati iti dvyartha ca eva paci vikrayoge ca ah . taulavikram odanam nirvartayati iti . iha ka cit kam cidmantrayate siddham bhujyatm iti . sa mantrayama ha prabhtam bhuktam asmbhi iti . mantrayama ha dadhi khalu bhaviyati paya khalu bhaviyati . mantryama ha dadhn khalu bhujya payas khalu bhujya iti . atra karmasaj prpnoti . tat hi tasya psitatamam bhavati . tasya api odana eva eva psitatama na tu gueu asya anurodha . tat yath bhujya aham odanam yadi mrduviada syt iti evam iha api dadhiguam odanam bhujya payoguamodanam bhujya iti . (P_1,4.49.3) KA_I,333.1-11 Ro_II,410-411 psitasya karmasajym nirvrttasya krakatve karmasajprasaga kriyepsitatvt . psitasya karmasajym nirvrttasya krakatve karmasaj na prpnoti . guam bhakayati iti . kim kraam . kriyepsitatvt . kriy tasya psit . na v ubhayepsitatvt . na v ea doa . kim kraam . ubhayepsitatvt . ubhayam tasya psitam . ta ca ubhayam yasya hi guabhakae buddhi prasakt bhavati na asau loam bhakayitv krt bhavati . yadi api tvat atra etat akyate vaktum ye tu ete rjakarmia manuy tem ka cit kam cit ha kaam kuru iti . sa ha na aham kaam kariymi ghaa may hrta iti . tasya kriymtram psitam . yadi api tasya kriymtram psitam ya tu asau preayati tasya ubhayam psitam iti . (P_1,4.50) KA_I,333.13-23 Ro_II,411-412 kim udharaam . viam bhakayati iti . na etat asti . prvea api etat sidhyati . na sidhyati . kartu psitatamam karma iti ucyate kasya ca nma viabhakaam psitam syt . viabhakaam api kasya cit psitam bhavati . katham . iha ya ea manuya dukhrta bhavati sa anyni dukhni anuniamya viabhakaam eva jyya manyate . ta ca psitam yat tat bhakayati . yat tarthi anyat kariymi iti anyat karoti tat udharaam . kim puna tat . grmntaram ayam gacchan caurn payati ahim laghayati kaakn mrdnti . iha psitasya api karmasaj rabhyate anpsitasya api . yat idnm na eva psitamam na api anpsitam tatra katham bhavitavyam . grmntaram ayam gacchan vrkamlni upasarpati kuyamlni upasarpati iti . atra api siddham . katham . anpsitam iti na ayam prasajyapratiedha psitam na iti . kim tarhi . paryudsa ayam yat anyat psitt tat anpsitam iti . anyat ca etat psitt yat na eva psitam na api anpsitam iti . (P_1,4.51.1) KA_I,333.25-334.15 Ro_II,413-418 kena akathitam . apdndibhi

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (177 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

vieakathbhi . kim udharaam . duhiycirudhiprachibhikicim upayoganimittam aprvavidhau bruvisiguena ca yatsacate tat akrtitam caritam kavin . duhi : gm dogdhi paya . na etat asti . kathit atra prv apdansaj . duhi . yci : idam tarhi pauravam gm ycate iti . na etat asti . kathit atra prv apdansaj . na ycant eva apya bhavati . ycita asau yadi dadti tata apyena yujyate . yci . rudhi : anvavaruaddhi gm vrajam . na etat asti . kathit atra prv adhikaraasaj . rudhi . pracchi : mavakam panthnam prcchati . na etat asti . kathit atra prv apdnasaj . na prant eva apya bhavati . prta asau yadi ce tata apyena yujyate . pracchi. bhiki : pauravam gm bhikate . na etat asti . kathit atra prv apdnasaj . na bhikat eva apya bhavati . bhikita asau yadi dadti tata apyena yujyate . bhiki . ci : vrkam avacinoti phalni . na etat asti . kathit atra prv apdnasaj . bruvisiguena ca yat sacate tat akrtitam caritam kavin . bruvisiguena ca yat sacate sambadhyate tat ca dharaam . kim puna tat . putram brte dharmam . putram anusti dharmam iti . na etat asti . kathit atra prv sampradnasaj . tasmt tri eva udharani . pauravam gm ycate . mavakam panthnam prcchati . pauravam gm bhikate iti . (P_1,4.51.2) KA_I,334.16-335.28 Ro_II,418-424 atha ye dhtnm dvikarmak tem kim kathite ldaya bhavanti hosvit akathite . kathite ldaya . kathite ldibhi abhihite guamkarmai k kartavy . kathite ldaya cet syu am kuryt tad gue . kathite ldaya cet syu ah guakarmai tad kartavy . duhyate go paya . ycyate pauravasya kambala iti . katham . akrakam hyakathitatvt . akrakam hi etat bhavati . kim kraam . akathitatvt . krakam cet tu na akath . atha krakam na akathitam . atha krake sati k kartavy . krakam cet vijnyt ym ym manyeta s bhavet . krakam cet vijntyt y y prpnoti s kartavy . duhyate go paya . ycyate pauravt kambala iti . kathite abhihite tvavidhi tvamati guakarmai ldividhi sapare . kathite ldibhi abhihite tvavidhi ea bhavati . kim idam tvavidhi iti . tava vidhi tvavidhi . tvamati . kimidam tvamati iti . tava mati tvamati . na evam anye manyante . katham tarhi anye manyante . guakarmai ldividhi sapare . guakarmai ldividhiya bhavanti saha parea yogena . gatibuddhipratyavasnrthaabdakarmkarmakm aikart sa au iti . dhruvaceitayuktiu ca api ague tat analpamate vacanam smarata . dhruvayuktiu ceitayuktiu ca api ague karmai ldaya bhavanti . tat analpmate cryasya vacanam smaryatm . apara ha : pradhnakarmai khyeye ldn hu dvikarmam . pradhnakarmai abhidheye dvikarmam dhtnm karmai ldaya bhavanti iti vaktavyam . ajm nayati grmam . aj nyate grmam . aj nt grmam iti . apradhne duhdnm . apradhne duhdnm karmai ldaya bhavanti iti vaktavyam . duhyate gau paya . yante kartu ca karmaa . ldaya bhavanti iti vaktavyam . gamyate devadatta grmam yajadattena . ke puna dhtnm dvikarmak . nvahyo harate ca api gatyarthnm tath eva ca dvikarmakeu grahaam draavyam iti nicaya . ajm nayati grmam . bhram vahati grmam . bhram harati grmam . gatyarthnm . gamayati devadattam grmam . ypayati devadattam grmam . siddham v apo anyakarmaa . siddham v puna etat bhavati . kuta . anyakarmaa . anyasya atra aj karma anyasya grma . ajm asau grhtv grmam nayati . anyakarma iti cet bryt ldnm avidhi bhavet . anyakarma iti cet bryt ldnm avidhi ayam bhavet . aj nyate grmam iti . parasdhane utpadyamnena lena ajy
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (178 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

abhidhnam na prpnoti . (P_1,4.51.3) KA_I,336.1-17 Ro_II,425-428 klabhvdhvagantavy karmasaj hi arkarmam . klabhvdhvagantavy akarmakm dhtnm karmasaj bhavanti iti vaktavyam . kla . msam ste . msam svapiti . bhva . godoham ste . godoham svapiti . adhvagantavya . kroam ste . kroam svapiti . dea ca akarmam karmasaja bhavati iti vaktavyam . kurn svapiti . pacln svapiti . vipartam tu yat karma tat kalma kavaya vidu . kimidam kalma iti . aparisamptam karma kalma . na v asmin sarvi karmakryi kriyante . kim tarhi . dvity eva . yasmin tu karmai upajyate anyat dhtvarthayog api ca yatra ah tat karma kalma iti ca kalma na uktam dhto hi vrtti na ralatvata asti . etena karmasaj sarv siddh bhavati kathitena . tatra psitasya kim syt prayojanam karmasajy . yat tu kathitam purastt psitatayuktam ca tasya siddhyartham . psitam eva tu yat syt tasya bhaviyati kathitena . atha iha katham bhavitavyam . net avasya srughnam iti hosvit net avasya srughnasya iti . ubhayath goikputra . (P_1,4.52.1) KA_I,336.19-337.13 Ro_II,429-431 abdakarma iti katham idam vijyate . abda yem kriy iti hosvit abda yem karma iti . ka ca atra viea . abdakarmanirdee abdakriym iti cet hvayatydnm pratiedha . abdakarmanirdee abdakriymiti ced hvayaddnm pratiedha vaktavya . ke puna hvayatdaya . hvayati krandati abdyate . hvayati devadatta . hvyayati devadattena . krandati devadatta . krandayati devadattena . abdyate devadatta . abdyayati devadattena iti . rotydn m ca upasamkhynam aabdakriyatvt . rotydnm ca upasamkhynam kartavyam . ke puna rotydaya . roti vijnti upalabhate . roti devadatta . rvayati devadattam . vijnti devadatta . vijpayati devadattam . upalabhate devadatta . upalambhayati devadattam . kim puna kraam na sidhyati . aabdakriyatvd . astu tarhi abda yem karma iti . abdakarmaa iti cet jalpatiprabhrtnm upasamkhynam . abdakarmaa iti cet jalpatiprabhrtnmupasakhynam kartavyam . ke puna jalpatiprabhrataya . jalpati vilapati bhate . jalpati devadatta . jalpayati devadattam . vilapati devadatta . vilpayati devadattam . bhate devadatta .bhayati devadattam . dre sarvatra . dre sarvatra upasakhynam kartavyam . payati rpatarka krpaam . darayati rpatarkam krpaam . (P_1,4.52.2) KA_I,337.14-27 Ro_II,431-432 adikhdinvahnm pratiedha . adikhdinvahnm pratiedha vaktavya . atti devadatta . dayate devadattena . apara ha : sarvam eva pratyavasnakryam ade na bhavati iti vaktavyam , parasmaipadam api . idam ekam iyate : kta adhikarae ca drauvyagatipratyavasnrthebhya : idam em jagdham . khdi . khdati devadatta . khdayati devadattena . n . nayati devadatta . nyayati devadattena . vaheraniyantrkartrkasya . vahe aniyantrkartrkasya iti vaktavyam . vahati bhram devadatta . vhayati bhram devadattena . aniyantrkartrkasya iti kimartham . vahanti yavn balvard . vhayanti balvardn yavn . bhake ahisrthasya . bhake ahimsrthasya iti vaktavyam . bhakayati pim devadatta . bhakayati pim devadattena . ahimsrthasya iti kimartham . bhakayanti yavn balvard . bhakayanti balvardn yavn . (P_1,4.52.3) KA_I,338.1-9 Ro_II,432-435 akarmakagrahae klakarmakm

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (179 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

upasakhynam . akarmakagrahae klakarmakm upasakhynam kartavyam . msam ste devadatta . msam sayati devadattam . msam ete devadatta . msam yayati devadattam . siddham tu klakarmakm akarmakavadvacant . siddham etat . katham . klakarmak akarmakavat bhavanti iti vaktavyam . tat tarhi vaktavyam . na vaktavyam . akarmakm iti ucyate na ca ke cit kad cit klabhvdhvabhi akarmak . te evam vijsyma . kva cit ye akarmak iti . atha v yena karma sakarmk ca akarmak ca bhavanti tena akarmakm . na ca etena karma ka cit api akarmaka . atha v yat karma bhavati na ca bhavati tena karmakm . na ca etat karma kva cit api na bhavati . (P_1,4.53) KA_I,338.11-15 Ro_II,435 hrkro vvacane abhivdidryo tmanepade upasakhynam . hrkrorvvacane abhivdidro tmanepade upasakhynam kartavyam . abhivadati gurum devadatta . abhivdayate gurum devadattam . abhivdayate gurum devadattena . payanti bhrty rjnam . darayate bhrtyn rj . darayate bhrtyai rj . katham ca atra tmanepadam . ekasya e aau i ti aparasya ica ca iti . (P_1,4.54.1) KA_I,338.17-20 Ro_II,435-436 kim yasya svam tantram sa svatantra . kim ca ata . tantuvye prpnoti . na ea doa . ayam tantraabda asti eva vitne vartate . tat yath : stram tantram . pretam tantram . vitna iti gamyate . asti prdhnye vartate . tat yath svatantra asau brhmaa iti ucyate . svapradhna iti gamyate . tat ya prdhnye vartate tantraabda tasya idam grahaam . (P_1,4.54.2) KA_I,338.21-339.9 Ro_II, 436-438 svatantrasya kartrsajym hetumati upasakhynam asvatrantvt . svatantrasya kartrsajym hetumati upasakhynam kartavyam . pcayati odanam devadatta yajadattena iti . kim puna kraam na sidhyati . asvatantratvt . na v svtrantryt itarath hi akurvati api krayati iti syt . na v kartavyam . kim kraam . svtantryt . svatantra asau bhavati . itarath hi akurvati api krayati iti syt . ya hi manyate na asau svatantra akurvati api tasya krayati iti etat syt . na akurvat i iti cet svatantra . na cet akurvati tasmin krayati iti etat bhavati svatantra asau bhavati . akyam tvat anena upasamkhynam kurvat vaktum kurvan svatantra akurvan na iti . sdhya jpakam bhavati . preite ca kila ayam kriym ca akriym ca drv adhyavasyati kurvan svatantra akurvan na iti . yadi ca preita asau na karoti svatantra asau bhavati iti . (P_1,4.55) KA_I,339.11-21 Ro_II,438-439 praie asvatantraprayojakatvt hetusajprasiddhi . praie asvatantraprayojakatvt hetusajy aprasiddhi . svatantraprayojaka hetusaja bhavati iti ucyate . na ca asau svatantram prayojayati . svatantratvt siddham . siddham etat . katham . svatantratvt . svatantram asau prayojayati . svatantratvt siddham iti cet svatantraparatantratvam vipratiiddam . yadi svatantra na prayojya atha prayojya na svatantra prayojya svatantra ca iti vipratiiddham . uktam v . kim uktam . ekam tvat uktam na v svtrantryt itarath hi akurvati api krayati iti syt iti . aparam uktam . na v smnyakrtatvt hetuta hi aviiam svatantraprayojakatvt aprayojaka iti cet muktamasamayena tulyam iti . (P_1,4.56) KA_I,340.2-25 Ro_II,440-442 kimartham rephdhika varaabda grhyate . rvart vvart m bht . rvart iti ucyate vvart m bht . aki amulkamulau vare
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (180 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

tosunkasunau iti . na etat asti prayojanam . cryapravrtti jpayati anantara ya varaabda tasya grahaam iti yat ayam krt mejanta iti krta mntasya ejantasya ca avyayasajm sti . krt mejanta para api sa . para api etasmt krt mnta ejanta ca asti . tadartham etat syt . yat tarhi avyaybhvasya avyayasajm sti tat jpayati crya nantara ya varaabda tasya grahaam iti . samseu avyaybhva . samsasya etat jpakam syt . avyaybhva eva samsa avyayasaja bhavati na anya iti . evam tarhi lokata etat siddham . tat yath loke vanntt udakntt priyam pnthaman uvrajet iti ya eva prathama vannta udaknta ca tata nuvrajati . laukikam ca ativartate . dvityam ca trtyam ca vanntam udakntam v anuvrajati . tasmt rephdika varaabda grahtavya . atha prgvacanam kimartham . prgvacanam sajnivrttyartham . prgvacanam kriyate niptasajy anivrtti yath syt . akriyame hi prgvacane anavak gatyupasargakarmapravacanyasaj niptasajm bdheran . t m bdhiata iti prgvacanam kriyate . atha kriyame api prgvacane yvat anavak et saj kasmt eva na bdhante . kriyame hi prgvacane satym niptasajym et avayavasaj rabhyante . tatra vacant samvea bhavati . (P_1,4.57) KA_I,341.2-9 Ro_II,442-444 ayam sattvaabda asti eva dravyapadrthaka . tat yath sattvam ayam brhmaa sattvamiyam brhma iti . asti kriypadrthaka . sadbhva sattvam iti . kasya idam grahaam . dravyapadrthakasya . kuta etat . evam hi krtv vidhi ca siddha bhavati pratiedha ca . kim puna ayam paryudsa . yat anyat sattvavacant iti . hosvit prasajya ayam pratiedha . sattvavacane na iti . kim ca ata . yadi paryudsa vipra iti atra api prpnoti . kriydravyavacana ayam samghto dravyt anyaca vidhin ryate . asti ca prdibhi smnyam iti krtv tadantavidhin niptasaj prpnoti . atha prasajyapratiedha na doa bhavati . yath na doa tath astu . (P_1,4.58-59.1) KA_I,341.11-18 Ro_II,444 prdaya iti yogavibhga . prdaya iti yogavibhga kartavya . prdaya sattvavacan niptasaj bhavanti . tata upasarg kriyyoge iti . kimartha yogavibhga . niptasajrtha . niptasaj yath syt . ekayoge hi niptasajbhva . ekayoge hi sati niptasajy abhva syt . yasmin eva viee gatyupasargakarmapravacanyasaj tasmin eva viee niptasaj syt . (P_1,4.58-59.2) KA_I,341.19-23 Ro_II,445 marucchabdasya upsakhynam . marucchabdasya upsakhynam kartavyam . maruddatto marutya . aca upasargt iti tattvam yath syt . racchabdasya upasamkhynam . racchabdasya upasamkhynam kartavyam . raddh . (P_1,4.60.1) KA_I,342.2-6 Ro_II,446 krikabdasya . krikabdasya upasakhynam kartavyam . krikkrtya . punacanasau chandasi . punacanasau chandasi gatisajau bhavata iti vaktavyam . punarutsytam vsa deyam . punarnikrta ratha . uik dta canohita . (P_1,4.60.2) KA_I,342.7-343.8 Ro_II,446-448 gatyupasargasaj kriyyoge yatkriyyukt tam prati iti vacanam . gatyupasargasaj kriyyoge yatkriyyukt tam prati gatyupasargasaj bhavanti iti vaktavyam . kim prayojanam . prayojanam gha avaatve .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (181 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

gha . pravrddha bhva prabhva . anupasarge iti pratiedha m bht . atvam . vigat secak asmt grmt visecaka grma . upasargt iti atvam m bht . atvam . pragat nyak asmt grmt pranyaka grma . upasargditi atvam m bht . vrddhividhau ca dhtugrahanarthakyam . vrddhividhau ca dhtugrahaam anarthakam . upasargt rti dhtau iti . tatra dhtugrahaasya etat prayojanam iha m bht prarabham vanam iti . kriyame ca api dhtugrahae prarcchaka iti atra prpnoti . yatkriyyukt tam prati iti vacant na bhavati . vadvidhnabhvbttvasvgdisvaraatveu doa bhavati . vadvidhi. yat udvata nivata ysi bapsat . vadvidhi . nasbhva . praasam mukham unnasam mukham . nasbhva . abttva . prepam parepam . abittva . svgdisvara . prasphik prodara . svgdisvara . atva . pra a dra pra a crya pra a rj pra a vrtrah . upasargt iti ete vidhaya na prpnuvanti . vadvidhinasbhvabttvasvgadisvaraatveu vacanaprmyt siddham . anavak ete vidhaya . te vacanaprmyt bhaviyanti . suduro pratiedha numvidhitatvaatvaatveu . suduro pratiedha numvidhitatvaatvaatveu vaktavya . numvidhi : sulabham durlabham . upasargt iti num m bht iti . na sudurbhym kevalbhym . iti etat na vaktavyam bhavati . na etat asti prayojanam . kriyate etat nyse eva . tatvam . sudattam . aca upasargt ta iti tatvam m bht iti . atvam . susiktam ghaaatena sustutam lokaatena . upasargt iti atvam m bhtiti . su pjym iti etat na vaktavyam bhavati . na etat asti prayojanam . kriyata etat nyse eva . atvam . durnayam durntamiti . upasargt iti atvam m bht iti . (P_1,4.61) KA_I,343.10-12 Ro_II,449 krbhvastiyoge iti vaktavyam . iha eva yath syt . rkrtya rbhya . iha m bht . r paktv . tat tarhi vaktavyam . na vaktavyam . kriyyoge iti anuvartate na ca anyay kriyay rydicvicm yoga asti . (P_1,4.62.1) KA_I,343.14-22 Ro_II,449-450 katham idam vijyate . ite param itiparam na itiparam anitiparam iti hosvit iti paro yasmt tat idam itiparam na itiparam anitiparamiti . kim ca ata . yadi vijyata ite param itiparam na itiparam anitiparam iti kh iti krtv nirahvat iti atra prpnoti . atha iti paro yasmt tat idam itiparam na itiparam anitiparamiti raua vaua iti krtv nirahvat iti atra prpnoti . astu tvat iti paro yasmt tat idam itiparam na itiparam anitiparamiti . nanu ca uktam raua vaua iti krtv nirahvat iti atra prpnoti iti . na ea doa . idam tvat ayam praavya . atha iha te prk dhto iti katham gatimtrasya prvaprayog bhavati . upoddharati iti . gatykrti pratinirdiyate . iha api tarhi anukarakrti nirdiyate . (P_1,4.62.2) KA_I,343.23-344. 3 Ro_II,450 kimartham idam ucyate . anukaraasya itikaraaparatvapratiedha aniaabdanivrttyartha . anukaraasya itikaraaparatvapratiedha ucyate . kim prayojanam . aniaabdanivrttyartha . anihaabdat m bht iti . idam vicrayiyati teprgdhtuvacanam prayoganiyamrtham v syt sajniyamrtham v iti . tat yad prayoganiyamrtham tad anihaabdanivrttyartham idam vaktavyam . yad hi sajniyamrtham tad na doa bhavati . (P_1,4.63) KA_I,344.5-10 Ro_II,450-451 idam atibahu kriyate dare andare sat asat iti . dre sat iti eva siddham . katham asatkrtya iti . tadantividhin bhaviyati . kena idnm andare bhaviyati . na darapratiedham vijsyma . ndare andare iti . na evam
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (182 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

akyam . daraprasage eva hi syt . andaraprasage na syt . andaragrahae puna kriyame bahuvrhi ayam vijyate . avidyamndare andare iti . tasmt andaragrahaam kartavyam . asata tu tadantavidhin siddham . (P_1,4.65) KA_I,344. 12-14 Ro_II,452 antaabdasya kividhisamsaatveu pasakhynam . antaabdasya kividhisamsaatveu pasakhynam kartavyam . a . antardh . kividhi . antardhi . samsa . antarhatya . atvam . antarhayt gobhyo g . (P_1,4.74) KA_I,344.16-345.7 Ro_II,452-453 sktprabhrtiu cvyarthagrahaam . sktprabhrtiu cvyarthagrahaam kartavyam . asktsktkrtv sktkrtya . yad hi skt eva kim cit kriyate tad m bht iti . makrntatvam ca gatisajsanniyuktam . makrntatvam ca gatisajsanniyogena vaktavyam . lavaakrtya . tatra cvipratiedha . tatra cvyantasya pratiedha vaktavya . lavakrtya . na v prvea krtatvt a v vaktavyam . kim kraam . prvea krtatvt . astu anena vibh . prvea nitya bhaviyati . idam tarhi prayojanam . makrntatvam ca gatisajsanniyuktam iti uktam . tat cvyantasya m bht iti . etat api na asti prayojanam . lavaaabdasya ayam vibh lavaamabda dea kriyate . yadi ca lava abdasya api vibh lavaamabda dea bhavati na kim cid duyati . traiabdyam ca ha sdhyam . | tacca evam sati siddham bhavati iti . (P_1,4.80) KA_I,345.9-346.14 Ro_II,453-456 kimidam prgdhtuvacanam prayoganiyamrtham : ete prk eva dhto prayoktavy . hosvit sajniyamrtham : ete prk ca akprk ca prayoktavy , prk prayujyamnnm gatisaj bhavati iti . ka ca atra viea . prgdhtuvacanam prayoganiyamrtham iti cet anukaraasya itikaraaparapratiedha aniaabdanivrttyartha . prgdhtuvacanam prayoganiyamrtham iti cet anukaraasya itikaraaparapratiedha vaktavya . kim prayojanam . aniaabdanivrttyartha . aniaabat m bht iti . chandasi paravyavahitavacanam ca . chandasi pare api vyavahit ca iti vaktavyam . sajniyame siddham . sajniyame siddham etat bhavati . astu tarhi sajniyama . ubhayo anarthakam vacanam anidarant . ubhayo api pakayo vacanamanarthakam . kim kraam . anidarant . na hi ka citprapacati iti prayoktavye pacatipra iti prayukte . yadi ca aniam dryeta tata yatnrham syt . upasarjanasannipte tu prvaparavyavasthrtham . upasarjanasannipte tu prvaparavyavasthrtham etat vaktavyam . rabham klamudrujam rabham klamudvaham . atra gate prk dhto prayoga yath syt . yadi upasarjanasannipte prvaparavyavasthrtham idam ucyate sukaamkari vran i iti atra gate prk dhto prayoga prpnoti . cryapravrtti jpayati na atra gate prkprayoga bhavati iti yat ayam addusuu krcchrkrcchrtheu khal iti khakram anubandham karoti . katham krtv jpakam . khitkarae etat prayojanam khiti iti mum yath syt iti . yadi ca atra gate prkprayoga syt khitkaraam anarthakam syt . astu atra mum . anavyayasya iti pratiedha bhaviyati . payati tu crya na atra gate prk dhato prayoga bhavati iti tata khakram anubandham karoti . na etat asti jpakam . yadi api atra gate prkprayoga syt sytevtra mumgama . katham . krdgrahae gatikrakaprvasya api grahaam bhavati iti . tasmt na artha evamarthena prgdhtuvacanena . katham rabham klamudrujam rabham klamudvaham . na ea doa . na ea udi upapadam . kim tarhi . vieaam . udi kle rujivaho . utprvbhym rujivahibhym kle upapade iti .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (183 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

(P_1,4.83) KA_I,346.16-18 Ro_II,456-457 kimartham mahat saj kriyate . anvarthasaj yath vijyeta . karma proktavanta karmapravacany iti . ke puna karma proktavanta . ye samprati kriym na hu . ke ca samprati kriym na hu . ye aprayujyamnasya kriym hu te karmapravacany . (P_1,4.84) KA_I,346.20-347.21 Ro_II,458-460 kimartham idam ucyate . karmapravacanyasaj yath syt . gatyupasargasaje m bhtm iti . kim ca syt . kalyasya samhitm anu prvarat : gati gatau iti nighta prasajyeta . yadi evam ve api karmapravacanyasaj vaktavy . ve api nighta na iyate : prdeam prdeam viparilikhati . asti atra viea . na atra ve likhim prati kriyyoga . kim tarhi . aprayujyamnam . prdeam prdeam vimya parilikhati iti . yadi evam ano api karmapravacanyasajay na artha . ano api hi na vrim prati kriyyoga . kim tarhi aprayujyamnam . kalyena sukrtm samhitm anuviamya deva prvarat . idam tarhi prayojanam dvity yath syt karmapravacanyayukte dvity iti . ata uttaram pahati . anurlakaevacannarthakyam smnyakrtatvt . anurlakaevacanrthakyam . kim kraam . smnyakrtatvt . smnyena eva atra karmapravacanyasaj bhaviyati lakaetthambhtkhynabhgavpssu pratiparyanava iti . hetvartham tu vacanam . hetvartham idam vaktavyam . hetu kalyasya samhit varasya na lakaam . kim vaktavyam etat . na hi . katham anucyamnam gasyate . lakaam hi nma sa bhavati yena puna puna lakyate na ya sakrdapi nimittatvya kalpate . sakrt ca asau kalyena sukrtm samhitm anuimya deva prvarat . sa tarhi tath . nirdea kartavya anu hetau iti . atha idnm lakaena hetu api vypta na artha anena . lakaena hetu api vypta . na hi avayam tat eva lakaam bhavati yena puna puna lakyate . kim tarhi . yat sakrt api nimittvya kalpate tat api lakaam bhavati . tat yath api bhavn kamaulapim chtram adrakt iti . sakrt sau kamaalupi chtra dra tasya tat eva lakaam bhavati . tat eva tarhi prayojanam dvity yath syt karmapravacanyayukte dvity iti . etat api na asti prayojanam . siddh atra dvity karmapravacanyayukte iti eva . na sidhyati . paratvt hetutvray trty prpnoti . (P_1,4.89) KA_I,347.23-25 Ro_II,461 marydbhividhyo iti vaktavyam . iha api yath syt kumram yaa pine iti . tat tarhi vaktavyam . na vaktavyam . marydvacane iti eva siddham . e asya yaasa maryd . (P_1,4.90) KA_I,348.2-6 Ro_II,461-462 kasya lakaadaya arth nirdiyante . vrkdnm . kimartham puna idam ucyate . karmapravacanyasaj yath syt . gatyupasargasaje m bhtm iti . na etat asti prayojanam . yatkriyyukt tam prati gatyupasargasaje bhavata na ca vrkdn prati kriyyoga . idam tarhi prayojanam dvity yath syt karmapravacanyayukte dvity iti . vrkam prati vidyotate . vrkamanu vidyotate iti . (P_1,4.93) KA_I,348.8-20 Ro_II,462-464 kimartham adhiparyo anarthakayo karmapravacanyasaj ucyate . karmapravacanyasaj yath syt . gatyupasargasaje m bhtm iti . na etat asti prayojanam . yatkriyyukt tam prati gatyupasargasaje bhavata anarthakau ca imau . idam tarhi prayojanam pacam yath syt pacam
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (184 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

apparibhi iti . kuta parygamyata iti . siddh atra pacam apdne iti eva . ta ca apdnapacam e . yatra api adhiabdena yoge pacam na vidhyate tatra api ryate . kuta adhygamyata iti . evam tarhi siddhe sati yat anarthakayo gatyupasargasajbdhikm karmapravacanyasajm sti tat jpayati crya anarthaknm api em bhavati arthavatkrtam iti . kim etasya jpane prayojanam . niptasya anarthakasya prtipadikatvam coditam . tat na vaktavyam bhavati . atha v na eva imau anarthakau . kim tarhi anarthakau iti ucyate . anarthntarvcinau anarthakau . dhtun uktm kriym hatu . tad aviiam bhavati yath akhe paya . yadi evam dhtun uktatvt tasyrthasya upasargaprayogo na prpnoti uktrthnm aprayoga iti . uktrthnmapi prayoga dryate . tat yath appau dvau naya . brhmaau dvau anaya iti . (P_1,4.96) KA_I,348.22-349. 4 Ro_II,464-465 iha kasmt na bhavati . sarpia api syt . gomtrasya api syt . kim ca syt . dvity api prasajyeta karmapravacanyayukte dvity iti . na ea doa . na ime apyarth nirdiyante . kim tarhi . parapadrth ime nirdiyante . eteu artheu yat padam vartate tat prati api karmapravacanyasaja bhavati iti . atha v yat atra karmapravacanyayuktam na ada prayujyate . kim puna tat . bindu . bindo tarhi kasmt na bhavati . upapadavibhakte krakavibhakti balyas iti pratham bhaviyati iti . (P_1,4.97) KA_I,349.6-9 Ro_II,466 adhirvaravacane uktam . kim uktam . yasya ca varavacanam iti kartrnirdea cet avacant siddham . prathamnupapatti tu . svavacant siddham iti . adhi svam prati karmapravacanyasaja bhavati iti vaktavyam . (P_1,4.99) KA_I,349.11-19 Ro_II,466-467 ldee parasmaipadagrahaam puruabdhitatvt . ldee parasmaipadagrahaam kartavyam . kim kraam . puruabdhitatvt . iha vacane hi sajbdhanam . iha hi kriyame anavak puruasaj parasmaipadasajm bdheta . parasmaipadasaj api anavak . s vacant bhaviyati . svak parasamaipadasaj . ka vaka . atrkkvas avaka . sici vrddhau tu parasmaipadagrahaam jpakam purubdhakatvasya . yat ayam sici vrddhi parasmaipadeu iti parasmaipadagrahaam karoti tat jpayati crya na puruasaj parasmaipadasajm bdhate iti . (P_1,4.101) KA_I,350.2-24 Ro_II,468-469 prathamamadhyamottamasajym tmanepadagrahaam samasakhyrtham . prathamamadhyamottamasajym tmanepadagrahaam kartavyam . tmanepadnm ca prathamamadhyamottamasaj bhavanti iti vaktavyam . kim prayojanam . samasakhyrtham . sakhytnudea yath syt . akriyame hi tmanepadagrahae tisra saj a sajina . vaiamyt sakhytnudea na prpnoti . kriyame api ca tmanepadagrahae nuprvyavacanam ca . nuprvyavacanam ca kartavyam . akriyamae hi kasya cit eva trikasya prathamasaj syt kasya cit eva madhyamasaj kasya cit eva uttamasaj . na vaikaeanirdet . yat tvat ucyate tmanepadagrahaam kartavyam samasakhyrtham iti . tat na kartavyam . saj api at eva nirdiyante . katham . ekaeanirdest . ekaeanirdea ayam . atha etasmin ekaeanirdee sati kim ayam krtaikaem dvandva . prathama ca prathama ca prathamau madhyama ca madhyama ca madhyamau uttama ca uttama ca uttamau prathamau ca madhyamau ca uttamau ca prathamamadhyamottam iti . hosvit
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (185 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

krtadvandvnm ekaea . prathamau ca madhyama ca uttama ca prathamamadhyamottam . prathamamadhyamotttam ca prathamamadhyamottam ca prathamamadhyamottam iti . kim ca ata . yadi krtaikeem dvandva prathamamadhyamayo prathamasaj prpnoti . uttamaprathamayo madhyamasaj prpnoti . madhyamottamayo uttamasaj prpnoti . atha krtadvandvnmekaeo na doa bhavati . yath na doa tath astu . kim puna atra nyyyam . ubhayam iti ha . ubhayam hi dryate . tat yath . bahu aktikiakam bahni aktikiakni bahu sthlpiharam bahni sthlpihari . yat api ucyate kriyame api tmanepadagrahae nurprvyavacanam kartavyam iti . na kartavyam . lokata etat siddham . tat yath loke vihavyasya dvbhym dvbhym agni upstheya iti . na ca ucyate nuprvyea iti nuprvyea ca upasthyata iti . (P_1,4.104) KA_I,351.2-10 Ro_II,470-471 tri tri iti anuvartate utho na . kim ca ata . yadi anuvartate ahana vibhaktau iti tvam na prpnoti . atha nivrttam prathamayo prvasavara iti atra pratyayayo eva grahaam prpnoti . yath icchasi tath astu . astu tvat anuvartate iti . nanu ca uktam ahana vibhaktau iti tvam na prpnoti iti . vacant bhaviyati . atha v puna astu nivrttam . nanu ca uktam prathamayo prvasavara iti atra pratyayayo eva grahaam prpnoti iti . na ea doa . aci iti anuvartate . na cjd prathamau pratyayau sta . nanu ca evam vijyate ajd yau prathamau ajdnm v yau prathamau iti . yat tarhi tasmt asa na pumsi iti anukrntam prvasavaradrgham pratinirdiati tat jpayati crya vibhaktyo grahaam iti . atha v vacanagrahaam eva kuryt . aujaso prvasavara iti . (P_1,4.105,107-108.1) KA_I,351.13-353.27 Ro_II,471-476 kimartham idam ucyate . yumadasmaccheavacanam niyamrtham . niyamrtha ayam rambha . atha etasmin niyamrthe vijyamne kim ayam upapadaniyama yumadi madhyama eva asmadi uttama eva hosvit puruaniyama yumadi eva madhyama asmadi eva uttama iti . kim ca ata . yadi puruaniyama eagrahaam kartavyam ee prathama iti . kim kraam . madhyamottamau niyatau yumadasmad aniyate . tatra prathama api prpnoti . tatra eagrahaam kartavyam prathamaniyamrtham . ee eva prathama bhavati na anyatra iti . atha api upapadaniyama evam api eagrahaam kartavyam ee prathama iti . yumadasmad niyate madhyamottamau aniyatau tau ee api prpnuta . tatra eagrahaam kartavyam eaniyamrtham . ee prathama eva bhavati na anya iti . upapadaniyame eagrahaam akyam akartum . katham . yumadasmad niyate madhyamottamau aniyatau tau ee api prpnuta . tata vakymi prathama bhavati iti . tat niyamrtham bhaviyati . yatra prathama ca anya ca prpnoti tatra prathama bhavati iti . tatra yumadasmadanyeu prathamapratiedha eatvt . tatra yumadasmadanyeu prathamasya pratiedha vaktavya . tvam ca devadatta ca pacatha . aham ca devadatta ca pacva . kim kraam . eatvt . ee prathama iti prathama prpnoti . siddham tu yumadasmado pratiedht . siddham etat . katham . yumadasmado pratiedht . ee pratham yumadasmado na iti vaktavyam . yumadi madhyamt asmadi uttama pratiedhena . yumadi madhyamt asmadi uttama iti etat bhavati vipratiedhena . yumadi madhyama iti asya avaka tvam pacasi . asmadi uttama iti asya avaka aham pacmi . iha ubhayam prpnoti tvam ca aham ca pacva . asmadi uttama iti etat bhavati
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (186 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

virpratiedhena . sa tarhi vipratiedha vaktvaya . na vaktavya . tyaddnm yat yat param tat tat iyate iti evam asmada ea bhaviyati . tatra asmadi uttama iti eva siddham . anekaeabhvrtham tu . anekaeabhvrtham tu sa vipratiedha vaktavya . yad ca ekaea na . kad ca ekaea na . sahavivakym ekaea . yad na sahavivak tada ekaea na asti . na v yumadasmado anekaeabhvt tadadhikaranm api anekaeabhvt avipratiedha . na v artha vipratiedhena . kim kraam . yumadasmado anekaeabhvt tadadhikaranm api yumadasmadadhikaranm api ekaeena na bhavitavyam . tvam ca aham ca pacasi pacmi ca iti . kriyprthaktve ca dravyaprthaktvadaranam anumnam uttaratra anekaeabhvasya . kriyprthaktve ca dravyaprthaktvam dryate . tat yath pacasi pacmi ca tvam ca aham ca iti . tat anumnam uttarayo api kriyayo ekaea na bhavati iti . evam ca krtv sa pi adoa bhavati yat uktam tatra yumadasmadanyeu prathamapratiedha eatvt iti . tatra api hi evam bhavitavyam tvam ca devadatta ca pacasi pacati ca . aham ca devadatta ca pacmi pacati ca iti . yat tvat ucyate na v yumadasmado anekaeabhvt tadadhikaranm api anekaeabhvt avipratiedha iti . dryate hi yumadasmado cnekaea tadadhikaranm ca ekaea . tat yath tvam ca aham ca vrttrahan ubhau samprayujyvahai iti . yat api ucyate kriyprthaktve ca dravyaprthaktvadaranam anumnam uttaratra anekaeabhvasya iti . kriyprthaktve khalu api dravyaikaea bhavati iti dryate . tat yath ak bhajyantm bhakyantm dvyantm iti . evam ca krtv sa api doo bhavati yat uktam tatra yumadasmadanyeu prathamapratiedha eatvt iti . na ea doa . parihrtam etat siddham tu yumadasmado pratiedht iti . sa tarhi pratiedha vaktavya . na vaktavya . ee prathama vidhyate . na hi ea ca anya ca eagrahaena grhyate . bhavet prathama na syn . madhyamottamau api na prpnuta . kim kraam . yumadasmado upapadayo madhyamottamau ucyete . na ca yumadasmad anya ca yumadasmadgrahaena grhyate . yat atra yumat yat ca asmat tattadrayau madhyamottamau bhaviyata . yath eva tarhi yat atra yumat yat ca smat tadrayau madhyamottamau bhavata evam ya atra ea tadraya prathama prpnoti . evam tarhi ee upapade prathama vidhyate . upoccri padam upapadam . yat ca atra upoccri na sa ea ya ca ea na tat upoccri . bhavet prathama na syt . madhyamottamau api na prpnuta . kim kraam . yumadasmado upapadayo madhyamottamau ucyete . upoccri padam upapadam . yat ca atra upoccri na te yumadasmad ye ca yumadasmad na tat upoccri . evam tarhi eea smndhikaraye prathama vidhyate . na ca atra eea eva smndhikarayam . bhavet prathama na syt . madhyamottamau api na prpnuta . kim kraam . yumadasmadbhym smndhikaraye madhyamottamau ucyete na ca atra yumadasmadbhym eva smndhikarayam . evam tarhi tyaddni sarvai nityam iti evam atra yumadasmado ea bhaviyati . tatra yumadi madhyama asmadi uttama iti eva siddham . na sidhyati . sthnini api iti prathama prpnoti . tyaddnm khalu api yat yat param tat tat iyate iti yad bhavata ea tad prathama prpnoti . (P_1,4.105,107-108.2) KA_I,353.27-354. 15 Ro_II,477-478 yumadi madhyama asmadi uttama iti eva ucyate. tau iha na prpnuta : paramatvam pacasi . paramham pacmi iti . tadantavidhin bhaviyati . iha api tarhi tadantavidhin prpnuta : atitvam pacati . atyaham pacati iti . ye ca api ete samndhikaraavrttaya taddhit tatra ca madhyamottamau na
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (187 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

prpnuta : tvattara pacasi mattara pacmi iti . tvadrpa pacasi madrpa pacmi iti . tvatkalpa pacasi . matkalpa pacmi iti. evam tarhi yumadvati asmadvati iti evam bhaviyati . iha api tarhi prpnuta : atitvam pacati . atyaham pacati iti . evam tarhi yumadi sdhane asmadi sdhane iti evam bhaviyati . evam ca krtv sa api adoa bhavati yat uktam tatra yumadasmadanyeu prathamapratiedha eatvt iti . atha v prathama utsarga kariyate . tasya yumadasmado upapadayo madhyamottamau apavdau bhaviyata . tatra yumadgandha ca asmadgandha ca asti iti krtv madhyamottamau bhaviyata . atha iha katham bhavitavyam . atvam tvam sampadyate tvadbhavati madbhavati iti . hosvit tvadbhavasi madbhavmi iti . tvadbhavati madbhavati iti evam bhavitavyam . madhyamottamau kasmt na bhavata . gauamukhyayo mukhye sampratyaya bhavati . tat yath . gau anubandhya aja agnhomya iti na bhka anubadhyate . katham tarhi bhke vrddhyttve bhavata . gau tihati . gm naya iti . arthraye etat evam bhavati . yat hi abdrayam abdamtre tat bhavati . abdraye ca vrddhyttve . (P_1,4.109) KA_I,354.17-356.13 Ro_II,478-484 para sannikara samhit cet adrutym asahitam . para sannikara sahit cet adrutym vrttau sahitsaj na prpnoti . drutym eva hi para sannikaro varnm na adrutym . tulya samnikara . tulya samnikara varnm drutamadhyamavilimbitsu vrttiu . kikrta tarthi viea . varaklabhyastvam tu . varnm tu klabhyastvam . tat yath . hastimaakayo tulya sannikara pribhyastvam tu . yadi evam drutym taparakarae madhyamavilimbitayo upasakhynam klabhedt . drutym taparakarae madhyamavilimbitayo upasakhynam kartavyam . kim kraam . klabhedt . ye drutym vrttau var tribhgdhik te madhyamym ye madhyamym vrttau var tribhgdhikste vilimbitym . uktam v . kim uktam . siddham tu avasthit var vaktu circiravacant vrttaya viiyante iti . atha v abdvirma sahit iti etat lakaam kariyate . abdvirme prativaram avasnam . abdvirme prativaram avasnasaj prpnoti . kim idam prativaram iti . varam varam prati prativaram . yena eva yatnena eka vara uccyryate vicchinne vare upasahrtya tam anyam updya dvitya prayujyate tath trtya tath caturtha . evam tarhi anavak sahitsaj avasnasajm bdhiyate . atha v avasnasajym prakaragati vijsyate : sdhya ya virma iti . ka ca sdhya . ya abdrthayo virma . atha v hrdvirma sah iti etat lakaam kariyate . hrdvirme sparghoasayoge asannidhnt asahitam . hrdvirme sparnm aghom sayoge asamnidhnt sahitsaj na prpnoti . kukkua pippak pittam iti . kim ucyate sayoge iti . atha yatra eka pacati iti eka prvaparayo hrdena pracchdyate . tad yath . dvayo raktayo vastrayo madhye uklam vastram tadguam upalabhyate . badarapiake riktaka lohakasa tadgua upalabhyate . ekena tulya sannidhi . yath eka vara hrdena pracchdyate evam aneka api . atha v paurvparyam aklavyapetam sahit iti etat lakaam kariyate. paurvparyam aklavyapetam sahit cet prvparbhvt asahitam . paurvparyam aklavyapetam sahit cet prvparbhvt sahitsaj na prpnoti . na hi varnm paurvparyam asti . kim kraam . ekaikavaravartitvt vca uccaritapradhvasitvt ca varnm . ekaikavaravartin vk . na dvau yugapat uccrayati . gau iti yvat gakre vk vartate na aukre na visarjanye . yvat aukre na gakre na visarjanye . yvat visarjanye na gakre na aukre . uccaritapradhvasitvt . uccaritapradhvasina khalu api var .
file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (188 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

uccarita pradhvasta . atha apara prayujyate . na vara varasya sahya . evam tarhi buddhau krtv sarv ceh kart dhra tatvannti abdena arthn vcyn drv buddhau kuryt paurvparyam . buddhiviayam eva abdnm paurvparyam . iha ya ea manuya prekprvakr bhavati sa payati asamin arthe ayam abda prayoktvaya smin tvat abde ayam tvat vara tata ayam tata ayam iti . (P_1,4.110) KA_I,356.15-358.8 Ro_II,484-488 idam vicryate abhva avasnalakaam syd virma v iti . ka ca atra viea . abhve avasnalakae uparyabhvavacanam . abhvevasnalakae uparyabhvagrahaam kartavyam . upari ya abhva iti vaktavyam . purastt api hi abdasya abhva tatra m bht iti . kim ca syt . rasa ratha . kharavasnayorvisarjanya iti visarjanya prasajyeta . astu tarhi virma . virme virmavacanam . yasya virma virmagrahaam tena kartavyam . nanu ca yasya api abhva tena api abhvagrahaam kartavyam . parrtham mama bhaviyati . abhva lopa . tata avasnam ca iti . mama api tarhi virmagrahaam parrtham bhaviyati . virma lopa avasnam ca iti . upari ya virma iti vaktavyam . purastt api abdasya virma tatra m bht iti . kim ca syt . rasa ratha . kharavasnayorvisarjanya iti visarjanya prasajyeta . rambhaprvaka mama virma . atha v na idam avasnalakaam vicryate . kim tarhi . saj . abhva vasnasaj syt virma v iti . ka ca atra viea . abhve avasnasajini uparyabhvavacanam . abhve avasnasajin yuparyabhvagrahaam kartavyam . upari ya bhva iti vaktavyam . purastt api hi abdasya abhva tatra m bht iti . kim ca syt . rasa ratha . kharavasnayorvisarjanya iti visarjanya prasajyeta . astu tarhi virma avsanam . virme virmavacanam . yasya virma tena virmagrahaam kartavyam . nanu ca yasya api abhva tena api abhvagrahaam kartavyam . parrtham mama bhaviyati . abhva lopa . tata avasnam ca iti . mama api tarhi virmagrahaam parrtham bhaviyati . virma lopa avasnam ca iti . upari ya virma iti vaktavyam . nanu ca yasya api abhva tena api abhvagrahaam kartavyam . parrtham mama bhaviyati . abhva lopa . tata avasnam ca iti . mama api tarhi virmagrahaam parrtham bhaviyati . virma lopa avasnam ca iti . upari ya virma iti vaktavyam . nanu ca uktam rambhaprvaka iti . na avayam ayam rami pravrttau eva vartate . kim tarhi . apravrttau api . tat yath . uparatni asmin kule vratni . uparata svdhyya iti . na ca tatra svdhyya bhtaprva bhavati na api vratni . bhvvirmabhvitvt abdasya vasnalakaam na . bhvvirmabhvitvt abdasya avasnalakaam na upapadyate . kim idam bhvvirmabhvitvt iti . bhvasya avirma bhvvirma bhvvirmea bhavati iti bhvvirmabhv bhvvirmabhvina bhvo bhvvirmabhvitvam . apara ha . bhvabhvitvdavirmabhvitvt ca abdasya avasnalakaam na upapadyate iti . tatpara iti v varasya avasnam . virmapara vara vasnasaja bhavati iti vaktavyam . vara antya v avasnam . atha v vyaktam eva pahitavyam antya vara vasnasaja bhavati iti . tat tarhi vaktavyam . na vaktavyam . sahitvasnayo lokaviditatvt siddham . samhit avasnam iti lokaviditau etau arthau . evam hi ka cit kam cid adhynam ha : annodevyam samhitay adhva iti . sa tatra paramasannikaram adhte . apara ha : kena vasyasi iti . sa ha : akrea ikrea ukrea iti . evam etau lokaviditatau arthau . tayo lokaviditatvt siddham iti .

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (189 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, Adhyaya 1

file:///C|/Users/student/Desktop/siddhanta%2...ali%20Vyakaranamahabhasya,%20Adhyaya%201.htm (190 of 190) [3/8/2008 12:51:13 PM]

Patanjali: Vyakaranamahabhasya, 2

Patanjali: Vyakaranamahabhasya (Mahabhasya) Based on the edition by Franz Kielhorn (Bombay 1880-1885), revised by K.V. Abhyankar (Poona 1972-1996). Input by George Cardona, formatted by Masato Kobayashi.

ADHYAYA 2 (unsegmented)

STRUCTURE OF REFERENCES: KA_n,n.n = Kielhorn/Abhyankar edition_ volume,page.line Ro_n,n.n = Rohatak edition_volume,page.line P_n,n.n.n = Pini_adhyya,pda.stra

BOLD = Ktyyana's Vrttikas

THIS GRETIL TEXT FILE IS FOR REFERENCE PURPOSES ONLY! COPYRIGHT AND TERMS OF USAGE AS FOR SOURCE FILE. Text converted to Unicode (UTF-8). (This file is to be used with a UTF-8 font and your browser's VIEW configuration set to UTF-8.)

file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (1 of 73) [3/8/2008 12:51:36 PM]

Patanjali: Vyakaranamahabhasya, 2

description: long a long A long i long I long u long U vocalic r vocalic R long vocalic r vocalic l long vocalic l velar n velar N palatal n palatal N retroflex t retroflex T retroflex d retroflex D retroflex n retroflex N palatal s

multibyte sequence: r R r l l

file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (2 of 73) [3/8/2008 12:51:36 PM]

Patanjali: Vyakaranamahabhasya, 2

palatal S retroflex s retroflex S anusvara anunasika m visarga Unless indicated otherwise, accents have been dropped in order to facilitate word search. For a comprehensive list of GRETIL encodings and formats see: www.sub.uni-goettingen.de/ebene_1/fiindolo/gretil/gretdiac.pdf and www.sub.uni-goettingen.de/ebene_1/fiindolo/gretil/gretdias.pdf

(P_2,1.1.1) KA_I,359.2-20 Ro_II,491-496 vidhi iti ka ayam abda . viprvt dha karmasdhana ikra . vidhyate vidhi iti . kim puna vidhyate . samsa vibhaktividhnam pargavadbhva ca . kim puna ayam adhikra hosvit paribh . ka puna adhikraparibhayo viea . adhikra pratiyogam tasya anirdertha iti yoge yoge upatihate . paribh puna ekadeasth sat sarvam stram abhijvalayati pradpavat . tat yath pradpa suprajvalita ekadeastha sarvam vema abhijvalayati . ka puna atra prayatnaviea . adhikre sati svarayitavyam paribhym puna satym sarvam apekyam . tath idam aparam dvaitam bhavati . ekrthbhva v smarthyam syt vyapek v iti . tatra ekrthbhve smarthye adhikre ca sati samsa eka sagrhta bhavati bibhaktividhnam pargavadbhva ca asagrhta . vyapekym puna smarthye adhikre ca sati bibhaktividhnam pargavadbhva ca sagrhta samsa tu eka asagrhta . anyatra khalu api samarthagrahani yuktagrahani ca kartavyni bhavanti . kva anyatra . isuso smarthye na cavhhaivayukte iti . vyapekym puna smarthye paribhym ca satym yvn vykarae padagandha asti sa sarva sagrhta bhavati samsa tu eka asagrhta . tatra ekrthbhva smarthyam paribh ca iti evam stram abhinnatarakam bhavati . evam api kva cit akartavyam samarthagrahaam kriyate kva cit ca kartavyam na kriyate . akartavyam tvat kriyate samarthnm prathamt v iti . kartavyam ca na kriyate karmai a samartht iti . nanu ca gamyate tatra smarthyam . kumbhakra nagarakra iti . satyam gamyate utpanne tu pratyaye . sa eva tvat samartht utpdya . (P_2,1.1.2) KA_I,359.21-361.24 Ro_II,496-504 atha samarthagrahaam kimartham .

file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (3 of 73) [3/8/2008 12:51:36 PM]

Patanjali: Vyakaranamahabhasya, 2

vakyati dvity ritdibhi samasyate . kaarita narakarita iti . samarthagrahaam kimartham . paya devadatta kaam . rita viumitra gurukulam . trty tatkrtrthena guavacanena . akulkhaa kirika . samarthagrahaam kimartham . tiha tvam akulay . khaa dhvati musalena . caturth tadarthrthabalihitasukharakitai . gohitam arahitam . samarthagrahaam kimartham . sukham gobhya . hitam devadattya . pacam bhayena . vrkabhayam dasyubhayam corabhayam . samarthagrahaam kimartham . gaccha tvam m vrkebhya . bhayam devadattasya yajadattt . ah subantena samasyate : rjapurua , brhmaakambala . samarthagrahaam kimartham . bhry rja . purua devadattasya . saptam auai : akaaua , straua . samarthagrahaam kimartham . kuala devadatta akeu . aua pibati pngre . atha kriyame api samarthagrahae iha kasmt na bhavati mahat kaam rita iti . na v bhavati mahkaarita iti . bhavati yad etat vkyam bhavati : mahat kaam mahkaam , mahkaam rita mahkaarita iti . yad tu etat vkyam bhavati : mahat kaam rita iti tad na bhavitavyam tad ca prapnoti . tad kasmt na bhavati . kasya kasmt na bhavati . kim dvayo hosvit bahnm . bahnm kasmt na bhavati . sup sup iti vartate . nanu ca bho krtau stri pravartante . tat yath prtipadikt iti vartamne anyasmt ca anyasmt ca prtipadikt utpatti bhavati . satyam etat . krti tu pratyekam parisampyate . yvati etat parisampyate prtipadikt iti tvata utpatty bhavitavyam . pratyekam ca etat parisampyate na samudye . evam iha api yvati etat parisampyate sup sup iti tvata samsena bhavitavyam . dvayo dvayo ca etat parisampyate na bahuu . dvayo tarhi kasmt na bhavati . asmarthyt . katham asmarthyam . spekam asamartham bhavati iti . yadi spekam asamartham bhavati iti ucyate rjapurua abhirpa rjapurua daranya atra vrtti na prpnoti . na ea doa . pradhnam atra spekam . bhavati ca pradhnasya spekasya api samsa . yatra tarhi apradhnam spekam bhavati tatra te vrtti na prpnoti : devadattasya gurukulam , devadattasya guruputra , devadattasya dsabhry iti . na ea doa . samudyapek atra a sarvam gurukulam apekate . yatra tarhi na samudyapek a tatra vrtti na prpnoti : kim odana lnm . saktvhakam paynm . kuta bhavn paliputraka . iha ca api : devadattasya gurukulam , devadattasya guruputra , devadattasya dsabhry iti : yadi e samudyapek a syt na etat niyogata gamyeta devadattasya ya guru tasya ya putra iti . kim tarhi . anyasya api guruputra devadattasya kim cit iti ea artha gamyeta . yata tu niyogata devadattasya ya guru tasya ya putra iti ea artha gamyate ata manymahe na samudyapek a iti . anyatra khalu api samarthagrahae spekasya api kryam bhavati . kva anyatra . isuso smarthye . brhamaasya sarpi karoti iti . tasmt na aeta akyak vaktum spekam asamartham bhavati iti . vrtti tarhi kasmt na bhavati mahat kaam rita iti . savieanm vrtti na vrttasya v vieaam na prayujyate iti vaktavyam . yadi savieanm vrtti na vrttasya v vieaam na prayujyate iti ucyate devadattasya gurukulam devadattasya guruputra devadattasya dsabhry iti atra vrtti na prpnoti . agurukulaputrdnm iti vaktavyam . tat tarhi vaktavyam savieanm vrtti na vrttasya v vieaam na prayujyate agurukulaputrdnm iti . na vaktavyam . vrtti tarhi kasmt na bhavati . agamakatvt . iha samnrthena vkyena bhavitavyam samsena ca . ya ca iha artha vkyena gamyate mahat kaam rita iti na jtu cit samsena asau gamyate mahat kaarita iti . etasmt heto brma agamakatvt iti . na brma apaabda syt iti . yatra gamaka bhavati bhavati
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (4 of 73) [3/8/2008 12:51:36 PM]

Patanjali: Vyakaranamahabhasya, 2

tatra vrtti . tat yath : devadattasya gurukulam , devadattasya guruputra , devadattasya dsabhry iti . yadi agamakatvam hetu na artha samarthagrahaena . iha api bhry rja purua devadattasya iti ya artha vkyena gamyate na asau jtu cit samsena asau gamyate bhrya rjapurua devadattasya iti . tasmt na artha samarthagrahaena . idam tarhi prayojanam . asti asamarthasamsa nasamsa gamaka . tasya sdhutvam m bht . akicit kurvam amam haramam agdht utsram iti . etat api na asti prayojanam . avayam kasya cit nasamsasya gamakasya sdhutvam vaktavyam . asryampayni mukhni apunargey lok arddhabhoj alavaabhoj brhmaa . su anapusakasya etat niyamrtham bhaviyati . etasya eva asamarthasamsasya nasamsasya gamakasya sdhutvam bhavati na anyasya iti . tasmn na artha samarthagrahaena . (P_2,1.1.3) KA_I,361.25-363.28 Ro_II,505-516 atha kriyame api samarthagrahae samartham iti ucyate kim samartham nma . prthagarthnm ekrthbhva samarthavacanam . prthagarthnm padnam ekrthbhva samartham iti ucyate . vkye prthagarthni rja purua iti . samse puna ekrthni rjapurua iti . kim ucyate prthagarthni iti yvat rja purua nyatm iti ukte rjapurua iti ca sa eva . na api brma anyasya nayanam bhavati iti . ka tarhi ekrthbhvakrta viea . subalopa vyavadhnam yatheam anyatarea abhisambandha svara . supa alopa bhavati vkye . rja purua iti . samse puna na bhavati . rjapurua iti . vyavadhnam ca bhavati vkye . rja rddhasya purua iti . samse na bhavati . rjapurua iti . yatheam anyatarea abhisambandha bhavati vkye . raja purua purua rja iti . samse na bhavati . rjapurua iti . dvau svarau bhavata vkye . raja purua . samse puna eka eva . rjapurua iti . na ete ekrthbhvakrt vie . kim tarhi . vcanikni etni . ha hi bhagavn supa dhtuprtipadikayo upasarjanam prvam samsasya anta udtta bhavati iti . ime tarhi ekrthbhvkrt vie . sakhyviea vyaktbhidnam lkupasarjanavieaam cayoga iti . sakhyviea bhavati vkye . rja purua rjo purua rjm purua iti . samse na bhavati . rjapurua iti . asti kraam yena etat evam bhavati . kim kraam . ya asau vieavc abda tadasnnidhyt . aga hi bhavn tam uccrayatu gasyate sa viea . nanu ca na etena evam bhavitavyam . na hi abdakrtena nma arthena bhavitavyam . arthakrtena nma abdena bhavitavyam . tat etat evam dryatm . artharpam eva etat evajtyakam yena atra viea na gamyate iti . avayam ca etat evam vijeyam . ya hi manyate ya asau vieavc abda tadasnnidhyt atra viea na gamyate iti iha tasya viea gamyeta : apsucara goucara varsuja iti . vyaktbhidhnam bhavati vkye . brhmaasya kambala tihati iti . samse puna avyaktam . brhmaakambala tihati iti . sandeha bhavati sambuddhi syt ahsamsa v iti . ea api aviea . bhavati hi kim cit vkye avyaktam tat ca samse vyaktam . vkye tvat avyaktam . ardham pao devadattasya iti . sandeha bhavati pauguasya v devadattasya yat ardham artha v ya asau sajbhta pau nma tasya yat ardham iti . tat ca samse vyaktam bhavati . ardhhapau devadattasya iti . upasarjanavieaam bhavati vkye . rddhasya rja purua iti . samse na bhavati . rjapurua iti . ea api adoa . samse api upasarjanavieaam bhavati . tat yath devadattasya gurukulam devadattasya guruputra devadattasya dsabhry iti . cayoga bhavati vkye . svacayoga svmicayoga
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (5 of 73) [3/8/2008 12:51:36 PM]

Patanjali: Vyakaranamahabhasya, 2

ca . svacayoga rja gau ca ava ca purua ca iti . samse na bhavati . rja gavvapuru iti . svmicayoga devadattasya ca yajadattasya ca viumitrasya ca gau iti . samse na bhavati . devadattayajadattaviumitrm gau iti . atha etasmin ekrthbhvkrte viee kim svbhvikam abdai arthbhidhnam hosvit vcanikam . svbhvikam iti ha . kuta etat . arthndet . na hi arth diyante . katham puna arthn dian evam bryt na arth diyante it . yat ha bhavn anekam anyapadrthe crthe dvandva apatye rakte nirvrtte iti . na etni arthdeanni . svabhvata etem abdnm eteu artheu abhinivinm nimittatvena anvkhynam kriyate . tat yath . kpe hastadakia panth . abhre candramasam paya iti . svabhvata tatrasthasya patha candramasa ca nimittatvena anvkhynam kriyate . evam iha api crthe ya sa dvandvasamsa anyapadrtha ya sa bahuvrhi iti . kim puna kraam na diyante . tat ca laghvartham . laghvartham hi arth na diyante . avayam hi anena arthn diat kena cit abdena nirdea kartavya syt . tasya ca tvat kena krta yena asau kriyate . atha tasya kena cit krta tasya kena krta iti anavasth . asambhava khalu api dea tasya . ka hi nma samartha dhtuprtipadikapratyayaniptnm arthn deum . na ca etat mantavyam pratyayrthe nirdie prakrtyartha anirdia iti . bhavati hi gubhidhne guina sampratyaya . tat yath ukla kra iti . viama upanysa . smnyaabd ete evam syu . smanyaabd ca na antarea vieam prakaraam v vieeu avatihante . yata tu khalu niyogata vrka iti ukte svabhvata kasmin cit eva viee vrkaabda vartate ata manymahe na ime smnyaabd iti . na cet smnyaabd prakrti prakrtyarthe vartate pratyaya pratyayrthe vartate . apravrtti khalu api arthdeanasya . bahava hi abd yem arth na vijyante . jarbhar turphart . antarea khalu api abdaprayogam bahava arth gamyante akinikocai pivihrai ca . na khalu api nirjtasya arthasya anvykhyane kim cit prayojanam asti . ya hi bryt purastt ditya udeti pact astam eti madhura gua kaukam rgaveram iti kim tena krtam syt . (P_2,1.1.4) KA_I,364.1-5 Ro_II,516 vvacannarthakyam ca svabhvasiddhatvt . vvacannarthakyam . kim kraam . svabhvasiddhatvt . iha dvau pakau vrttipaka avrttipaka ca . svabhvata ca etat bhavati vkyam ca samsa ca . tatra svbhvike vrttiviaye nitye samse prapte vvacanena kim anyat akyam abhisambandhum anyat ata sajy . na ca sajy bhvbhvau iyete . tasmt na artha v vacanena . (P_2,1.1.5) KA_I,364.6-365.14 Ro_II,517-525 atha ye vrttim vartayanti kim te hu . parrthbhidhnam vrtti iti hu . atha tem evam bruvatm kim jahatsvrth vrtti hosvit ajahatsvrth . kim ca ata . yadi jahatsvrth vrtti rjapuruam naya iti ukte puruamtrasya nayanam prpnoti aupagavam naya iti ukte apatyamtrasya . atha ajahatsvrth vrtti ubhayo vidyamnasvrthayo dvayo dvivacanam iti dvivacanam prpnoti . k puna vrtti nyyy . jahatsvrth . yuktam puna yat jahatsvrth nma vrtti syt . bham yuktam . evam hi dryate loke . purua ayam parakarmai pravartamna svam karma jahti . tat yath tak rjakarmai vartamna svam karma jahti . evam yuktam yat rj pururthe vartamna svam artham jahyt upagu ca apartyrthe vartamna svam artham jahyt . nanu ca uktam rjapuruam naya iti ukte puruamtrasya nayanam prpnoti aupagavam naya iti ukte apatyamtrasya iti . na ea doa . jahat api asau svrtham na
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (6 of 73) [3/8/2008 12:51:36 PM]

Patanjali: Vyakaranamahabhasya, 2

atyantya jahti . ya parrthavirodh svrtha tam jahti . tat yath tak rjakarmai vartamna svam takakarma jahti na hikkitahasitakayitni . na ca ayam artha parrthavirodh vieaam nma . tasmt na hsyati . atha v anvayt vieaam bhaviyati . tat yath . ghrtaghaa tailaghaa iti niikte ghrte taile v anvyayt vieaam bhavati ayam ghrtaghaa ayam tailaghaa iti . viama upanysa . bhavati hi tatra y ca yvat ca arthamtr . aga hi bhavn agnau niapya ghrtaghaam trakrcena praklayatu . na gasyate sa viea . yath tarhi mallikpua campakaputa iti nikrsu api sumanasu anvayt vieaam bhavati ayam mallikapua ayam campakapua iti . atha v samarthdhikra ayam vrttau kriyate . smartham nama bheda sasarga v . apara ha : bhedasasargau v smarthyam iti . ka puna bheda sasarga v . iha rja iti ukte sarvam svam prasaktam purua iti ukte sarva svmi prasakta . iha idnm rjapurua iti ukte rj puruam nivartayati anyebhya svmibhya purua api rjnam anyebhya svebhya . evam etasmin ubhayata vyavacchinne yadi jahti kmam jahtu . na jtu cit puruamtrasya nayanam bhaviyati . atha v puna astu ajahatsvrth vrtti . yuktam puna yat ajahatsvrth nma vrtti syt . bham yuktam . evam hi dryate loke . bhikuka ayam dvitym bhikm sdya prvm na jahti sacayya pravartate . nanu ca uktam ubhayo vidyamnasvrthayo dvayo dvivacanam iti dvivacanam prpnoti iti . kasy puna dvivacanam prpnoti . prathmy . na prathamsamartha rj . ahy tarhi . na ahsamartha purua . prathamy eva tarhi prpnoti . nanu ca uktam na prathamsamartha rj iti . abhinihita sa sa artha antarbhta prtipadikrtha sampanna . tatra prtipadikrthe pratham iti prathamy eva dvivacanam prpnoti . saghtasya aikrthyt na avayavasakhyta subutpatti . saghtasya ekatvam artha . tena avayavasakhyta subutpatti na bhaviyati . parasparavyapek smarthyem eke . parasparavyapek smarthyem eke icchanti . k puna abdayo vyapek . na brma abdayo iti . kim tarhi . arthayo . iha rja purua iti ukte rj puruam apekate mama ayam iti . purua api rjnam apekate aham asya iti . tayo abhisambandhasya ah vcik bhavati . tath kaam rita iti kriykrakayo abhisambandhasya dvity vcik bhavati . (P_2,1.1.6) KA_I,365.15-367.9 Ro_II,525-531 atha yadi eva ekrthbhva smarthyam atha api vyapek smarthyam kim gatam etat iyat strea hosvit anyatarasmin pake bhya stram kartavyam . gatam iti ha . katham . sama ayam arthaabdena saha samsa . sam ca upasarga . upasarg ca puna evamtmak yatra ka cit kriyvc abda prayujyate tatra kriyvieam hu . na ca iha ka cit kriyvc abda prayujyate yena sama smarthyam syt . tatra prayogt etat gantavyam nnam atra ka cit prayogrha abda na prayujyate yena sama smarthyam iti . tat yath . dhmam drv agni atra iti gamyate triviabdhakam ca drv parivrjaka iti . ka puna asau prayogrha abda . ucyate . sagatrtham samartham sasrrtham samartham samprekitam artham samartham sambaddhrtham samartham iti . tat yad tvat ekrthbhva smarthyam tad evam vigraha kariyate sagatrtha sasrrtha samartha iti . tat yath sagatam ghrtam sagatam tailam iti ucyate . ekbhtam iti gamyate . yad vyapek smarthyam tad evam vigraha kariyate samprekitrtha samartha sambaddhrtha samartha iti . ka puna iha badhntyartha . sambaddha iti ucyate ya rajjv ayas v kle vyatiikta bhavati . na
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (7 of 73) [3/8/2008 12:51:36 PM]

Patanjali: Vyakaranamahabhasya, 2

avayam badhnti vyatiage eva vartate . kim tarhi . ahnau api vartate . tat yath sambaddhau imau damyau iti ucyete yau anyonyam na jahta . atha v bhavati ca evajtyakeu badhnti vartate . tat yath . asti na gargai sambandha . asti na vatsai sambandha . sayoga iti artha . atha etasmin vyapekym smarthye ya asau ekrthbhvkrta viea sa vaktavya . tatra nnkrakt nightayumadasmaddeepratiedha . tatra etasmin vyapekym smarthye nnkrakt nightayumadasmadde prpnuvanti . tem pratiedha vaktavya . nighta . ayam daa . hara anena . asti daasya harate ca vyapek iti krtv nighta prpnoti . yumadasmadde . odanam paca . tava bhaviyati . odanam paca mama bhaviyati . asti odanasya yumadasmado ca vyapek iti krtv vmnvdaya prpnuvanti . tem pratiedha vaktavya . kim ucyate nnkrakt iti yad tena eva sajya hriyate . na api brma anyena sajya hriyate iti . kim tarhi . abdapramak vayam . yat abda ha tat asmkam pramam . abda ca iha sattm ha . ayam daa . asti iti gamyate . sa daa kart bhtv anyena abdena abhisambadhyamna karaam sampadyate . tat yath . ka cit kam cit prcchati . kva devadatta iti . sa tasmai cae . asau vrke iti . katarasmin . ya tihati iti . sa vrka adhikaraam bhtv anyena abdena abhisambadhyamna kart sampadyate . pracaye samsapratiedha . pracaye samsapratiedha vaktavya . rja gau ca ava ca purua ca rjagavvapuru iti . samarthatarm v . samarthatarm v padnm samsa bhaviyati . kni puna samarthatari . yni dvandvabhvni . kuta etat . em hi utar vrtti prpnoti . tat yath samarthatara ayam mavaka adhyayanya iti ucyate . rutaragrantha iti gamyate . apara ha : samarthatarm v padnm samsa bhaviyati . kni puna samarthatari . yni dvandvabhvni . kuta etat . etni samnavibhaktni anyavibhakti rj . bhavati viea svasmin bhrtari pitrvyaputre ca . samudyasmarthyt v siddham amudyasmarthyt v puna siddham etat . samudyena rja smarthyam bhavati na avayavena . apara ha . samarthatarm v samudyasmarthyt . samarthatarm v padnm samsa bhavati . kuta etat . samudyasmarthyt eva . asmin pake v iti etat asamarthitam bhavati . etat ca samarthitam . katham . na eva v puna atra rja avapuruau apekamasya gav saha samsa bhavati . kim tarhi . go rjnam apekamasya svapurubhym samsa samsa bhavati . pradhnam atra tada gau bhavati . bhavati ca pradhnasya spekasya api samsa . (P_2,1.1.7) KA_I,367.10-368.24 Ro_II,532-537 khytam svyayakrakavieaam vkyam . khytam svyayam sakrakam sakrakavieaam vkyasajam bhavati vaktavyam . svyayam . uccai pahati . ncai pahati . sakrakam . odanam pacati . sakrakavieaam . odanam mrdu viadam pacati . sakriyvieaam ca iti vaktavyam . suhu pacati . duhu pacati . apara ha : khytam savieaam iti eva . sarvi hi etni kriyvieani . ekati . ekati vkyasajam bhavati vaktavyam . brhi brhi . samnavkye nightayumadasmadde . samnavkye iti prakrtya nightayumadasmadde vaktavy . kim prayojanam . nnvkye m bhvan nightdaya iti . ayam daa . hara anena . odanam paca . tava bhaviyati . odanam paca . mama bhaviyati . yoge pratiedha cdibhi . cdibhi yoge pratiedha vaktavya . grma tava ca svam mama ca svam . kimartham icam ucyate . yathnysam eva cdibhi yoge pratiedha ucyate . idam adya
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (8 of 73) [3/8/2008 12:51:36 PM]

Patanjali: Vyakaranamahabhasya, 2

aprvam kriyate vkyasaj samnavkydhikra ca . tat dveyam vijnyt : sarvam etat vikalpate iti . tat crya suhrt bhtv anvcae cdibhi yoge yathnysam eva bhavati iti . samarthanighte hi samndhikaraayuktayukteu upasakhynam asamarthatvt . samarthanighte hi samndhikaraayuktayukteu upasakhynam kartavyam syt . samndhikarae . paave te dsymi . mrdave te dsymi . samndhikarae . yuktayukte . nady tihati kle . vrkasya lambate kh . lnm te odanam dadmi . lnm me odanam dadti . kim puna kraam na sidhyati . asamarthatvt . rjagavkre dvisamsaprasaga dviahbhvt . rjagavkre dvisamsaprasaga . kim kraam . dviahbhvt . dve hi atra ahyau . rja go kram iti . kim ucyate dvisamsaprasaga iti yvat sup saha sup iti vartate . dvisamsaprasaga iti na evam vijyate dvayo subantayo samsaprasaga dvisamsaprasaga iti . katham tarhi . dviprakrasya samsasya prasaga dvisamsaprasaga iti . rjagokram iti api prpnoti na ca evam bhavitavyam . bhavitavyam ca yad etat vkyam bhavati go kram gokram rja gokram rjagokram iti . yad tu etat vkyam bhavati rja go kram iti tad na bhavitavyam tad ca prpnoti . tad kasmt na bhavati . siddham tu rjaviiy go krea smarthyt . siddham etat . katham . rjaviiy go krea saha samsa bhavati na kevaly . kim vaktavyam etat . na hi . katham anucyamnam gasyate . yath eva ayam gavi yatate na kramtrea santoam karoti evam rjani api yatate . rja y gau tasy yat kram iti . na eva v puna atra go rjnam apekamy krea saha samsa prpnoti . kim kraam . asmarthyt . katham asmarthyam . spekam asamartham bhavati iti . katham tarhi go kram apekamy rj saha samsa bhavati . pradhnam atra tada gau bhavati . bhavati ca pradhnasya spekasya api samsa . (P_2,1.1.8) KA_I,368.25-369.24 Ro_II,537-540 atha kimartham padavidhau samarthdhikra kriyate . padavidhau samarthavacanam varraye stre nantaryavijnt. padavidhau samarthdhikra kriyate varraye stre nantaryamtre kryam yath vijyeta . tihatu dadhi ana tvam kena . tihatu kumr chatram hara devadatta iti . samarthdhikrasya vidheyasmndhikarayt nirdenarthakyam . samarthdhikra ayam vidheyena samndhikaraa . kim ca vidheyam . samsa . yvat bryt samartha samsa iti tvat samartha padavidhi . na ca rjapurua iti etasym avasthym samarthdhikrea kim cit api akyam pravartayitum nivartayitum v . samarthdhikrasya vidheyasmndhikarayt nirdea anarthaka . siddham tu samarthnm iti vacant . siddham etat . katham . samarthnm padnm vidhi iti vaktavyam . evam api dvyekayo na prpnoti . ekaeanirdet v . atha v ekaeanirdea ayam. samarthasya ca samarthayo ca samarthnm ca samarthnm iti . evam api aprabhrtnm eva prpnoti . aprabhrtiu hi ekaea parisampyate . na ea doa . pratyekam vkyaparisampti dr iti dvyekayo api bhaviyati . evam api vivibhaktnm na prpnoti . samartht samarthe padt pade iti . evam tarhi samarthapadayo vidhiabdena sarvavibhaktyanta samsa : samarthasya vidhi samarthavidhi , samarthayo vidhi samarthavidhi , samartht vidhi samarthavidhi , samarthe vidhi samarthvidhi . padasya vidhi padavidhi , padayo vidhi padavidhi , padnm vidhi padavidhi , padt vidhi padavidhi , pade vidhi padavidhi . samarthavidhi ca samarthavidhi ca samarthavidhi ca samarthavidhi ca samarthavidhi ca samarthavidhi . padavidhi ca padavidhi ca
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (9 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

padavidhi ca padavidhi ca padavidhi ca padavidhi . samarthavidhi ca padavidhi ca samartha padavidhi . prva samsa uttarapadalop ydrcchikvibhakti . (P_2,1.1.9) KA_I,370.1-371.24 Ro_II,540-546 samndhikaraeu upasakhynam asamarthatvt . samndhikaraeu upasakhynam kartavyam . vra prua vrapurua . kim puna kraam na sidhyati . asamarthatvt . katham asamarthatvam . dravyam padrtha iti cet. yadi dravyam padrtha na bhavati tad smarthyam . atha hi gua padrtha bhavati tad smarthyam . anya hi vratvam gua anya hi puruatvam . na anyatvam asti iti iyat smarthyam bhavati . anya hi devadatta gobhya avebhya ca na ca tasya etvat smartham bhavati . ka v viea yat gue padrthe smarthyam syt dravye ca na syt . ea viea . ekam tayo adhikaraam anya ca vratvam gua anya puruatvam . dravyapadrthikasya api tarhi guabhedt smarthyam bhaviyati . aakya dravyapadrthikena dravyasya guakrta upakra pratijtum . nanu ca abhyantara asau bhavati . yadi api abhyantara na tu gamyate . na hi gua iti ukte madhuratvam gamyate rgaveram iti v kaukatvam . guapadrthikena api tarhi aakya guasya dravyakrta upakra pratijtum . atha guapadrthika pratijnte dravyapadrthika api kasmt na pratijnte . evam anayo smarthyam syt v na v . kva ca tvat idam syt samndhikaraena iti . yatra sarvam samman : indra akra puruhta purandara . kandu koha kula iti . na evajtyaknm samsena bhavitavyam pratyayena v utpattavyam . kim kraam . arthagatyartha abdaprayoga . artham pratyyayiymi iti abda prayujyate . tatra ekena uktatvt tasya arthasya dvityasya prayogea na bhavitavyam . kim kraam . uktrthnm aprayoga iti . na tarhi idnm idam bhavati bhrtyabharaya iti . na etau samnrthau . eka atra akyrthe krtya bhavati apara arhatyarthe : akya bhartum bhrtya . arhati bhrtim bharaya . bhrtya bharaya bhrtyabharaya iti . yadi tarhi yatra kim cit samnam ka cit viea tatra bhavitavyam iha api tarhi prpnoti . daranyy mt daranyamt iti . atra api kim cit samnam ka cit viea . kim puna tat . sadbhvnyabhvau . na kva cit sadbhvnyabhvau na sta ucyate ca samndhikaraena iti . tatra prakaragati vijsyate : yatra sdhya smndhikarayam . kva ca sdhya smndhikarayam . yatra sarvam samnam sadbhvnyabhvau dravyam ca. atha v samndhikaraena iti tat samnam ryate yat samnam bhavati na ca bhavati . na ca etat samnam kva cit api na bhavati . atha v yvat bryt samnadravyea iti tvat samndhikaraena iti . dravyam hi loke adhikaraam iti ucyate . tat yath . ekasmin dravye vyuditam . ekasmin adhikarae vyuditam iti . tath vykarae vipratiiddham ca anadhikaraavci iti adravyavci iti gamyate . evam api idam avayam kartavyam samndhikaraam asamarthavat bhavati iti . kim prayojanam . sarpi klakam yaju ptakam iti evamartham . yadi samndhikaraam asamarthavat bhavati iti ucyate sarpi pyate yaju kriyate iti atra atvam na prpnoti . adhtvabhihitam iti evam tat . evam ca krtv samndhikaraeu upasakhynam kartavyam . vra prua vrapurua . kim kraam asamarthatvt . na v vacanaprmyt . na v kartavyam . kim kraam . vacanaprmyt . vacanaprmyt atra samsa bhaviyati . kim vacanaprmyam . samnamadhyamadhyamavr ca iti . luptkhyteu ca . luptkhyteu ca upasakhynam kartavyam . nikaumbi nirvrasi . luptkhyteu ca . kim . vacanaprmyt . kim vacanaprmyam . kugatiprdaya ca iti . asti anyat etasya vacane prayojanam . kim . surj
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (10 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

atirj iti . na brma vrttistravacanaprmyt iti . kim tarhi . vrttikavacanaprmyt iti . siddham tu kvksvatidurgativacant prdaya ktrthe iti . tadarthagate v . tadarthagate v puna siddham etat . kim idam tadarthagate iti . tasya artha tadartha tadarthasya gati tadarthagati tadarthagate iti . yasya arthasya kaumby smarthyam sa nis ucyate . atha v sa artha tadartha tadarthasya gati tadarthagati tadarthagate iti . ya artha kaumby samartha sa nis ucyate . (P_2,1.1.10) KA_I,371.25-374.18 Ro_II,547-554 atha yatra bahnm samsaprasaga kim tatra dvayo dvayo samsa bhavati hosvit avieea . ka ca atra viea . samsa dvayo dvayo cet dvandve anekagrahaam . samsa dvayo dvayo cet dvandve anekagrahaam kartavyam . carthe dvandva . anekam iti vaktavyam iha api yath syt . plakanyagrodhakhadirapal iti . na ea doa . atra api dvayo dvayo samsa bhaviyati . dvayo dvayo samsa iti cet na bahuu dvitvbhvt . dvayo dvayo samsa iti cet tat na . kim kraam . bahuu dvitvbhvt . na bahuu dvitvam asti . na avayam evam vigraha kartavya : plaka ca nyagrodha ca khadira ca pala ca iti . kim tarhi evam vighraha kariyate : plaka ca nyagrodha ca plakanyagrodhau khadira ca pala ca khadirapalau plakanyagrodhau ca khadirapalau plakanyagrodhakhadirapal iti . hotrpotrneodgtra tarhi na sidhyanti . hotpotneodgtra iti prpnoti . na ca evam bhavitavyam . bhavitavyam ca yad evam vigraha kriyate hot ca pot ca hotpotrau ne ca udgt ca neodgtrau hotpotrau ca neodgtrau ca hotpotneodgtra iti . hotrpotrneodgtra tu na sidhyanti . samsntapratiedha ca . samsntasya ca pratiedha vaktavya . vktvaksrugdradam iti . vktvacasrugdradam iti prpnoti . na ea doa . atra api parea parea saha samsa bhaviyati . sruk ca dradam ca srugdradam tvak ca srugdradam ca tvaksrugdradam vk ca tvaksrugdradam ca vktvaksrugdradam iti . hotrpotrneodgtra evam tarhi sidhyanti . iha ca susukmajaakeena sunatjivsan samantaitirandhrea dvayo vrttau na sidhyati . astu tarhi avieea . avieea bahuvrhau anekapadaprasaga . yadi avieea bahuvrhau anekapadaprasaga . tatra ka doa . tatra svarasamsntapuvadbhveu doa . tatra svarasamsntapuvadbhveu doa bhavati . svara . prvalpriya aparalpriya . svara . samsnta . pacagavapriya . samsnta . puvadbhva . khdiretaraamyam rauravetaramyam . na v avayavatatpuruatvt. na v ea doa . kim kraam . avayavatatpuruatvt . avayava atra tatpuruasaja tadrayau samsntapuvadbhvau bhaviyata . svara katham . tasya antodttatvam vipratiedht . antodttatvam kriyatm prvapadaprakrtisvara iti antodttatvam bhavati vipratiedhena . na ea yukta vipratiedha . vipratiedhe param iti ucyate . prvam ca antodttatvam param prvapadaprakrtisvaratvam . na paravipratiedham brma . kim tarhi . antaragavipratiedham . nimittisvarabalyastvt v . atha v nimittasvart nimittisvara balyn iti vaktavyam . kim puna nimittam ka v nimitt . bahuvrhi nimittam tatpurua nimitt . tat tarhi vaktavyam nimittasvart nimittisvara balyn iti . na vaktavyam . ekaitiptsvaravacanam tu jpakam nimittisvarabalyastvasya . yat ayam yuktrohydiu ekaitipacchabdam pahati tat jpayati crya nimittasvart nimittisvara balyn iti . ka puna arhati yuktrohydiu ekaitipacchabdam pahitum . evam kila nma pahyate eka iti ekaiti eka iti pda yasya iti . tat ca na . evam vigraha kariyate . eka iti eu te ime ekaitaya ekaitaya pd yasya iti . atha api evam vigraha kriyate eka iti ekaiti eka
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (11 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

iti pda yasya iti evam api na artha phena . igante dvigau iti ea svara atra bdhaka bhaviyati . asya tarhi bahuvrhyavayavasya tatpuruaj prpnoti susukmajaakeena sunatjivsan samantaitirandhrea iti . tatra ka doa . tasya antodttatvam vipratiedht iti antodttatvam syt vipratiedhena . na ea doa . na idam bahuvrhyavayavasya tatpuruasya lakaam rabhyate . kim tarhi . yasya bahuvrhyavayavasya tatpuruasya tat lakaam asti tasya antodttatvam bhaviyati vipratiedhena . nanu ca asya api asti kim vieaam vieyea bahulam iti. bahulavacant na bhaviyati . asya tarhi bahuvrhyavayavasya tatpuruaj prpnoti . adhikaaivara iti . tatra ka doa . tasya antodttatvam vipratiedht iti antodttatvam syt vipratiedhena . na ea doa . igante dvigau iti ea svara bhaviyati . ya tarhi na iganta adhikaatavara iti . iha ca api adhikaaivara iti samsanta prpnoti . acprakarae sakhyy tatpuruasya upasakhynam nistridyartham iti . na ea doa . avyayde iti evam tat . kim puna kraam avyayde iti evam tat . iha m bht gotriat gocatvriat iti . bahuvrhisaj tarhi prpnoti. sakhyay avyaysanndrdhikasahy sakhyeye iti . na sakhym sakhyeye vartayiyma . katham . evam vigraha kariyate adhik ai varm asya iti . yath tarhi sa yoga pratykhyyate tath prvea prpnoti . katham ca sa yoga pratykhyyate . aiya sakhyottarapada sakhy iva abhidhyitvt iti . pratykhyte tasmin yoge sakhym sakhyeye vartayiyma . tatra evam vigraha kariyate adhik ai vari asya iti . sarvatha vayam adhikaaivart na mucymahe . katham . yvat sa ca yoga pratykhyyate ayam ca vigraha asti adhik ai varm asya iti . yat tu tat uktam adhikaaivara na sidhyati iti sa siddha bhavati . katham . yvat sa ca yoga pratykhyyate ayam ca vigraha asti adhik ai vari asya iti . adhikaatavara tu na sidhyati . kartavya atra yatna . (P_2,1.2) KA_I,375.2-376.23 Ro_II,555-561 sup iti kimartham . karoi aan . na etat asti . asmarthyt atra na bhaviyati . katham asmarthyam . samndhikaraam asamarthavat bhavati iti . idam tarhi . pye pyamna . idam ca api udharaam karoi aan . nanu ca uktam asmarthyt atra na bhaviyati . katham asmarthyam . samndhikaraam asamarthavat bhavati iti . na ea doa . adhtvabhihitam iti evam tat . mantritasya pargvadbhve ahymantritakrakavacanam . mantritasya pargvadbhve ahyantam mantritakrakam ca parasya agavat bhavati iti vaktavyam . athyantam tvat . madrm rjan magadhnm rjan . mantritakrakam . kuena aan . na asti atra viea pargavadbhve sati asati v . idam tarhi . paraun vrcan . tannimittagrahaam v . tannimittagrahaam v kartavyam. mantritanimittam parasya agavat bhavati iti vaktavyam . tat ca avayam anyatarat vaktavyam . avacane hi subantamtraprasaga . anucyamne hi etasmin subantramtrasya pargavadbhva prpnoti . asya api prasajyeta . ktrea agne svyu sarabhasya mitrea agne mitradheye yatasva . kim puna atra jyya . tannimittagrahaam eva jyya . idam api siddham bhavati . gou svmin aveu svmin . etat hi na eva athyantam na api mantritakrakam . subantasya pargavadbhve samndhikaraasya upasakhyanam ananantaratvt . subantasya pargavadbhve samndhikaraasya upasakhyanam kartavyam . tkay scy svyan tkena paraun vrcan . kim puna kraam na sidhyati . ananantaratvt . nanu ca parasya pargavadbhve krte prvasya api bhaviyati . svare avadhrat ca . svare avadhrat ca na sidhyati . svare
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (12 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

avadhraam kriyate na nantarye . param api chandasi . param api chandasi prvasya agavat bhavati iti vaktavyam . te pita marutm sumnam etu . prati tv duhita diva . vrva duhita diva . avyayapratiedha ca . avyaynm ca pratiedha vaktavya . uccai adhyna ncai adhyna . anavyaybhvasya . anavyaybhvasya iti vaktavyam . iha m bht . upgni adhyna pratyagni adhyna . atha kimartham svare avadhraam kriyate . svare avadhraam subaloprtham . svare avadhraam kriyate subla m bht iti . paraun vrcan . na v subantaikntatvt . na v kartavyam . kim kraam . subantaikntatvt . subantaiknta pargavadbhva bhavati . prtipadikaiknta tu sublope . prtipadikaiknta tu bhavati sublope krte . pratyayalakaena subantaikntat syt . tasmt svare avadhraam na kartavyam subaloprtham . prtipadikasthy supa luk ucyate . tasmt svaragrahaena na artha . idam tarhi prayojanam atvaatve m bhtm iti . kpe sican carma naman iti . etat api na asti prayojanam . iha tvat kpe sican iti svrayam padditvam bhaviyati . carma naman iti prvapadt sajym aga iti etasmt niyamt na bhaviyati . nanu ca samse etat bhavati prvapadam uttarapadam iti . na iti ha . avieea etat bhavati . prvam padam prvapadam uttaram padam uttarapadam iti . (P_2,1.3) KA_I,377.2-21 Ro_II,561-565 prgvacanam kimartham . prgvacanam sajnivrttyartham . prgvacanam kriyate samsasajy anivrtti yath syt . akriyame hi prgvacane anavak avyaybhvdaya saj samsasajm bdheran . t m bdhiata iti prgvacanam kriyate . atha kriyame api prgvacane yvat anavak avyaybhvdaya saj kasmt eva na bdhante . kriyame hi prgvacane satym samsasajym et avayavasaj rabhyante . tatra vacanasamvea bhaviyati . samsasaj api anavak . s vacant bhaviyati . svak samsasaj . ka avaka . vispadni avaka . vispaam pau vispaapau iti . na ea asti avaka . e hi cryasya ail lakyate yena eva avayavakryam bhavati tena eva samudyakryam api bhavati . yena eva avayavakryam svara tena eva samudkryam api samsa bhaviyati . vispadni guavacaneu iti . idam tarhi kkatlyam ajkrpyam . atra api yena eva avayavakryam pratyayotpatti kriyate tena eva samudkryam samsasaj bhaviyati . samst ca tadviayt . idam tarhi punrja punargava . atra api avayam tatpuruasaj vaktavya tatpururaya samsnta yath syt . idam tarhi . punardheyam . atra api avayam gatisaj vaktavy gatikrakopapadt krt iti ea svara yath syt . idam tarhi punarutsytam vsa deyam . atra api avayam gatisaj vaktavy gati gatau iti nighta yath syt . yadi tat na asti punacanasau chandasi iti. sati tasmin tena eva siddham . evam api ek saj iti vacant na asti yaugapadyena sambhava . paryya prasajyeta . tasmt prgvacanam kartavyam . (P_2,1.4) KA_I,377.23-378.15 Ro_II,565-569 sahavacanam kimartham . sahavacanam prthak asamsrtham . sahagrahaam kriyate sahabhtayo samsaj yath syt ekaikasya m bht iti . kim ca syt . yadi ekaikasya samsaj syt iha rkpda iti samsnta prasajyeta . iha ca rjva iti dvau svarau sytm . katham ca krtv ekaikasya saj prpnoti . pratyekam vkyaparisampti dr . tat yath vrddhiguasaje pratyekam bhavata . nanu ca ayam api asti drnta samudye vkyaparisampti iti . tat yath garg atam dayantm iti . arthina ca rjna hirayena bhavanti na ca pratyekam daayanti .
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (13 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

sati etasmin drnte yadi tatra pratyekam iti ucyate iha api sahagrahaam kartavyam . atha tatra antarea pratyekam iti vacanam pratyekam guavrddhisaje bhavata iha api na artha sahagrahaena . evam tarhi siddhe sati yat sahagrahaam karoti tasya etat prayojanam yoggam yath vijyeta . sati ca yogge yogavibhga kariyate . saha sup samasyate . kena saha . samarthena. anuvycalat anuprviat . tata sup . sup ca saha sup samasyate . adhikra ca lakaam ca . yasya samsasya anyat lakaam na asti idam tasya lakaam bhaviyati . punarutsytam vsa deyam punarnikrta ratha iti . ivena vibhaktyalopa prvapadaprakrtisvaratvam ca . ivena saha samsa vibhaktyalopa prvapadaprakrtisvaratvam ca vaktavyam . vsasiva kanye iva . (P_2,1.5) KA_I,378.17-19 Ro_II,569 kimartham mahat saj kriyate . anvarthasaj yath vijayeta . anavyayam avyayam bhavati iti avyaybhva . avyaybhva ca samsa avyayasaja bhavati iti etat na vaktavyam bhavati . (P_2,1.6) KA_I,378.23-379.5 Ro_II,569-570 iha kasmt na bhavati . sumadr sumagadh saputra sacchtra iti . samrddhau skalye iti ca prpnoti . na ea doa . iha ka cit samsa prvapadrthapradhna , ka cit uttarapadrthapradhna , ka cit anyapadrthapradhna , ka cit ubhayapadrthapradhna . prvapadrthapradhna avyaybhva , uttarapadrthapradhna tatpurua , anyapadrthapradhna bahuvrhi ubhayapadrthapradhna dvandva . na ca atra prvapadrthaprdhnyam gamyate . atha v na ime samsrth nirdiyante . kim tarhi . avyayrth nirdiyante ime . eteu artheu yat avyayam vartate tat subantena samasyate iti . (P_2,1.7) KA_I,379.7-12 Ro_II,570-572 asdrye iti kimartham . yath devadatta tath yajadatta iti . asdrye iti ucyate . tatra idam na sidhyati : yathakti yathbalam iti . kim kraam . yath iti ayam prakravacane thl sa ca sdrye vartate . na ea doa . ayam yathabda asti eva avyutpannam prtipadikam vpsvc . asti prakravacane thl . tat yat avyutpannam prtipadikam vpsvci tasya idam grahaam . atha ya prakravacane thl tasya grahaam kasmt na bhavati . prvea prpnoti sdryasampatti iti . pratiedhavacanasmarthyt na bhaviyati . (P_2,1.9) KA_I,379.14-15 Ro_II,572 sup iti vartamne puna subgrahaam kimartham . avyayam iti evam tat abht submtre yath syt . maprati spaprati odanaprati . (P_2,1.10) KA_I,379.17-380.5 Ro_II,573-574 akdaya trtynt prvoktasya yath na tat . akdaya trtynt pari saha samasyante iti vaktavyam . prvoktasya yath na tat . ayathjtyake dyotye . akea na tath vrttam yath prvam iti akapari alkpari . ekatve akaalkayo . akaalkayo ca ekavacanntayo iti vaktavyam . iha m bht . akbhym vrttam akai vrttam . kitavavyavahre ca . kitavavyavahre iti vaktavyam . iha m bht . akea idam na vrttam akaena yath prvam . (P_2,1.11-12) KA_I,380.7-12 Ro_II,574-575 yogavibhga kartavya . vibh iti ayam adhikra. tata apaparibahiracava pacamy iti . pacamgrahaam akyam akartum . katham . subantena iti vartate etai ca karmapravacanyai yoge pacam vidhyate . tatra
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (14 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

antarea api pacamgrahaam pacamyantena eva samsa bhaviyati . idam tarhi prayojanam . bahiabdena yoge pacam na vidhyate . tatra api yath syt iti . bahirgrmt . atha kriyame api pacamgrahae yvat bahiabdena yoge pacam na vidhyate katham eva etat sidhyati . pacamgrahaasmarthyt . (P_2,1.13) KA_I,380.14-16 Ro_II,575 marydbhividhigrahaam akyam akartum . katham . pacamyantena iti vartate ca karmapravacanyayukte pacam vidhyate . etayo ca eva arthayo karmapravacanyasaja bhavati na anyatra . (P_2,1.16) KA_I,380.18-23 Ro_II,575-576 kim udharaam . anugagam hstinapuram anugagam vras anuoam paliputram . yasya ca yma iti ucyate gag ca api yat vras api yat . tatra kuta etat gagay saha samsa bhaviyati na puna vrasy iti . evarm tarhi lakaena iti vartate gag ca eva hi lakaam na vras . atha v yasya ca yma iti ucyate gag ca api yat vras api yat . tatra prakaragati vijsyate : sdhya yasya yma iti . sdhya ca gagy na vrasy . (P_2,1.17) KA_I,381.2-7 Ro_II,576-577 kimartha cakra . evakrrtha . tihadguprabhrtni eva . kva m bht . paramam tihadgu . tihadgu klaviee . tihadgu klaviee iti vaktavyam . tihanti gva asmin kle tihadgu . vahadgu . khaleyavdni prathamntni anyapadrthe . khaleyavdni prathamntni anyapadrthe samasyante . khaleyavam khalebusam lnayavam lyamnayavam ptayavam pyamnayavam . (P_2,1.18) KA_I,381.9-382.3 Ro_II,577-579 vvacanam kimartham . vibh samsa yatha syt . samsena mukte vkyam api yath syt . pram gagy iti . na etat asti prayojanam . prakrt mahvibh . tay vkyam api bhaviyati . idam tarhi prayojanam avyaybhvena mukte ahsamsa yath syt . gagpram iti . etat api na asti prayojanam . ayam api vibh ahsamsa api . tau ubhau vacant bhaviyata . ata uttaram pahati . pre madhye ahy vvacanam . pre madhye ahy v iti vaktavyam . avacane hi ahsamsbhva yath ekadeipradhne . akriyame hi vvacane ahsamsasya abhva syt yath ekadeipradhne . tat yatha ekadeisamsena mukte ahsamsa na bhavati . kim puna kraam ekadeisamsena mukte ahsamsa na bhavati . samsataddhitnm vrtti vibh . vrttiviaye nitya apavda . iha puna vvacane kriyame ekay vrtti vibh aparay vrttiviaye vibhpavda . ekrntaniptanam ca . ekrntaniptanam ca kartavyam . pregagam iti . na kartavyam . saptamy aluk siddham . bhavet siddham yad saptam yad tu any vibhaktaya tad na sidhyati . (P_2,1.20) KA_I,382.5-21 Ro_II,579-582 nadbhi sakhysamse anyapadrthe pratiedha . nadbhi sakhysamse anyapadrthe pratiedha vaktavya . dvrvatka dea trrvatka dea . nadbhi sakhy iti prpnoti . na vaktavya . iha ka cit samsa prvapadrthapradhna , ka cit uttarapadrthapradhna , ka cit anyapadrthapradhna , ka cit ubhayapadrthapradhna . prvapadrthapradhna avyaybhva , uttarapadrthapradhna tatpurua , anyapadrthapradhna bahuvrhi , ubhayapadrthapradhna dvandva. na ca atra prvapadrthaprdhnyam gamyate . nanu ca yat yena ucyate sa tasya artha bhavati . atra ca vayam etbhym padbhym etam
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (15 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

artham ucyamnam payma . etat eva ca jnma yat yena ucyate sa tasya artha iti . api ca anyapadrthat na prakalpeta . citragu abalagu iti . kim kraam . atra api hi vayam etbhym abdbhym etam artham ucyamnam payma . yadi api atra etbhym abdbhym ea artha ucyate anyapadrtha api tu gamyate . tatra anyapadrthraya bahuvrhi bhaviyati . iha api tarhi anyapadrtha gamyate svapadrtha api tu gamyate . tatra svapadrthraya avyaybhva prpnoti . evam tarhi idam iha sampradhryam . avyaybhva kriyatm bahuvrhi iti . bahuvrhi bhaviyati vipratiedhena . bhavet ekasajdhikre siddham parakryatve tu na sidhyati . rambhasmarthyt avyaybhva prpnoti parakryatvt ca bahuvrhi . parakryatve ca na doa . nadbhi sakhyy samhre avyaybhva vaktavya . sa ca avayam vaktavya . sarvam ekanadtare . (P_2,1.23) KA_I,382.23-24 Ro_II,582 dvigo tatpuruatve kni prayojanni . dvigo tatpuruatve samsnt prayojanam . pacagavam daagavam pacarjam daarjam . (P_2,1.24) KA_I,383.2-384,8 Ro_II,582-587 ritdiu gamigmydnm upasakhynam . ritdiu gamigmydnm upasakhynam kartavyam . grmam gam gramagam gramam gm grmagm . ritdibhi ahne dvitysamsavacannarthakyam bahuvrhikrtatvt . ritdibhi ahnavciny dvityy samsavacanam anarthakam . kim kraam . bahuvrhikrtatvt . iha hi ya kaam rita kaam anena ritam bhavati . tatra bahuvrhi siddham . ahne dvtysvaravacannarthakyam ca . ahne dvity prvapadam prakrtisvaram bhavati iti etat svaravacanam anarthakam . kim kraam . bahuvrhikrtatvt eva . jtisvaraprasaga tu . jtisvara tu prpnoti . grmatata arayagata . jtiklasukhdibhya ancchdant kta akrtamitapratipann iti . tatra jtdiu vvacant siddham . yat etat v jte iti etat v jtdiu iti vakymi . ime jtdaya bhaviyanti . nanu ca bheda bhavati . bahuvrhau sati samsntodttatvena api bhavitavyam prvapadaprakrtisvaratvena api tatpuruatve sati prvapadaprakrtisvaratvena eva . na asti bheda . ya api tatpuruam rabhate na tasya daavrita bahuvrhi . tatra tatpurue sati dvau samsau dvau svarau . bahuvrhau sati eka samsa dvisvaratvam . evam tarhi siddhe sati yat tatpuruam sti tat jpayati crya samne arthe kevalam vigrahabhedt yatra tatpurua prpnoti bahuvrhi ca tatra tatpurua bhavati iti . kim etasya jpane prayojanam . rja sakh rjasakha . rj sakh asya iti bahuvrhi na bhavati . na etat jpakasdhyam apavdai utsarg bdhyante iti . bdhakena anena bhavitavyam smnyavihitasya vieavihitena . atha na smnyavihita . yat ucyate bahuvrhikrtatvt iti etat ayuktam . asti khalu api viea bahuvrhe tatpuruasya ca . kim abdakrta atha arthakrta . abdakrta va arthakrta ca . abdakrta tvat . bahuvrhau sati kap bhavitavyam . tatpurue sati na bhavitavyam . arthakrta . tatpurue sati ruhdnm kta kartari bhavati dhtvarthasya anapavarge . rha vrkam devadatta iti . bahuvrhau vyapavrkte karmai bhavati . rha vrka devadattena iti . anyathjtyaka khalu api pratyakea arthasampratyaya anyathjtyaka sambandht . rja sakh rjasakh . sambandht etat gantavyam nnam rja api asya sakh iti . ubhayam khalu api iyate : svasti somasakh puna ehi . gavsakha iti . (P_2,1.26) KA_I,384.10-12 Ro_II,587 kim udharaam . khavrha jlma . kepe iti ucyate . ka kepa nma . adhtya sntv gurubhi anujtena khav rohavy . ya idnm ata anyatha karoti sa khavrha ayam jlma . na ativratavn iti .
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (16 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

(P_2,1.29) KA_I,384.14-20 Ro_II,588 atyantasayoge samsasya avieavacant ktena samsavacannarthakyam . atyantasayoge samsasya avieavacant ktntena ca aktntena ca kl ktntena iti samsavacanam anarthakam . atyantasayoge iti eva siddham . anatyantasayogrtham tu . anatyantasayogrtham tarhi idam vaktavyam . a muhrt carcar . te kad cit aha gacchanti kad cit rtrim . tat ucyate ahargat rtrigat iti . na etat asti . gatagrahat api etat siddham . idam tarhi . aharatisrt rtryatisrt msapramita candram . (P_2,1.30) KA_I,384.22-385.22 Ro_II,589-592 tatkrtrthena iti kimartham . dadhn pau ghrtena pau . na etat asti . asmarthyt atra na bhaviyati . katham asmarthyam . spekam asamartham bhavati iti . na hi dadhna paun smarthyam . kena tarhi . bhujin . dadhn bhukte pau iti . iha api tarhi na prpnoti . akulkhaa kirika iti . atra api na akuly khaena smarthyam . kena tarhi . karotin . akulay krta khaa iti . vacant bhaviyati . iha api vacant bhaviyati dadhn pau ghrtena pau iti . tasmt tatkrtrthagrahaam kartavyam . guavacanena iti kimartham . gobhi vapvn dhnyena dhanavn . kim puna iha udharaam . akulkhaa devadatta iti . katham puna guavacanena samsa ucyamna dravyavacanena syt . iha trty tatkrtrthena guena iti iyat siddham . sa ayam evam siddhe sati yat vacanagrahaam karoti tasya etat prayojanam evam yath vijyeta guam uktavat guavacanena iti . katham puna ayam guavacana san dravyavacana sampadyate . rabhyate tatra matublopa guavacanebhya matupa luk iti . tat yath uklagua ukla kragua kra evam khaagua khaa . yadi evam na artha krtrthagrahaena . bhavati hi akuly khaena smarthyam . asmarthyt ca atra na bhaviyati dadhn pau ghrtena pau iti . tasmat na artha tatkrtrthagrahaena . trtysamse arthagrahaam anarthakam arthagati hi avacant . trtysamse arthagrahaam anarthakam . kim kraam . arthagati hi avacant . antarea api vacanam arthagati bhaviyati . nirdeyam iti cet trtyrthanirdea api . atha evam api nirdea kartavya iti cet trtyrthanirdea api kartavya syt . trty tadarthakrtrthena iti vaktavyam . tat tarhi vaktavyam . na vaktavyam . na ayam arthanirdea . kim tarhi . yoggam idam nirdiyate . sati ca yogge yogavibhga kariyate . trty tatkrtena guavacanena samasyate . tata arthena . arthaabdena ca trty samasyate . dhnyrtha vasanrtha . prvasadrasamonrtha iti arthagrahaam na kartavyam bhavati . (P_2,1.31) KA_I,385.24-386.3 Ro_II,592-593 prvdiu avarasya upasakhynam . prvdiu avarasya upasakhynam . msvara ayam savatsarvara ayam . sadragrahae uktam . kim uktam . sadragrahaam anarthakam trtysamsavacant . ahyartham iti cet trtysamsavacannarthakyam iti . (P_2,1.32) KA_I,386.5-8 Ro_II,593 kartrkarae krt ktena . kartrkarae krt ktena iti vaktavyam. ahihata nakhanirbhinna dtralna paraucchinna . krt ktena iti kimartham . iha m bht . dtrea lnavn paraun chinnavn . tat tarhi vaktavyam . na vaktavyam . bahulavacant siddham . (P_2,1.33) KA_I,386.10-15 Ro_II,594 krtryai adhikrthavacane anyatra api dryate .krtryai

file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (17 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

adhikrthavacane anyatra api dryate iti vaktavyam . busopendhyam tropendhyam ghanaghtyam . sdhanam krt iti v pdahrakdyartham . atha v sdhanam krt saha samasyate iti vaktavyam . kim prayojanam . pdahrakdyartham . pdbhym hriyate pdahraka gale copyate galecopaka . (P_2,1.34-35) KA_I,386.18-388.4 Ro_II,595-597 annena vyajanam bhakyea mirkaraam iti asamarthasamsa . annena vyajanam bhakyea mirkaraam iti asamarthasamsa ayam draavya . kim kraam . krakm kriyay smarthyt . krakm kriyay smarthyam bhavati na tem anyonyena . tat yath nirayay dvbhym khbhym smarthyam na tem anyonyena . evam tarhi ha ayam annena vyajanam bhakyea mirkaraam iti na ca asti smarthyam . tatra vacant samsa bhaviyati . vacanaprmyt iti cet nnkrakm pratiedha . vacanaprmyt iti cet nnkrakm pratiedha vaktavya . tihatu dadhn odana bhujyate devadattena . siddham tu samndhikaradhikre kta trtyprvapada uttarapadalopa ca iddham etat . katham . samndhikaradhikre vaktavyam kta trtyprvapada samasyatesup uttarapadasya ca lopa bhavati iti . dadhn upasikta dadhyupasikta dadhyupasikta odana dadhyodana guena sasr guasasr , guasasr dhn guadhn . ahsamsa ca yuktaprnta . ahsamsa ca yuktaprnta samasyate uttarapadasya ca lopa vaktavya . avnm yukta avayukta avayukta ratha avaratha . dadhna pra dadipra dadhipra ghaa dadhighaa . tat tarhi bahu vaktavyam . na v asamse adarant . na v vaktavyam . kim kraam . asamse adarant . yat hi asamse dryate samse ca na dryate tat loprambham prayojayati . na ca asamse upasiktaabda sasraabda praabda v dryate . katham tarhi smarthyam gamyate . yuktrthasampratyayt ca smarthyam . dadhn yuktrthat sampratyate . katham puna jyate dadhn yuktrthat sampratyate iti . sampratyayt ca tadarthdhyavasnam . sampratyayt ca tadartha adhyavasyate . avayam ca etat evam vijeyam . sampratyamnrthalope hi anavasth .ya hi manyate sampratyamnrthnm abdnm lopa bhavati iti anavasth tasya lopasya syt . dadhi iti ukte bahava arth gamyante mandakam uttarakam nilnakam iti tadvcinm abdnm lopa vaktavya syt . tath gua iti ukte madhuraabdasya rgaveram iti ukte ca kauabdasya . antarea khalu api abdaprayogam bahava arth gamyante akinikocai pivihrai ca . tadvcinm abdnm lopa vaktavya syt . (P_2,1.36) KA_I,388.6-390.19 Ro_II,598-603 kim caturthyantasya tadarthamtrea samsa bhavati . evam bhavitum arhati . caturth tadarthamtrea cet sarvaprasaga aviet . caturth tadarthamtrea cet sarvaprasaga sarvasya caturthyantasya tadarthamtrea saha samsa prpnoti . anena api prpnoti . randhanya sthl avahananya ulkhalam iti . kim kraam . aviet . na hi ka cit viea updyate evajtyakasya caturthyantasya tadarthena saha samsa bhavati iti . anupdyamane viee sarvaprasaga . balirakitbhym ca anarthakam vacanam . balirakitbhym ca samsavacanam anarthakam . ya hi mahrjya bali mahrjrtha sa bhavati . tatra tadartha iti eva siddham . yadi puna vikrti caturthyant prakrty saha samasyate iti etat lakaam kriyeta . vikrti prakrty iti cet avaghsdnm upasakhynam . vikrti prakrty iti cet
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (18 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

avaghsdnm upasakhynam kartavyam . avaghsa varsuram hastividh iti . arthena nityasamsavacanam . arthabdena nityasamsa vaktavya . brhmartham katriyrtham . kim vikrti caturthyant prakrty saha samasyate iti ata arthena nityasamsa vaktavya . na iti ha sarvath arthena nityasamsa vaktavya vigraha m bht iti . sarvaligat ca . sarvaligat ca vaktavy . brhmartham paya brhmartha spa brhmarth yavg iti . kim arthena nityasamsa ucyate iti ata sarvaligat vaktavy . na iti ha . sarvath sarvaligat vaktavy . kim kraam . arthaabda ayam puliga uttarapadrthapradhna ca tatpurua . tena puligasya eva samsasya abhidhnam syt strnapusakaligasya na syt . tat tarhi bahu vaktavyam . vikrti prakrty iti vaktavyam . avaghsdnm upasakhynam kartavyam . arthena nityasamsa vaktavya . sarvaligat ca vaktavy . na vaktavyam . yat tvat ucyate vikrti prakrty iti vaktavyam . na vaktavyam . cryapravrtti jyapati vikrti caturthyant prakrty saha samasyate iti yat ayam balirakiitagrahaam karoti . katham krtv jpakam . yathjtyaknm samse balirakitagrahaena artha tathjtyaknm samsa . yadi ca vikrti caturthyant prakrty saha samasyate na tadarthamtrea tata balirakiitagrahaam arthavat bhavati . yat api ucyate avaghsdnm upasakhynam kartavyam iti . na kartavyam . avaghsdaya ahsams bhaviyanti . yat hi yadartham bhavati ayam api tatra abhisambandha bhavati asya idam iti . tat yath guro idam gurvartham iti . nanu ca svarabheda bhavati . caturthsamse sati prvapadaprakrtisvaratvena bhavitavyam ahsamse puna antodttatvena a asti bheda . caturthsamse api sati antodttatvena eva bhavitavyam . katham . cryapravrtti jpayati vikrti caturthyant prakrtisvar bhavati na caturthmtram iti yat ayam caturth tadarthe arthe kte ca iti arthagrahaam ktagrahaam ca karoti . katham krtv jpakam . yathjtyaknm arthagrahaena ktagrahaena ca artha tathjtyaknm prakrtisvaratvam . yadi ca vikrti caturthyant prakrty bhavati na caturthmtram tata arthagrahaam ktagrahaam ca arthavat bhavati .yat api ucyate arthena nityasamsa vaktavya iti . na vaktavya . sarthappratyaya kariyate . kim krtam bhavati . na ca eva hi kad cit vigraha bhavati . api ca sarvaligat siddh bhavati . yadi sarthapprataya kriyate itsaj na prpnoti . atha api katham cit itsaj syt evam api ryartham bhvartham iti agasya iti iyauvaau sytm . evam tarhi bahuvrhi bhavaiyati . kim krtam bhavati . bhavati vai ka cit asvapadavigraha bahuvrhi . tat yath obhanam mukham asy sumukh iti . na evam akyam . iha hi mahadartham iti ttvakapau prasajyetm . evam tarhi tadarthasya uttarapadasya arthaabda dea kariyate . kim krtam bhavati . na ca eva kad cit deena vigraha bhavati . api ca sarvaligat siddh bhavati . tat tarhi vaktavyam . na vaktavyam . yogavibhga kariyate . caturth subantena saha samasyate . tata tadarthrtha . tadarthasya uttarapadasya arthaabda dea bhavati . iha api tarhi samsa prpnoti chtrya rucitam chtrya svaditam iti . cryapravrtti jpayati tdarthye ya caturth s samasyate na caturthmtram iti yat ayam hitasukhagrahaam karoti . katham krtv jpakam . yathjtyaknm samse hitasukhagrahaena artha tathjtyaknam samsa . yadi ca tdarthye y caturth s samasyate na caturthmtram tata hitasukhagrahaam arthavat bhavati . iha api tarhi tadarthasya uttarapadasya arthaabda dea prpnoti . ypya dru ypadru rathadru . vvacanam vidhsyate . iha api tarhi vibh prprnoti . brhmartham katriyrtham iti . evam tarhi cryapravrtti jpayati prakrtivikrtyo ya samsa tatra tadarthasya uttarapadasya arthaabda dea bhavati anyatra nitya iti yat ayam
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (19 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

balihitagrahaam karoti . evam tarhi udakrtha vvadha . sthnivadbhvt udabhva prpnoti . tasmt na evam akyam . na cet evam arthena nityasamsa vaktavya sarvaligat ca . na ea doa . idam tvat ayam praavya . atha iha brhmaebhya iti k e caturth . tdarthye iti ha . yadi tdarthye caturth arthaabdasya prayogea na bhavitavyam uktrthnm aprayoga iti . samsa api tarhi na prpnoti . vacant samsa bhaviyati . yat api ucyate sarvaligat ca vaktavy iti . na vaktavy . ligam aiyam lokrayatvt ligasya . (P_2,1.37) KA_I,390.21-24 Ro_II,604 atyalpam idam ucyate bhayena iti . bhayabhtabhtibhbhi iti vaktavyam . vrkt bhayam vrkabhayam vrkt bhta vrkabhta vrkt bhti vrkabhti vrkt bh vrkabh iti . apara ha : bhayanirgatajugupsubhi iti vaktavyam : vrkabhayam grmanirgata adharmajugupsu iti . (P_2,1.40) KA_I,390.26-391.2 Ro_II,604 audibhi iti vaktavyam . iha api yath syt . akadhrta strdhrta akakitava strkitava iti . tat tarhi vaktavyam . na vaktavyam . bahuvacananirdet audibhi iti vijsyate . (P_2,1.42) KA_I,391.4-7 Ro_II,605 dhvkea iti arthagrahaam . dhvkea iti arthagrahaam kartavyam . iha api yath syt . trthakka iti . kepe iti ucyate . ka iha kepa nma . yath trthe kk na ciram sthtra bhavanti evam ya gurukulni gatv na ciram tihati sa ucyate trthakka iti . (P_2,1.43) KA_I,391.9-13 Ro_II,605 krtyai niyoge yadgrahaam . krtyai niyoge iti vaktavyam . iha api yath syt . prvegeyam sma prta adhyeya anuvka iti . tat tarhi vaktavyam . na vaktavyam . re iti eva siddham . iha yat yasya niyogata kryam ram tasya tat bhavati . tata re iti eva siddham . yagrahaam ca kartavyam . iha m bht . prvhe dtavy bhik iti . (P_2,1.47) KA_I,391.15-20 Ro_II,605 kim udharaam . avataptenakulasthitam te etat . kepe iti ucyate . ka iha kepa nma . yath avatapte nakul na ciram sthtra bhavanti evam kryi rabhya ya na ciram tihati sa ucyate avataptenakulasthitam te etat iti . kepe saptamyantam ktntena saha samasyate iti ucyate . tatra sagatikena sanakulena ca samsa na prpnoti . kepe gatikrakaprve uktam . kim uktam . krdgrahae gatikrakaprvasya api iti . (P_2,1.48) KA_I,392.2-3 Ro_II,606 kimartha cakra . evakrrtha . ptresamitdaya eva . kva m bht . paramam ptresamit iti . (P_2,1.49) KA_I,392.5-14 Ro_II,606-607 iha kasmt avyaybhva na bhavati . ek nad ekanad . nadbhi sakhy iti prpnoti . iha ka cit samsa prvapadrthapradhna , ka cit uttarapadrthapradhna , ka cit anyapadrthapradhna , ka cit ubhayapadrthapradhna . prvapadrthapradhna avyaybhva , uttarapadrthapradhna tatpurua , anyapadrthapradhna bahuvrhi , ubhayapadrthapradhna dvandva. na ca atra prvapadrthaprdhnyam gamyate . athav
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (20 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

avyaybhva kriyatm bahuvrhi iti . bahuvrhi bhaviyati vipratiedhena . bhavet ekasajdhikre siddham parakryatve tu na sidhyati . rambhasmarthyt ca avyaybhva prpnoti parakryatvt ca bahuvrhi . parakryatve ca na doa . nadbhi sakhyy samhre avyaybhva vaktavya . sa ca avayam vaktavya . sarvam ekanadtare . (P_2,1.51.1) KA_I,393.2-19 Ro_II,607-609 samhra iti ka ayam abda . samprvt harate sarmasdhane gha . samhriyate samhra iti . yadi karmasdhana paca kumrya samahrt pacakumri daakumri gostriyo upasarjanasya iti hrasvatvam na prpnoti dvigu ekavacanam iti etat ca vaktavyam . evam tarhi bhvasdhana bhaviyati . samharaam samhra . atha bhvasdhane sati kim abhidhyate . yat tat auttardharyam . ka puna gavm samhra . yat tat arjanam krayaam bhiaam aparaharaam v . yadi evam vikipteu pleu gou carantu na sidhyati . evam tarhi samabhykaraam samhra . evam api pacagrm aagar tripur iti na sidhyati . kim kraam . sam ekatvavc bhimukhye vartate harati dentaraprpae . na avayam harati dentaraprpae eva vartate . kim tarhi . sdrye api vartate . tat yath mtu anuharati pitu anuharati . atha v pacagrm aagar tripur iti na eva idam iyati eva avatihate . avayam asau tata kim cit kkati kriym v guam v . yat kkata tat ekam sa ca samhra . ayam tarhi bhvasdhane sati doa . pacapl nyatm iti bhvnayane codite dravynayanam na prpoti . na ea doa . iha tvat ayam praavya . atha iha gau anubandhya aja agnomya iti katham krtau coditym dravye rambhalambhanaprokaaviasanni kriyante . asambhavt . krtau rambhadnm sambhava na asti iti krtv krtisahacarite dravye rambhadni kriyante . idam api evajtyakam eva . asambhavt bhvnayanasya dravynayanam bhaviyati . atha v avyatirekt dravykrtyo . (P_2,1.51.2) KA_I,393.20-394.24 Ro_II,609-612 kim puna dvigusaj pratyayottarapadayo bhavati . evam bhavitum arhati . dvigusaj pratyayottarapadayo cet itaretarrayatvt aprasiddhi . dvigusaj pratyayottarapadayo cet itaretarrayatvt aprasiddhi . k etaretarrayat . dvigunimitte pratyayottarapade pratyayottarapadanimitt ca dvigusaj . tat etat itaretarrayam . itaretarrayi ca na prakalpante . evam tarhi arthe it vakymi . arthe cet taddhitnutpatti bahuvrhivat . arthe cet taddhitotpatti na prpnoti . pcanpiti , dvimtura , traimtura . kim kraam . dvigun uktatvt bahuvrhivat . tat yath citragu iti bahuvrhioktatvt matvarthasya matvarthya na bhavati . evam tarhi samsataddhitavidhau iti vakymi . samsataddhitavidhau iti cet anyatra samsasajbhva . samsataddhitavidhau iti cet anyatra samsasaj na prpnoti . kva anyatra . svare . pacratni , daratni . igante dvigau iti ea svara na prpnoti . siddham tu pratyayottarapadayo ca iti vacant . siddham etat . katham . pratyayottarapadayo ca iti vacant . pratyayottarapadayo dvigusaj bhavati iti vaktavyam . nanu ca uktam dvigusaj pratyayottarapadayo cet itaretarrayatvt aprasiddhi iti . na ea doa . itaretarrayamtram etat coditam sarvi ca itaretarrayi ekatvena parihrtni siddham tu nityaabdatvt iti . na idam tulyam anyai itaretarrayai . na hi saj nity . evam tarhi bhvin saj vijsyate . tat yath : ka cit kam cit tantuvyam ha : asya strasya akam
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (21 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

vaya iti . sa payati . yadi aka na vtavya atha vtavya na aka . aka vtavya ca iti vipratiiddham . bhvin khalu asya saj abhipret . sa manye vtavya yasmin ute aka iti etat bhavati iti . evam iha api tasmin dvigu bhavati yasya abhinirvrttasya pratyaya uttarapadam iti ca ete saje bhaviyata . atha v puna astu arthe iti . nanu ca uktam arthe cet taddhitnutpatti bahuvrhivat iti . na ea doa . na avayam arthaabda abhidheye eva vartate . kim tarhi . sydarthe api vartate . tat yath . drrtham ghamahe . dhanrtham bhikmahe . dr na syu . dhanni na syu iti . evam iha api taddhitrthe dvigu bhavati taddhita syt iti . dvigo v lugvacanam jpakam taddhitotpatte . atha v yat ayam dvigo luk anapatye iti dvigo uttarasya taddhitasya lukam sti tat jpayati crya utpadyate dvigo taddhita iti. (P_2,1.51.3) KA_I,395.1-396.11 Ro_II,612-616 samhrasamhayo aviet samhragrahanarthakyam taddhitrthena krtatvt . samhra samha iti aviitau etau arthau . samhrasamhayo aviet samhragrahaam anarthakam . kim kraam . taddhitrthe krtatvt . taddhitrthe dvigu iti evam atra dvigu bhaviyati . yadi taddhitrthe dvigu iti evam atra dvigu bhavati taddhitotpatti prpnoti . utpadyatm . luk bhaviyati . lukkrtni prpnuvanti . kni . pacapl daapl . aparimabistcitakambalebhya na taddhitaluki iti pratiedha prpnoti . pacagavam daagavam . go ataddhitaluki it ac na prapnoti . na ea doa . avieea dvigo p bhavati iti uktv samhre iti vakymi . tat niyamrtham bhaviyati . samhre eva na anyatra iti . go akra dvigo samhre . avieea go ac bhavati iti uktv dvigo samhre iti vakymi . tat niyamrtham bhaviyati . samhre eva na anyatra iti . abhidhnrtham tu . abhidhnrtham tu samhragrahaam kartavyam . samhrea abhidhnam yath syt taddhitrthena m bht iti . kim ca syt . taddhitotpatti prasajyeta . utpadyatm . luk bhaviyati . lukkrtni prpnuvanti . sarvi parihrtni . na sarvi parihrtni . pacakumri daakumri . lik taddhitaluki iti pa luk prasajyeta . dvandvatatpuruayo uttarapade nityasamsavacanam . dvandvatatpuruayo uttarapade nityasamsa vaktavya . vgdradapriya chatropnahapriya pacagavapriya daagavapriya . kim prayojanam . samudyavrttau avayavnm m kad cit avrtti bht iti . tat tarhi vaktavyam . na vaktavyam . iha dvau pakau vrttipaka avrttipaka ca . yad vrttipaka tad sarvem eva vrtti . yad tu avrtti tad sarvem avrtti . uttarapadena parimina dvigo samsavacanam . uttarapadena parimina dvigo samsa vaktavya . dvimsajta trimsajta . kim puna kraam na sidhyati . sup sup iti vartate . evam tarhi idam syt : dvau msau dvimsam , dvimsam jtasya iti . na evam akyam . svare hi doa syt . dvimsajta iti prpnoti dvimsajta iti ca iyate . dvyhnajta ca na sidhyati . dvyahajta iti prpnoti na ca evam bhavitavyam . bhavitavyam ca yad samhre dvigu . dvyahnajta tu na sidhyati . kim ucyate parimin iti na puna anyatra api . pacagavapriya daagavapriya . anyatra samudyabahuvrhitvt uttarapadaprasiddhi . anyatra samudyaba huvrhisaj . anyatra samudyabahuvrhitvt uttarapadam prasiddham . uttarapade prasiddhe uttarapade iti dvigu bhaviyati . sarvatra matvarthe pratiedha . sarveu pakeu dvigusajy matvarthe pratiedha vaktavya . kim prayojanam . pacakhav daakhav . dvigo iti kra m bht . pacagu daagu . go ataddhitaluki iti ac m bht iti .

file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (22 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

(P_2,1.52) KA_I,396.13-23 Ro_II,617-618 kim anantare yoge sakhyprva sa dvigusaja hosvit prvamtre . kim ca ata . yadi anantare yoge eka dvigo iti kra na prpnoti . atha prvamtre akabhik atra api prpnoti . astu anantare . kamam eka . krntena samsa bhaviyati . ek eka . iha tarhi ekpp dvigo iti kra na prpnoti . astu tarhi prvamtre. katham ekabhik . bantena samsa bhaviyati . ek bhik ekabhik . iha tarhi saptaraya igante dvigau iti ea svara prpnoti . astu tarhi anantare . katham ekpp . samhre iti eva siddham . ka puna atra samhra . yat taddnam sambhrama v . iha tarhi pacahotra daahotra igante dvigau iti ea svara na prapnoti . astu tarhi prvamtre . katham saptaraya . antodttaprakarae tricakrdnm chandasi iti evam etat siddham . atha v puna astu anantare . katham pacahotra daahotra . dyudttaprakarae divodsdnm chandasi iti eva siddham . (P_2,1.53) KA_I,397.2-3 Ro_II,619 kim udharam . vaiykaraakhasci . kim vykaraam kutsitam hosvit vaiykaraa . vaiykaraa kutsita . tasmin kutsite tatstham api kutsitam bhavati . (P_2,1.55) KA_I,397.5-398.19 Ro_II,619-627 upamnni iti ucyate . kni puna upamnni . kim yat eva upamnam tat eva upameyam hosvit anyat upamnam anyat upameyam . kim ca ata . yadi yat eva upamnam tat eva upameyam ka iha upamrtha gau iva gau iti . atha anyat eva upamnam anyat upameyam ka iha upamrtha gau iva ava iti . evam tarhi yatra kim cit smnyam ka cit viea tatra upamnopameye bhavata . kim vaktavyam etat . na hi . katham anucyamnam gasyate . mnam hi nma anirjtajnrtham updyate anirjtam artham jsymi iti . tat sampe yat na atyantya mimte tat upamnam . gau iva gavaya iti . gau nirjta gavaya anirjta . kmam tarhi anena eva hetun yasya gavaya nirjta syt gau anirjta tena kartavyam syt gavaya iva gau iti. bham kartavyam . kim puna iha udharaam . astrym . kva puna ayam ymabda vartate . atrym iti ha . kena idnm devadatt abhidhyate . samsena. yadi evam astrymo devadatta iti na sidhyati . upasarjanasya iti hrasvatvam bhaviyati . yadi tarhi upasarjanni api evajtyakni bhavanti tittirikalm kumbhakaplalohin anupasarjanalakaa kra na prpnoti . evam tarhi astrym eva astrabda vartate devadattym ymabda . evam api gua anirdia bhavati . bahava astrym gu tk skm prthu iti . anirdiyamnasya api guasya bhavati loke sampratyaya . tat yath candramukh devadatt iti . bahava candre gu y ca asau priyadaranat s gamyate . evam api samndhikaraena iti vartate . vyadhikaraatvt samsa na prpnoti . kim hi vacant na bhavati . yadi api tvat vacant samsa syt iha tu khalu mrg iva capal mrgacapal samndhikaraalakaa puvadbhva na prpnoti . evam tarhi tasym eva ubhayam vartate . etat ca atra yuktam yat tasym eva ubhayam vartate iti . itarath hi bahu apekyam syt . yadi tvat evam vigraha kriyate astr iva ym devadatt iti astrym ym iti etat apekyam . atha api evam vigraha kriyate yath sstrym tadvat iyam devadatt iti evam api devadattym ym iti apekyam syt . evam api gua anirdia bhavati . bahava astrym gu tk skm prthu iti . anirdiyamnasya api guasya bhavati loke sampratyaya . tat yath candramukh devadatt iti . bahava candre gu y ca asau priyadaranat s gamyate . upamnasamse guavacanasya vieabhktvt
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (23 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

smanyavacanprasiddhi . upamnasamse guavacanasya vieabhktvt smanyavacanasya aprasiddhi syt . astrym . ymabda ayam astrabdena abhisambadhyamna vieavacana sampadyate . tatra smnyavacanai iti samsa na prpnoti . na v ymatvasyo uhhayatra bhvt tadvcaktvt ca abdasya smnyavacanaprasiddhi . na v ea doa . kim kraam . ymatvasyo uhhayatra bhvt . ubhayatra eva ymatvam asti astrym devadattym ca . tadvcaktvt ca abdasya . smnyavacanaprasiddhi tadvcaka ca atra ymabda prayujyate . kimvcaka . ubhayavcaka . ymatvasya ubhayatra bhvt tadvcakatvt ca abdasya smnyavacanam prasiddham . smnyavacane prasiddhe smnyavacanai iti samsa bhaviyati . na ca avayam sa eva smnyavacana ya bahnm smnyam ha. dvayo api smnyam ha sa api smnyavacana eva . atha v smnyavacanai iti ucyate . sarva ca abda anyena abdena abhisambadhyamna vieavacana sampadyate . te evam vijsyma prk abhisambandht smnyavacana iti . (P_2,1.56) KA_I,398.21-399.2 Ro_II,627-628 smnyprayoge iti kimartham . iha m bht . purua ayam vyghra iva ra . purua ayam vyghra iva balavn . smnyprayoge iti akyam akartum . kasmt na bhavati purua ayam vyghra iva ra . purua ayam vyghra iva balavn iti . asmarthyt . katham asmarthyam . spekam asamartham bhavati iti . evam tarhi siddhe sati yat smnyprayoge iti pratiedham sti tat jpayati crya bhavati vai pradhnasya spekasya api samsa iti . kim etasya jpane prayojanam . rjapurua abhirpa rjapurua daranya atra vrtti siddh bhavati . (P_2,1.57) KA_I,399.4-26 Ro_II,628-632 vieaavieyayo ubhayavieaatvt ubhayo ca vieyatvt upasarjanprasiddhi . vieaavieyayo ubhayavieaatvt ubhayo ca vieyatvt upasarjansya aprasiddhi . kratil iti kraabda ayam tilaabdena abhisambadhyamna vieaavacana sampadyate . tath tilaabda kraabdena abhisambadhyamna vieaavacana sampadyate . tat ubhayam vieaam bhavati ubhayam ca vieyam . vieaavieyayo ubhayavieaatvt ubhayo ca vieyatvt upasarjansya aprasiddhi . na v anyatarasya pradhnabhvt tadvieakatvt ca aparasya upasarjanaprasiddhi . na v ea doa . kim kraam . anyatarasya pradhnabhvt . anyatarat atra pradhnam . tadvieakatvt ca aparasya . tadvieakam ca aparam . anyatarasya pradhnabhvt tadvieakatvt ca aparasya upasarjanasaj bhaviyati . yad asya til prdhnyena vivakit bhavanti kra vieaatvena tad til pradhnam kra vieaam . kmam tarhi anena eva hetun yasya kr prdhnyena vivakit bhavanti til vieaatvena tena kartavyam tilakr iti . na kartavyam . na hi ayam dvandva til ca kr ca iti . na khalu api ahsamsa tilnm kr iti . kim tarhi . dvau imau pradhnaabdau ekasmin arthe yugapat avarudhyete . na ca dvayo pradhnaabdayo ekasmin arthe yugapat avarudhyamnayo kim cit api prayojanam asti . tatra prayogt etat gantavyam . nnam atra anyatarat pradhnam tadvieakam ca aparam iti . tatra tu etvn sandeha kim pradhnam kim vieaam iti . sa ca api kva sandeha . yatra ubhau guaabdau . tat yath kujakhajaka khajakubjaka iti . yatra hi anyatarat dravyam anyatara gua tatra yat dravyam tat pradhnam . tat yath uklam labheta kram labheta iti na piapim labhya krt bhavati . avayam tadguam dravyam kkati .
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (24 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

katham tarhi imau dvau pradhnaabdau ekasmin arthe yugapat avarudhyete vrka iip iti . na etayo vayaka samvea . na hi avrka iip asti . (P_2,1.58) KA_I,400.2-11 Ro_II,633-634 atha kimartham uttaratra evamdi anukramaam kriyate na vieaam vieyea bahulam iti eva siddham . bahulavacanasya akrtsnatvt uttaratrnukramaasmarthyam . akrtsnam bahulavacanam iti uttaratra anukramaam kriyate . yadi akrtsnam yat anena krtam akrtam tat . evam tarhi na brma akrtsnam iti . krtsnam ca krakam ca sdhakam ca nirvartakam ca . yat ca anena krtam suktrtam tat . kimartham tarhi evamdi anukramaam kriyate . udharaabhyastvt . te khalu api vidhaya suparigrht bhavanti yeu lakaam prapaca ca . kevalam lakaam kevala prapaca v na tath krakam bhavati . avayam khalu asmbhi idam vaktavyam bahulam anyatarasym ubhayath v ekem iti . sarvavedapriadam hi idam stram . tatra na eka panth akya sthtum . (P_2,1.59) KA_I,400.13-18 Ro_II,635 reydaya pahyante . krtdi krtigaa . reydiu cvyarthavacanam . reydiu cvyarthagrahaam kartavyam . areaya reaya krt reikrt . yad hi reaya eva kim cit kriyante tad m bht . anyatra ayam cvyarthagrahaeu cvyantasya pratiedham sti . tat iha na tath . kim kraam . anyatra prvam cvyantakryam param cvyarthakryam . iha puna prvam cyvarthakryam param cvyantakryam iti . (P_2,1.60) KA_I,400.20-401.27 Ro_II,635-638 naviie samnaprakrtivacanam . naviie samnaprakrtigrahaam kartavyam . iha m bt . siddham ca abhuktam ca iti . ana iti ca pratiedha kartavya . iha m bht . kartavyam akrtam iti . nuiadhikena ca . nuiadhikena ca samsa vaktavya . iha api yath syt . aitnaitena jvati . klikliitena jvati . kim ucyate samnaprakrtigrahaam kartavyam iti yad naviiena iti ucyate . na ca atra nakrta eva viea . kim tarhi . prakrtikrta api . ayam viiaabda asti eva avadhrae vartate . tat yath . devadattayajadattau hyau abhirpau daranyau pakavantau devadatta tu yajadattt svdhyyena viia . svdhyyena eva iti gamyate . anye gu sam bhavanti . asti dhikye vartate . tat yath . devadattayajadattau hyau abhirpau daranyau pakavantau devadatta tu yajadattt svdhyyena viia . svdhyyena adhika anye gu avivakit bhavanti . tat yad tvat avadhrae viiaabda tad na eva artha samnaprakrtigrahaena . na iha bhaviyati . siddham ca abhuktam ca iti . na api ana iti pratiedhena . na iha bhaviyati kartavyam akrtam iti . nuiadhikena api tu tad samsa na prpnoti . yad dhikye viiaabda tad samnaprakrtigrahaam kartavyam . iha m bht iddham ca abhuktam ca iti . ana iti ca pratiedha kartavya . iha m bht . kartavyam akrtam iti . nuiadhikena api tu samsad siddha bhavati . tatra dhikye viiagrahaam matv samnaprakrtigrahaam codyate . avadhraam na cet nuiviiena na prakalpeta . atha cet adhikavivak kryam tulyaprakrtikena iti . krtpakrtdnm ca upasakhynam . krtpakrtdnm ca upasakhynam . krtpakrtam bhuktavibhuktam ptaviptam . siddham tu ktena visamptau ana . siddham etat . katham. ktntena kriyvisamptau ana ktntam samasyate iti vaktavyam . gatapratygatdnm ca upasakhynam . gatapratygatdnm ca upasakhynam kartavyam . gatapratygatam ytnuytam pupuik kraykrayik
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (25 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

phalphalik mnonmnik . (P_2,1.67) KA_I,402.2-5 Ro_II,639 ayukta ayam nirdea . samndhikaraena iti vartate . ka prasaga yad vyadhikaranm samsa syt . evam tarhi jpayati crya yathjtyakam uktam uttarapadam tathjtyakena prvapadena samasyate iti . kim etasya jpane prayojanam . prtipadikagrahae ligaviiasya api grahaam bhavati iti e paribh na kartavy bhavati . (P_2,1.69.1) KA_I,402.7-403.6 Ro_II,639-641 idam vicryate : varena trtysamsa v syt : krena sraga krasraga samndhikaraena v : kra sraga krasraga iti . ka ca atra viea . varena trtysamsa etapratiedhe varagrahaam . varena trtysamsa etapratiedhe varagrahaam kartavyam . trty prvapadam prakrtisvaram bhavati . anete vara iti vaktavyam . atha dvityena varagrahaena etavieaena artha . bham artha yadi avara etaabda asti . nanu ca ayam asti : * ita eta , kreta , lohiteta iti . na artha evamarthena varagrahaena . yadi tvat ayam kartari kta trty karmai iti anena svarea bhavitavyam . atha api kartari paratvt krtsvarea bhavitavyam . atha samndhikaraa . samndhikarae dvi varagrahaam . samndhikarae dvi varagrahaam kartavyam . vara vareu anete iti vaktavyam . ekam varagrahaam kartavyam iha m bht . paramaukla paramakra iti . dvityam varagrahaam kartavyam iha m bht . kratil iti . ekam varagrahaam anakrthakam . anyataratra kasmt na bhavati . lakaapratipadikoktayo pratipadoktasya eva iti . evam sati . tni etni tri varagrahani bhavanti samsavidhau dve svaravidhau ca ekam . yasya api trtysamsa tasya api tni eva tri varagrahani bhavanti samsavidhau dve svaravidhau ca ekam . smnyena mama trtysamsa bhaviyati trty tatkrtrthena guavacanena iti . avayam varena pratipadam samsa vaktavya yatra tena na sidhyati tadartham . kva ca tena na sidhyati . ukababhru haritababhru iti . tath ca sati tni eva tri varagrahani bhavanti samsavidhau dve svaravidhau ca ekam . atha samndhikaraa smnyena siddha syt . bham siddha . katham . vieaam vieyea bahulam iti . evam api dve varagrahae kartavye svaravidhau eva pratipadoktasya abhvt . tasmt samndhikaraa iti ea paka jyyn . (P_2,1.69.2) KA_I,403.7-406.8 Ro_II,641-653 samndhikaradhikre pradhnopasarjannm param param vipratiedhena . samndhikaradhikre pradhnopasarjannm param param bhavati vipratiedhena . pradhnnm pradhnam upasarjannm upasarjanam . pradhnnm tvat pradhnam . vrdrakangakujarai pjyamnam iti asya avaka govrndraka avavrndraka . poyuvatnm avaka ibhyayuvati hyayuvati . iha ubhayam prpnoti . ngayuvati vrndrakayuvati . pradhnnm param bhavati vipratiedhena . upasarjannm param upasarjanam . sanmahatparamotkr iti asya avaka sadgava sadava . krtyatulykhy ajty iti asya avaka tulyaveta tulyakra . iha ubhayam prpnoti : tulyasat tulyamahn . upasarjannm param upasarjanam bhavati vipratiedhena . samndhikaraasamst bahuvrhi . samndhikaraasamst bahuvrhi bhavati vipratiedhena . samndhikaraasamsasya avaka vra purua vrapurua . bahuvrhe avaka kahekla . iha ubhayam prpnoti : vrapuruaka grma . bahuvrhi bhavati
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (26 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

vipratiedhena . kad cit karmadhraya sarvadhandyartha . kad cit karmadhraya bhavati bahuvrhe . kim prayojanam . sarvadhandyartha . sarvadhan sarvabj sarvake naa gaurakharavat vanam gauramrgavat vanam krasarpavn valmka lohitalimn grma . kim prayojanam . karmadhrayaprakrtibhi matvarthyai abhidhnam yath syt . kim ca kraam na syt . bahuvrhi uktatvt matvarthasya . yadi uktatvam hetu karmadhrayea api uktatvt na prpnoti . na khalu api sajraya matvarthya . kim tarhi . arthraya . sa yath eva bahuvrhi uktatvt na bhavati evam karmadhrayea api uktatvt na bhaviyati . evam tarhi idam syt : sarvi dhanni sarvadhanni sarvadhanni asya saniti sarvadhan . na evam akyam . nityam evam sati karmadhraya syt . tatra yat uktam kad cit karmadhraya iti etat ayuktam . evam tarhi bhavati vai kim cit cry kryavat buddhim krtv pahanti kry abd iti . tadvat idam pahitam samndhikaraasamdt bahuvrhi kartavya kad cit karmadhraya sarvadhandyartha iti . yad ucyate samndhikaraasamst bahuvrhi bhavati vipratiedhena iti na ea yukta vipratiedha . antaraga karmadhraya . k antaragat . svapadrthe karmadhraya anyapadrthe bahuvrhi . astu . vibh karmadhraya . yad na karmadhraya tad bahuvrhi bhaviyati . evam api yadi atra kad cit karmadhraya bhavati karmadhrayaprakrtibhi matvarthyai abhidhnam prpnoti . sarva ca ayam evamartha yatna karmadhrayaprakrtibhi matvarthyai abhidhnam m bht iti . evam tarhi na idam tasya yogasya udharaam vipratiedhe param iti . kim tarhi . ii iyam pahit . samndhikaraasamst bahuvrhi ia kad cit karmadhraya sarvadhandyartha iti . yadi ii pahit na artha anena . iha hi sarve manuy alpena yatnena mahata arthn kkanti . ekena mea atasahasram . ekena kuddlakena khrsahasram . tatra karmadhrayaprakrtibhi matvarthyai abhidhnam astu bahuvrhi iti bahuvrhi bhaviyati laghutvt . katham sarvadhan sarvabj sarvake naa iti . iniprakarae sarvde inim vakymi . tat ca avayam vaktavyam hana bdhanrtham . katham gaurakharavat vanam gauramrgavat vanam krasarpavn valmka lohitalimn grma . asti atra viea . jty atra abhisambandha kriyate . krasarpa nma sarpajti s asmin valmke asti . yad hi antarea jtim tadvatm abhisambandha kriyate krasarpa valmka iti evam tad bhaviyati . prvapadtiaye tiyikt bahuvrhi skmavastratardyartha . prvapadtiaye tiyikt bahuvrhi bhavati vipratiedhena . kim prayojanam . skmavastratardyartha . tiyikasya avaka pautara pautama . bahuvrhe avaka citragu abalagu . iha ubhayam prpnoti skmavastratara tkrgatara . bahuvrhi bhavati vipratiedhena . na ea yukta vipratiedha . virpatiedhe param iti ucyate . prva ca bahuvrhi para tiyika . iavc paraabda . vipratiedhe param yat iam tat bhavati . evam api ayukta . antaraga tiiyika . k antaragat . ypprtipadikt tiyika subantnm bahuvrhi . tiyika api na antaraga . katham . samartht taddhita utpadyate smarthyam ca subantenta . evam api antaraga . katham . svapadrthe tiyika anyapadrthe bahuvrhi . evam api na antaraga . katham . spardhym tiyika bhavati . na ca antarea pratiyoginam spardh bhavati . na eva v atra tiyika prpnoti . kim kraam . asmarthyt . katham asmarthyam. spekam asamartham bhavati iti . yvat vastri tadvantam apekante tadvantam ca apekya vastrm vastrai yugapat spardh bhavati . nanu ca ayam tiyika evamtmaka satym vyapekym vidhyate . satyam evamtmaka ym ca na anatarea vyapekm pravrtti
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (27 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

tasyam satym bhavitavyam . km ca na antarea vyapekm tiyikasya pravrtti . y hi pratiyoginam prati vyapek . y hi tadvantam prati na tasym bhavitavyam . bahuvrhi api tarhi na prpnoti . kim kraam . asmarthyt eva . katham asmarthyam . spekam asamartham bhavati iti . yvat vastri vastrntari apekante tadvat ca abhisambandha . evam tarhi na idam tasya yogasya udharaam vipratiedhe param iti . kim tarhi . ii iyam pahit . prvapadtiaye tiyikt bahuvrhi ia : skmavastratardyartha iti . yadi ii iyam pahit na artha anena . katham y e yukti ukt : yvat vastri vastrntari apekante tadvat ca abhisambandha iti . yad hi antarea vastrm vastrai yugapat spardhm tadvat ca abhisambandha kriyate nipratidvandva tad bahuvrhi . bahuvrhe tiyika . na tarhi idnm idam bhavati : skmataravastra iti . bhavati . yad antarea tadvantam vastrm vastrai yugapat spardh nipratidvandva tad tiyika . katham puna anyasya prakarea anyasya prakara syt . na eva anyasya prakarea anyasya prakarea bhavitavyam . yath eva ayam dravyeu yatate vastri me syu iti evam gueu api yatate skmatari me syu iti . na atra tiyika prpnoti . kim kraam . guavacant iti ucyate . na ca samsa guavacana . samsa api guavacana . katham . ajahatsvrth vrtti . atha jahatsvrthym tu doa eva . jahatsvrthym api na doa . bhavati bahuvrhau tadguasavijnam api . tat yath . uklavsasam naya . lohito rtvija pracaranti iti . tatgua nyate tadgu ca pracaranti . uttarapadrthtiaye tiyika bahuvrhe bahvhyatardyartha . uttarapadrthtiaye tiyika bahuvrhe bhavati vipratiedhena . kim prayojanam . bahvhyatardyartha . bahvhyatara bahusukumratara . ka puna atra viea bahuvrhe v tiyika syt tiyikntena v bahuvrhi . svarakapo viea . yadi atra tiyikt bahuvrhi syt bahvyatara evam svara prasajyeta bahvhyatara iti ca iyate . bahvhyakatara iti ca prpnoti bahvhyataraka iti ca iyate . samndhikaradhikre kaprthivdnm upasakhynam uttarapadalopa ca . samndhikaradhikre kaprthivdnm upasakhynam kartavyam uttarapadalopa ca vaktavya . kabhoj prthiva kaprthiva . kutapavsa sauruta kutapasaurutra . ajpaya taulvali ajtaulvali . yaipradhna maudgalya yaimaudgalya . (P_2,1.71) KA_I,406.10-11 Ro_II,653 klkgarbhi svastimat garbhi . catupt jti iti vaktavyam . iha m bht .

(P_2,1.72) KA_I,406.13-14 Ro_II,654 kimartha cakra . evakrrtha . mayravyasakdaya eva . kva m bht . parama mayravyasaka iti . (P_2,2.2) KA_I,407.2-9 Ro_II,655-656 iha kasmt na bhavati : grmrdha , nagarrdha iti . ardhaabdasya napusakaligasya idam grahaam puliga ca ayam ardhaabda . kva puna ayam napusakaliga kva puliga . samapravibhge napusakaliga , avayavavc puliga . iha kasmt na bhavati : ardham pippalnm iti . na v bhavati ardhapippalya iti . bhavati yad khaasamuccaya : ardhapippal ca ardhapippal ca ardhapippal ca ardhapippalya iti . yada tu etat vkyam bhavati ardham pippalnm iti tad na bhavitavyam . tad kasmt na bhavati . ekdkhikarae iti vartate . na tarhi idnm idam bhavati : ardhari iti . bhavati . ekam etat adhikaraam ya asau ri nma .

file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (28 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

(P_2,2.3) KA_I,407.11-408.20 Ro_II,657-660 anyatarasygrahaam kimartham . anyatarasym samsa yath syt . samsena mukte vkyam api yath syt . dvityam bhiky iti . na etat asti prayojanam . prakrt mahvibh . tay vkyam api bhaviyati . idam tarhi prayojanam . ekadeisamsena mukte ahsamsa api yath syt . bhikdvityam iti . etat api na asti prayojanam . ayam api vibh ahsamsa api . tau ubhau vacant bhaviyata . ata uttaram pahati . dvitydnm vibhprakarae vibhvacanam jpakam avayavavidhne smnyavidhnbhvasya . dvitydnm vibhprakarae vibhvacanam kriyate jprtham . kim jpyate . etat jpayati crya . avayavavidhau smnyavidhi na bhavati iti . kim etasya jpane prayojanam . bhinatti chinatti . nami krte ap na bhavati . na etat asti prayojanam . abde yandaya kariyante . tat tarhi apa grahaam kartavyam . na kartavyam .prakrtam anuvartate . kva prakrtam . kartari ap iti . tat vai prathamnirdiam ahnirdiena ca iha artha . rudhdibhya iti e pacam ap iti prathamy athm prakalpayiyati tasmt iti uttarasya iti . pratyayavidhi ayam na ca pratyayavidhau pacamya prakalpik bhavanti . na ayam pratyayavidhi . vihita pratyaya prakrta ca anuvartate . evam tarhi jpayati crya yatra utsargpavdam vibh tatra apavdena mukte utsarga na bhavati iti . kim etasya jpane prayojanam . dikprvapadt p . prmukh prmukh pratyamukh pratyamukh . pa mukte na bhavati . na etat asti prayojanam . vakyati etat . dikprvapadt a anudttatvam bvidhne hi anyatra api viayt pprasaga iti . idam tarhi prayojanam . ardhapippal ardhakotak . ekadeisamsena mukte ahsamsa na bhavati . unmattagagam lohitagagam . avyaybhvena mukte bahuvrhi na bhavati . dki plki . i mukte a na bhavati . yadi etat jpyate upago apatyam aupagava . taddhitena mukte upagvapatyam iti na sidhyati . asti atra viea . dve hi atra vibh . daivayajiaucivrkistyamugrikheviddhibhya anyatarasym iti samarthnm prathamt v iti ca . tatra ekaya vrtti bhaviyati aparaya vrttiviaye vibhapavda . kriyame api vai anyatarasygrahae ahsamsa na prpnoti . kim kraam . praena iti pratiedht . na etat prantam . an etat paryavapannam . etat api prantam eva . katha. praam nma artha tam ha tyaabda . ata praam . ya asau prantt svrthe bhge an sa api praam eva . evam tarhi anyatarasygrahaasmarthyt ahsamsa api bhaviyati . (P_2,2.4) KA_I,408.22-409.4 Ro_II,660 kimartha cakra . anukaraartha . anyatarasym iti etat anukryate . kim prayojanam . anyatarasym samsa yath syt . samsena mukte vkyam api yatha syt . jvikm prpta iti . na etat asti prayojanam . prakrt mahvibh . tay vkyam bhaviyati . idam tarhi prayojanam . dvitysamsa api yatha syt . jvikprpta iti . etat api na asti prayojanam. ayam api ucyate dvitysamsa api . tat ubhayam vacant bhaviyati . evam tarhi na ayam anukarartha cakra . kim tarhi . atvam anena vidhyate . prptpanne dvityntena saha samasyete atvam ca bhavati prptapannayo iti . prpt jvikm prptajvik pann jvikm pannajivik . (P_2,2.5.1) KA_I,409.6-12 Ro_II,661-662 kimpradhna ayam samsa . uttarapadrthapradhna . yadi uttarapadrthapradhna sadharma anena anyai uttarapadrthapradhnai bhavitavyam . anyeu ca uttarapadrthapradhneu y eva asau antarvartin vibhakti tasy samse api ravaam bhavati : rja purua rjapurua iti .
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (29 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

iha puna vkye ah samse pratham . kena etat evam bhavati . ya asau msajtayo abhisambandha sa samse nivartate . abhihita sa artha antarbhta prtipadikrtha sampanna . tatra prtipadikrthe pratham iti pratham bhavati . na tarhi idnm idam bhavati : msajtasya iti . bhavati . bhyam artham apekya ah . (P_2,2.5.2) KA_I,409.13-410.6 Ro_II,662-666 klasya yena samsa tasya aparimitvt anirdea . klasya yena samsa sa aparim . tasya aparimitvt anirdea . agamaka nirdea anirdea . na hi jtasya msa parimam . kasya tarhi . triadrtrasya . tat yath . droa badarm devadattasya iti . na devadattasya droa parimam . kasya tarhi . badarm . siddham tu klaparimam yasya sa kla tena . siddham etat . katham . klaparimam yasya sa kla tena samasyate iti vaktavyam . sidhyati . stram tarhi bhidyate . yathnysam eva astu . nanu ca uktam klasya yena samsa tasya aparimitvt anirdea iti . kam puna klam matv bhavn ha klasya yena samsa tasya aparimitvt anirdea iti . yena mrtnm upacay ca apacay ca lakyante tam klam hu . tasya eva kay cit kriyay yuktasya aha iti ca bhavati rtri iti ca . kay kriyay . dityagaty . tay eva asakrt vrttay msa iti bhavati savatsara iti ca . yadi evam jtasya msa parimam . ekavacanadvigo ca upasakhynam . ekavacanntnm iti vaktavyam . iha m bht . msau jtasya ms jtasya iti . dvigo ca iti vaktavyam iha api yath syt : dvimsajta , trimsajta . uktam v . kim uktam . ekavacane tvat uktam anabhidhnt iti . dvigo kim uktam . uttarapadena parimina dvigo samsavacanam iti . (P_2,2.6) KA_I,410.8-412.12 Ro_II,666-677 kimpradhna ayam samsa . uttarapadrthapradhna . yadi uttarapadrthapradhna abrhmaam naya iti ukte brhmaamtrasya nayanam prpnoti . anyapadrthapradhna tarhi bhaviyati . yadi anyapadrthapradhna , avar hemanta iti hemantasya yat ligam vacanam ca tat samsasya api prpnoti . prvapadrthapradhna tarhi bhaviyati . yadi prvapadrthapradhna avyayasaj prpnoti : avyayam hi asya prvapadam iti . na ea doa . phena avyayasaj kriyate . na ca nasamsa tatra pahyate . yadi api nasamsa na pahyate na tu pahyate . phena api avyayasajym satym abhideheyavat ligavacanni bhavanti . ya ca iha artha abhidhyate na tasya ligasakhybhym yoga asti . na idam vcanikam aligat asakhyat va . kim tarhi . svbhvikam etat . tat yath: samnam hamnnm adhynnm ca ke cit arthai yujyante apare na . na ca idnm ka cit arthavn iti krtv sarvai arthavadbhi akyam bhavitum ka cit anarthaka iti krtv sarvai anarthakai . tatra kim asmbhi akyam kartum . yat naa prk samst ligasakhybhym yoga na asti samse ca bhavati svbhvikam etat . atha v rayata ligavacanni bhaviyanti . guavacannm hi abdnm rayata ligavacanni bhavanti . tat yath : uklam vastram , ukl ukla kambala , uklau kambalau ukl kambal iti . yat asau dravyam rita bhavati gua tasya yat ligam vacanam ca tat guasya api bhavati . evam iha api yat asau dravyam rita bhavati samsa tasya yat ligam vacanam ca tat samsasya api bhaviyati . atha v puna astu uttarapadrthapradhna . nanu ca uktam abrhmaam naya iti ukte brhmaamtrasya nayanam prpnoti iti . na ea doa . idam tvat ayam praavya : atha iha rjapuruam naya iti ukte puruamtrasya nayanam kasmt na bhavati . asti atra viea . rj vieaka
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (30 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

prayujyate . tena viiasya nayanam bhavati . iha api tarhi na vieaka prayujyate . tena naviiasya nayanam bhaviyati . ka puna asau . nivrttapadrthaka . yad puna asya padrtha nivartate kim svbhvik nivrtti hosvit vcanik . kim ca ata . yadi svbhvik kim na prayujyamna karoti . atha vcanik tat vaktavyam : na prayujyamna padrtham nivartayati iti . evam tarhi svbhvik nivrtti . nanu ca uktam kim na prayujyamna karoti iti . na prayujyamna padrtham nivartayati katham . klapratiklavat . tat yath kla hanyamna pratiklam nirhanti . yadi etat naa mhtmyam syt na jtu cit rjna hastyavam bibhryu . na iti eva rjna bryu . evam tarhi svbhvik nivrtti . nanu ca uktam kim na prayujyamna karoti iti . nanimitt tu upalabdhi . tat yath samandhakre dravym samavasthitnm pradpnimittam daranam na ca tem pradpa nirvartaka bhavati . yadi puna ayam nivrttapadrthaka kimartham brhmaaabda prayujyate . evam yath vijayeta asya padrtha nivartate iti . na iti hi ukte sandeha syt kasya padrtha nivartate iti . tatra asandehrtham brhmaaabda prayujyate . evam v etat . atha v sarve ete abd guasamudyeu vartante brhmaa katriya vaiya dra iti . tapa rutam ca yoni ca iti etad brhmaakrakam . tapatrutbhym ya hna jtibrhmaa eva sa . tath gaura ucycra pigala kapilakea iti etn api abhyantarn brhmaye gun kurvanti . samudyeu ca vrtt abd avayaveu api vartante. tad yath . prve pacl uttare pacl tailam bhuktam ghrta bhuktam ukla nla kapila kra iti . evam ayam samudye brhmaaabda pravrtta avayaveu api vartate jtihne guahne ca . guahne tvat. abrhmaa ayam ya tihan mtrayati . abrhmaa aya ya gacchan bhakayati . jtihne sandeht durupadet ca brhmaaabda vartate . sandeht tvat : gauram ucycra pigalam kapilakeam drv adhyavasyati brhmaa ayam iti . tata pact upalabhate na aya brhmaa abrhmaa ayam iti . tatra sandeht ca brhmaaabda vartate jtikrt ca arthasya nivrtti . durupadet : durupadiam asya bhavati amumin avake brhmaa tam naya iti . sa tatra gatv yam payati tam adhyavasyati brhmaa ayam iti . tata pact upalabhate na aya brhmaa abrhmaa ayam iti . tatra durupadet ca brhmaaabda vartate jtikrt ca arthasya nivrtti . ta ca sandeht durupadet v . na hi ayam klam marivaram pae snam drv adhyavasyati brhmaa ayam iti . nirjtam tasya bhavati . idam khalu api bhya uttarapadrthaprdhnye sati sagrhtam bhavati . kim . anekam iti . kim atra sagrhtam . ekavacanam . katham puna ekasya pratiedhena anekasya sampratyaya syt . prasajya ayam kriyguau tata pact nivrttim karoti . tat yath : saya yaya bhojaya anekam iti . yadi api tvat atra etat akyate vaktum yatra kriyguau prasajyete yatra khalu na prasajyete tatra katham : aneka tihati iti . bhavati ca evajtyaknm api ekasya pratiedhena bahnm sampratyaya . tat yath na na ekam priyam na na ekam sukham iti . iha abrhmaatvam abrhmaat paratvt tvatalau prpnuta . tatra ka doa . svare hi doa syt . abrhmaatvam iti evam svara prasajyeta . abrhmaatvam iti ca iyate . nasamse bhvavacane uktam . kim uktam . tvatalbhym nasamsa prvapratiiddham svarsiddhyartham iti . (P_2,2.7) KA_I,412.14-16 Ro_II,677 at guavacanena .at guavacanena iti vaktavyam . akrt iti ucyamne iha ca prasajyeta . at grgya iti . iha ca na syt . atkara .

file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (31 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

(P_2,2.8) KA_I,412.18-413.13 Ro_II,678-680 krdyog ca . krdyog ca ah samasyate iti vaktavyam . idhmapravracana palatana . kimartham idam ucyate . pratipadavidhn ca ah na samasyate iti vakyati . tasya ayam purastt apakara . k puna ahpratipadavidhn k krdyog . sarv ah pratipadavidhn ealakam varjayitv . kartrkarmao krti iti y ah s krdyog . tatsthai ca guai . tatsthai ca guai athguai ah samasyate iti vaktavyam . brhmaavara candanagandha paahaabda nadhghoa . na tu tadvieaai . na tu tadvieaai iti vaktavyam . iha m bht . ghrtasya tvra candanasya mrdu iti . kimartham idam ucyate . guena iti pratiedham vakyati . tasya ayam purastt apakara . kim kraam guena na iti ucyate na puna guavacanena iti ucyate . na evam akyam . iha hi na syt . kkasya kryam kaakasya taikyam balky auklyam iti . etat eva tasmin yoge udharaam . yat vai brhmaasya ukl vralasya kr iti asmarthyt atra na bhaviyati . katham asmarthyam . spekam asamartham bhavati iti . dravyam atra apekyate dant . tasmt guena na iti vaktavyam . guena na iti ucyamne tatsthai ca guai iti vaktavyam . tatsthai ca guai iti ucyamne na tu tadvieaai iti vaktavyam . (P_2,2.10) KA_I,413.15-17 Ro_II,681 pratipadavidhn ca . pratipadavidhn ca ah na samasyate iti vaktavyam . iha m bht . sarpia jnam madhuna jnam iti . (P_2,2.11) KA_I,413.19-414.21 Ro_II,681-684 gue kim udharaam . brhmaasya ukl vralasya kr iti . na etat asti prayojanam . asmarthyt atra na bhaviyati . katham asmarthyam . spekam asamartham bhavati iti . dravyam atra apekyate dant . idam tarhi kkasya kryam kaakasya taikyam balky auklyam iti . idam api udharaam brhmaasya ukl vralasya kr iti . nanu ca uktam . asmarthyt atra na bhaviyati . katham asmarthyam . spekam asamartham bhavati iti . dravyam atra apekyate dant iti . na ea doa . bhavati vai kasya cit artht prakarat v apekyam nirjtam tad vrtti prpnoti . sati kim udharaam . brahmaasya pakyan brhmaasya pakyama . na etat asti . pratiidhyate atra ah laprayoge na iti . y ca ryate e bhyam artham apekya bhavati . tatra asmrthyt na bhaviyati . katham asmarthyam . spekam asamartham bhavati iti . dravyam atra apekyate odana . idam tarhi caurasya dvian vralasya dvian . nanu ca atra api pratiidhyate . vakyati etat dvia atu vvacanam iti . avyaye kim udharaam . brhmaasya uccai vralasya ncai iti . na etat asti . asmarthyt atra na bhaviyati . katham asmarthyam . spekam asamartham bhavati iti . dravyam atra apekyate sanam . idan tarhi brhmaasya krv vralasya krtv iti . etat api na asti . pratiidhyate tatra ah avyayaprayoge na iti . y ca ryate e bhyam artham apekya bhavati . tatra asmrthyt na bhaviyati . katham asmarthyam . spekam asamartham bhavati iti . dravyam atra apekyate kaa . idam tarhi . pur sryasya udeto dheya . pur vatsnm apkarto . nanu ca atra api pratiidhyate avyayam iti krtv . vakyati etat . avyayapratiedhe tosunkasuno apratiedha iti . samndhikarae kim udharaam . rja paliputrakasya ukasya mrvidasya pine strakrasya . na etat asti . asmarthyt atra na bhaviyati . katham asmarthyam . samndhikaraam asamarthavat bhavati iti . idam tarhi . sarpia pyamna yajua kriyamasya iti . nanu ca atra api asmarthyt eva na bhaviyati . katham asmarthyam . samndhikaraam asamarthavat bhavati iti .
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (32 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

adhtvabhihitam iti evam tat . (P_2,2.14) KA_I,414.23-415.19 Ro_II,684-686 katham idam vijyate karmai y ah s na samasyate iti hosvit karmai ya kta iti . kuta sandeha . ubhayam prakrtam . tatra anyatarat akyam vieayitum . ka ca atra viea . karmai iti ahnirdea cet akartari krt samsavacanam . karmai iti ahnirdea cet akartari krt samsa vaktavya . idhmapravracana palatana . trkakbhyam ca anarthaka pratiedha . trkakbhyam ca anarthaka pratiedha . apm sra . karmai iti eva siddham . astu tarhi karmai ya kta iti . kim udharaam . brhmaasya bhuktam vralasya ptam iti . ktanirdee asamarthatvt apratiedha . ktanirdee asamarthatvt apratiedha . anarthaka pratiedha apratiedha . samsa kasmt na bhavati . asmarthyt . katham asmarthyam . spekam asamartham bhavati iti . dravyam atra apekyate odana . pratiedhyam iti cet kartari api pratiedha .atha evam sati pratiedha kartavya iti dryate kartari api pratiedha vaktavya syt . brhmaasya gata brhmaasya yta iti . pjym ca pratiedhnarthakyam . pjym ca pratiedha anartha . rjm pjita . karmai iti eva siddham . tasmt ubhayaprptau karmai ahy pratiedha . tasmt ubhayaprptau karmai iti evam y ah tasy pratiedha vaktavya . sa tarhi vaktavya . na vaktavya ityarthe ayam ca pahita . kamai ca . karmai iti evam y ah iti . (P_2,2.17) KA_I,415.21-22 Ro_II,686 kim iha nityagrahaena abhisambadhyate vidhi hosvit pratiedha . vidhi iti ha . kuta etat . vidhi hi vibh nitya pratiedha . (P_2,2.18) KA_I,416.2-417.6 Ro_II,686-690 prdiprasage karmapravacanyapratiedha . prdiprasage karmapravacanynm pratiedha vaktavya . vrkam prati vidyotate vidyut . sdhu devadatta mtaram prati . vyavetapratiedha ca . vyavetnm ca pratiedha vaktavya . a mandrai indra haribhi yahi mayuraromabhi . siddham tu kvsvatidurgativacant . siddham etat . katham . kvsvatidurgataya samasyante iti vaktavyam . ku . kubrhmaa kuvrala . . kara pigala . su . subrhmaa suvrala . at . atibrhmaa ativrala . dur . durbrhmaa . gati . prakraka prayaka prasecaka rkrtya rkrtam . prdaya ktrthe . prdaya ktrthe samasyante iti vaktavyam . pragata crya prcrya prntevs prapitmaha . etat eva ca saungai vistaratarakea pahitam . svat pjym . svatpjym iti vaktavyam . surj atirj . du nindym . du nindym iti vaktavyam . dukulam durgava . adarthe . adarthe iti vaktavyam . kara pigala . ku pprthe . ku pprtheiti vaktavyam . kubrhmaa kuvrala . prdaya gatdyarthe prathamay . prdaya gatdyarthe prathamay samasyante iti vaktavyam . pragata crya prcrya prntevs prapitmaha . atydaya krntdyarthe dvityay . atydaya krntdyarthe dvityay samasyante iti vaktavyam . atikrnta khavm atikhava atimla . avdaya krudyarthe trtyay . avdaya krudyarthe trtyay samasyante iti vaktavyam . avakrua kokilay avakokila vasanta . parydaya glndyarthe caturthy . parydaya glndyarthe caturthy samasyante iti vaktavyam . pariglna adhyayanya paryadhayana . nirdaya krntdyarthe pacamy . nirdaya krntdyarthe pacamy samasyante iti vaktavyam . nikrnta kaumby nikaumbi nirvrasi . avyayam pravrddhdibhi . avyayam pravrddhdibhi samasyate iti vaktavyam . punaprvavrddham barhi bhavati punaravam punasukham . ivena vibhaktyantalopa
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (33 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

prvpadaprakrtisvaratvam ca . vsasiva kanyeiva . udttavat ti gatimat ca avyayam samasyate iti vaktavyam . anuvyacalat anuprviat yat pariyanti . (P_2,2.19) KA_I,417.8-418.13 Ro_II,690-696 ati iti kimartham . kraka vrajati . hraka vrajati . ati iti akyam akartum . kasmt na bhavati . kraka vrajati . hraka vrajati iti . sup sup iti vartate . ata uttaram pahati . upapadam ati iti tadarthapratiedha . upapadam ati iti tadarthasya ayam pratiedha vaktavya . kasya . tiarthasya . ka puna tiartha . kriy . kriypratiedha v . atha v vyaktam eva idam pahitavyam upapadam akriyay iti . atha akriyay iti kim pratyudhriyate . kraka gata hraka gata . na etat kriyvci . kim tarhi. dravyavci . idam tarhi krakasya gati krakasya vrajy . etat api dravyvci . katham . krdabhihita bhva dravyavat bhavati iti . evam tarhi siddhe sati yat ati iti pratiedham sti tat jpayati crya anayo yogayo nivrttam sup sup iti . kim etasya jpane prayojanam . gatikrakopapadnm krdbhi samsa bhavati iti e paribh na kartavy bhavati . yadi etat jpyate kena idnm samsa bhaviyati . samarthena . yadi evam dhtpasargayo api samsa prpnoti . prvam dhtu upasargea yujyate pact sdhanena iti . na etat asti . prvam dhtu sdhanena yujyate pact upasargea . sdhanam hi kriym nirvartayati . tm upasarga viinai . abhinirvrttasya ca arthasya upasargea viea akya vaktum . ahsamst upasargasamsa vipratiedhena . ahsamst upasargasamsa vipratiedhena . ahsamsasya avaka rja purua rjapurua . upapadasamsasya avaka stamberama karejapa . iha ubhayam prpnoti . kumbhakra nagarakra . upapadasamsa bhavati vipratiedhena . na v ahsamsbhvd upapadasamsa . na v artha vipratiedhena . kim kraam . na v ahsamsbhvd upapadasamsa bhaviyati . katham . gatikrakopadnm krdbhi saha samsavanacam prk subutpatte iti vacant . atha v vibh ahsamsa . yad na ahsamsa tad upapadasamsa bhaviyati . anena eva yath syt tena m bht iti . ka ca atra viea tena v syt anena v . upapadasamsa nityasamsa ahsamsa puna vibh . nanu ca nityam ya samsa sa nityasamsa . yasya vigraha na asti . na iti ha . nitydhikre ya samsa sa nityasamsa . na evam akyam . avyaybhvasya hi anityasamsat prasajyeta . tasmt nitya samsa nityasamsa . yasya vigraha na asti . (P_2,2.20) KA_I,418.15-22 Ro_II,697 evakra kimartha . niyamrtha . na etat asti prayojanam . siddhe vidhi rabhyama antarea api evakram niyamrtha bhaviyati . iata avadhrartha tarhi bhaviyati . yath evam vijyeta : am eva avyayena iti . m evam vijyi : am avyayena eva iti . asti ca idnm anavyayam amabda yadartha vidhi syt . asti iti ha . khaayam brhmaakulam iti . na etat asti prayojanam . antaragatvt atra samsa bhaviyati . idam tarhi prayojanam . am eva yat tulyavidhnam upapadam tatra eva yath syt . am ca anyena ca yat tulyavidhnam upapadam tatra m bht iti . agre bhojam agre bhuktv . agrdiu aprptavidhe samsapratiedham codayiyati . sa na vaktavya bhavati . (P_2,2.23) KA_I,418.24-419.8 Ro_II,698 ea iti ucyate . ka ea nma . yem padnm anukta samsa sa ea . eavacanam padata cet na abhvt . eavacanam padata cet tat na . kim kraam . abhvt . na hi santi tni padni yem padnm anukta samsa . arthata tarhi eagrahaam . yeu artheu anukta samsa sa ea . arthata
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (34 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

cet aviiam . arthata cet aviiam etat bhavati . kuta . padata . na hi santi te arth yeu anukta samsa . trikata tarhi eagrahaam . yasya trikasya anukta samsa sa ea . kasya ca anukta . prathamy . (P_2,2.24.1) KA_I,420.2-421.16 Ro_II,699-704 padagrahaam kimartham. anekam anyrthe iti iyati ucyamne vakyrthe api bahuvrhi syt . yath me mt tath me pit susntam bho iti . padagrahae puna kriyame na doa bhavati . atha anyagrahaam kimartham . anekam padrthe iti iyati ucyamne svapadrthe api bahurvhi syt . rjapurua takapurua iti . na etat asti prayojanam . tatpurua svapadrthe bdhaka bhaviyati . bhavet ekasajdhikre siddham . parakryatve tu na sidhyati . rambhasmarthyt ca tatpurua parakryatvt ca bahuvrhi prpnoti . parakryatve ca na doa . ea iti vartate . eatvt na bhaviyati . eavacane uktam . kim uktam . tatra eavacant doa sakhysamndhikaraanasamseu bahuvrhipratiedha iti . atha ekasajdhikre na artha anyagrahaena . ekasajdhikre ca kartavyam . akriyame hi anyagrahae yath eva tatpurua svapadrthe bahuvrhim bdhate evam anyapadrthe api bdheta . atha anekagrahaam kimartham. anyapadrthe iti iyati ucyamne ekasya api padasya bahuvrhi syt . sarpia api syt . madhuna api syt . gomtrasya api syt . na etat asti prayojanam . sup sup iti vartate . idam tarhi prayojanam . bahnm api samsa yath syt . suskmajaakeena sunatjinavsas . uttarrtham ca anekagrahaam kartavyam crthe dvandva anekam iti . iha api yath syt . plakanyagrodhakhadirapal iti . etat api na asti prayojanam . cryapravrtti jpayati bahnm api samsa bhavati iti yat ayam uttarapade dvigum sti . tatpurua api tarhi bahnm prpnoti . grahaena tatpurua ucyate . tena bahnm na bhaviyati . ata uttaram pahati . anekavacanam upasarjanrtham . anekagrahaam kriyate upasarjanrtham . prathamnirdiam samse upasarjanam iti anekasya supa upasarjanasaj yath syt . citragu abalagu iti . na v ekavibhaktitvt . na v etat api prayojanam asti . kim kraam . ekavibhaktitvt . ekavibhakti ca aprvnipte iti upasarjanasaj bhaviyati . citragu abalagu iti . citr yasya gva citragu tihati . citr yasya gva citragum paya . citr yasya gva citragu krtam . citr yasya gva citragave dehi . citr yasya gva citrago naya . citr yasya gva citrago svam . citr yasya gva citragau nidhehi . citr yasya gva he citrago iti . yadi tarhi yata kuta cit eva kim cit padam adhyhrtya ekavibhakty yoga kriyate etat api ekavibhaktiyuktam bhavati iha api prpnoti . rjakumr takakumr . rja y kumr rjakumr tihati . rja y kumr rjakumrm paya . rja y kumr rjakumry krtam . rja y kumr rjakumryai dehi . rja y kumr rjakumry naya . rja y kumr rjakumry svam . rja y kumr rjakumrym nidhehi . rja y kumr he rjakumri iti . kim vaktavyam etat . na hi . katham anucyamnam gasyate . ekagrahaasmarthyt . yadi hi yat ekavibhaktiyuktam ca anekavibhaktiyuktam ca tatra syt ekagrahaam anarthakam syt . vibhaktiyuktam ca aprvanipte iti eva bryt . (P_2,2.24.2) KA_I, 421.17-423.14 Ro_II,704-710 padrthbhidhne anuprayognupapatti abhihitatvt . padrthasya abhidhne anuprayogasya anupapatti . citragu devadatta iti . kim kraam . abhihitatvt . citraguabdena abhihita sa artha iti krtv anuprayoga na prpnoti . na v anabhihitatvt . na v ea doa . kim kraam . anabhihitatvt .
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (35 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

citraguabdena anabhihita sa artha iti krtv anuprayoga bhaviyati . katham anabhihita yvat idnm eva uktam padrthbhidhne anuprayognupapatti abhihitatvt iti . smnybhidhne hi vienabhidhnam . smnye hi abhidhyamne viea anabhhita bhavati . tatra avayam vierthin viea anuprayoktavya . citragu . ka . devadatta iti. bhavet siddham yad smnye vrtti . yad tu khalu viee vrtti tad na sidhyati . citr gva devadattasya citragu devadatta iti . tat api siddham . katham . na idam ubhayam yugapat bhavati vkyam ca samsa ca . yad vkyam tad na samsa . yad samsa tad na vakyam . yad samsa tad smnye vrtti . tatra avayam vierthin viea anuprayoktavya . citragu . ka . devadatta iti. smnyasya eva tarhi anuprayoga na prpnoti . citragu tat . citragu kim cit . citragu sarvam iti . smnyam api yath viea tadvat . citragu iti ukte sandeha syt . sarvam v vivam v iti . tatra avayam sandehanivrttyartham vierthin viea anuprayoktavya . atha v vibhaktyartha abhidyate . etat ca atra yuktam yat vibhaktyartha abhidhyate . tatra hi sarvapact padam vartate asya iti . vibhaktyarthbhidhne adravyasya ligasakhyopacrnupapatti . vibhaktyarthbhidhne adravyasya ligasakhybhym upacra anupapanna . bahuyavam bahuyav bahuyava bahuyavau bahuhav iti . apara ha : vibhaktyarthbhidhne adravyasya ligasakhyopacrnupapatti vibhaktyarthbhidhne dravyasya ye ligasakhye tbhym vibhaktyarthasya upacra anupapanna . bahuyavam bahuyav bahuyava bahuyavau bahuhav iti . katham hi anyasya ligasakhybhym anyasya upacra syt . siddham tu yath guavacaneu . siddham etat. katham . yath guavacaneu . guavacaneu uktam : guavacannm abdnm rayata ligavacanni bhavanti iti . tat yath uklam vastram ukl ukla kambala uklau kambalau ukl kambal iti . yat asau dravyam rita bhavati gua tasya yat ligam vacanam ca tat guasya api bhavati . evam iha api yat asau dravyam rita vibhaktyartha tasya yat ligam vacanam ca tat samsasya api bhaviyati . yadi tarhi vibhaktyartha abhidhyate krtsna padrtha katham abhihita bhavati sadravya saliga sasakhya ca . arthagrahaasmarthyt . iha anekam anyapade iti iyat siddham . katham puna pade nma vrtti syt . abda hi ea . abde asambhavt arthe kryam vijsyate . sa ayam evam siddhe sati yat arthagrahaam karoti tasya etat prayojanam krtsna padrtha yath abhidhyeta sadravya saliga sasakhya ca iti . yadi tarhi krtsna padrtha abhidhyate laig skhy ca vidhaya na sidhyanti . uktam v . kim uktam . ligeu tvat . siddham tu striy prtipadikavieaatvt svrthe bdaya iti . skhyeu api uktam karmdnm anukt ekatvdaya iti krtv skhy bhaviyanti . pratham tarhi na prpnoti . samayt bhaviyati . yadi smayik na niyogata any kasmt na bhavanti . karmdnm abhvt . ah tarhi prpnoti . ealaka ah . aeatvt na bhaviyati . evam api vyatikara . ekasmin api dvivacanabahuvacane prpnuta dvayo api ekavacanabahuvacane bahuu api ekavacanadvivacane . arthata vyavasth bhaviyati . atha v sakhy nma iyam parapradhn . sakhyeam any vieyam . yadi ca atra pratham na syt sakhyeyam avieitam syt . atha v vakyati etat . tatra vacanagrahaasya prayojanam ukteu api ekatvdiu pratham yath syt iti . evam api ah prpnoti . kim kraam . vyabhicarati eva hi ayam samsa ligasakhye . athyartham puna na vyabhicarati . abhihita sa artha antarbhta prtipadikrtha sampanna . tatra prtipadikrthe pratham iti pratham bhaviyati . na tarhi idnm idam bhavati : citrago devadattasya . bhavati . bhyam artham apekya ah .
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (36 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

(P_2,2.24.3) KA_I,423.16-425.13 Ro_II,710-714 parigaanam kartavyam . bahuvrhi samndhikaranm . samndhikaranm bahuvrhi vaktavya . kim prayojanam . vyadhikaranm m bht iti . pacabhi bhuktam asya iti . avyaynm ca . avyaynm bahuvrhi vaktavya . uccairmukha ncairmukha . saptamyupamnaprvapadasya uttarapadalopa ca . saptamprvasya upamnaprvasya ca bahuvrhi vaktavya uttarapadasya ca lopa vaktavya . kahestha kla asya kahekla uramukham iva mukham asya uramukha kharamukha . samudyavikraahy ca . samudyaahy vikraahy ca bahuvrhi vaktavya uttarapadasya ca lopa vaktavya . kenm samhra c asya keaca suvarasya vikra alakra asya suvarlakra . prdibhya dhtujasya v . prdibhya dhtujasya bahuvrhi vaktavya uttarapadasya ca v lopa vaktavya . prapatitapara prapara prapatitapala prapala . naa astyarthnm . naa astyarthnm bahuvrhi vaktavya uttarapadasya ca v lopa vaktavya . avidyamnaputra aputra avidyamnabhrya abhrya . tat tarhi bahu vaktavyam . na v anabhidhnt asamndhikarae sajbhva . na v vaktavyam . asamndhikaranm bahuvrhi kasmt na bhavati : pacabhi bhuktam asya iti . anabhidhnt . tat ca avayam anabhidhnam rayitavyam . kriyame api vai parigaane yatra abhidhnam na asti na bhavati tatra bahuvrhi . tat yath paca bhuktavanta asya iti . atha etasmin sati anabhidhne yadi vrttiparigaanam kriyate vartiparigaanam api kartavyam . tat katham kartavyam . arthaniyame matvarthagrahaam . arthaniyame matvarthagrahaam kartavyam . matvarthe ya sa bahuvrhi iti vaktavyam . iha m bht : kaam ritam anena iti . tath ca uttarasya vacanrtha . evam ca krtv uttarasya yogasya vacanrtha upapanna bhavati . ke cit tvat hu : yat vrttistre iti . sakhyvyaysanndrdhikasakhy sakhyeye iti . apara ha : yat vrttike iti . karmavacanena aprathmy . karmavacanena aprathmy bahuvrhi vaktavya . ha ratha anena haratha anavn upahrta pau rudrya upahrtapau rudra uddhrta odana sthly uddhrtaudan sthl . yadi karmavacanena iti ucyate kartrvacanena katham . prptam udakam grmam prptodaka grma gat atithaya grmam gattithi grma . kartrvacanena api . kartrvacanena api iti vaktavyam . aprathamy iti kimartham . vre deve gata . aprathamy iti ucyamne iha kasmt na bhavati . vre deve gatam paya iti . bahirag atra apratham . subadhikre astikrdivacanam . subadhikre astikrdnm upasakhynam kartavyam . astikr brhma . tat tarhi vaktavyam . na v avyayatvt . na v vaktavyam . kim kraam . avyayatvt . avyaya ayam astiabda . na ea aste la . katham avyayatvam . upasargavibhaktisvarapratirpak ca niptasaj bhavanti iti niptasj . nipta avyayam iti avyayasaj . (P_2,2.24.4) KA_I,425.14-427.5 Ro_II,714-719 atha kisabrahmacr iti ka ayam samsa . bahuvrhi iti aha . ka asya vigraha . ke sabrahmacria asya iti . yadi evam kaha iti prativacanam na upapadyate . na hi anyat prena anyat khyyate . evam tarhi evam vigraha kariyate : kem sabrahmacr kisbrahmacr iti . prativacanam ca eva na upapadyate svare ca doa bhavati . kisabrahmacr iti evam svara prasajyeta . kisabrahmacr iti ca iyate . evam tarhi evam vigraha kariyate . ka sabrahmacr kisabrahmacr iti . bhavet prativacanam upapannam svare tu doa bhavati . evam tarhi
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (37 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

evam vigraha kariyate . ka sabrahmacr tava kisabrahmacr tvam iti . atha v puna astu evam vigraha : ke sabrahmacria asya iti . nanu ca uktam kaha iti prativacanam na upapadyate . na ea doa . agnaukaravinyyena bhaviyati . tat yath . ka cit kam cit ha . agnau karavi iti . kuru iti kartari anujte karma api anujtam bhavati . apara ha : agnau kariyate iti . kriyatm iti karmai anujte kart api anujta bhavati . yath eva khalu api ke sabrahmacria asya iti kah iti ukte sambandht etat gamyate . nnam sa api kaha iti . evam kaha iti ukte sambandht etat gantavyam syt . nnam te api kah iti . na khalu api te aky samsena pratinirdeum . upasarjanam he te bhavanti . atha arthatrty iti ka ayam samsa . bahuvrhi iti ha . ka asya vigraha . ardham trtyam em iti . ka samsrtha . samsrtha na upapadyate . anyapadrtha hi nma sa bhavati . yem padnm samsa tata anyasya padasya artha anyapadrtha . evam tarhi evam vigraha kariyate . ardham trtyam anayo iti . evam api ka ahyartha . ahyartha na upapadyate . kim hi tayo ardham bhavati . astu tari evam vigraha ardham trtyam em iti . nanu ca uktam samsrtha na upapadyate iti . na ea doa . avayavena vigraha samudya samsrtha . yadi avayavena vigraha samudya samsrtha asidvitya anusasra pavam . sakaraadvityasya balam krasya vardhatm iti. dvayo dvivacanam prpnoti . astu tarhi ayam eva vigraha ardham trtyam anayo . nanu ca uktam . ahyartha na upapadyate iti . na ea doa . idam tvat ayam praavya . atha iha devadattasya bhrt iti ka ahyartha . tatra etat syt . ekasmt prdurbhva iti . etat ca vrtam . tat yath . srthikanam ekapratiraye uitnm prta utthya pratihamnnm na ka cit parasparam sambandha bhavati . evajtyakam bhrtrtvam nma . atra cet yukta ahyartha dryate iha api yukta dryatm . iha tarhi ardhatrty nyantm iti ukte ardhasya nayanam na prpnoti . astu tarhi ayam eva vigraha ardham trtyam em iti . nanu ca uktam anusasra pavam . sakaraadvityasya balam krasya vardhatm iti. dvayo dvivacanam prpnoti iti . na ea doa . ayam tyanta abda asti eva praam . asti sahyavc . tat ya sahyavc tasya idam grahaam . asidvitya asisahya iti gamyate . evam api ardhatrty iti ekasmin ekavacanam iti ekavacanam prpnoti . ekrth hi samudy bhavanti . tat yath atam ytham vanam iti . astu tarhi ayam eva vigraha ardham trtyam anayo iti . nanu ca uktam ardhatrty nyantm iti ukte ardhasya nayanam na prpnoti iti . na ea doa . bhavati bahuvrhau tadguasavijnam api . tat yath . uklavsasam naya . lohito rtvija pracaranti iti . tadgua nyate tadgu ca pracaranti . atha v puna astu ayam eva vigraha ardham trtyam em iti . nanu ca uktam ekavacanam prpnoti iti . na ea doa . sakhy nma iyam parapradhn . sakhyeyam anay vieyam . yadi ca atra ekavacanam syt sakhyeyam avieitam syt . iha tarhi ardhatrty dro iti ayam droaabda samudye pravrtta avayave na upapadyate . na ea doa . samudyeu api abd pravrtt avayaveu api vartante. tad yath . prve pacl uttare pacl tailam bhuktam ghrta bhuktam ukla nla kapila kra iti . evam ayam samudye droaabda pravrtta avayaveu api vartati . kmam tarhi anena eva hetun yad dvau droau ardhrhakam ca kartavyam ardhatrty dro iti . na kartavyam . samudyeu api hi abd pravrtt avayaveu api vartante. keu avayaveu . ya avayava tam samudyam na vyabhicarati . kam ca samudyam na vyabhicarati . ardhdroa droam . ardhhakam puna vyabhicarati .

file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (38 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

(P_2,2.25) KA_I,427.7-428.16 Ro_II,719-724 dvitr tricatur iti ka ayam samsa . bahuvrhi iti ha . ka asya vigraha . dvau v traya v iti . bhavet yad bahnm nayanam tad bahuvacanam upapannam yad tu khalu dvau nyete tad na sidhyati . tad api sidhyati . katham . ke cit tvat hu : anirjte arthe bahuvacanam prayoktavyam iti . tat yath : kati bhavata putr . kati bhavata bhry iti . apara ha : dvau v iti ukte traya v iti gamyate . traya v iti ukte dvau v iti gamyate . s e pacdhihn vk . atra yuktam bahuvacanam . atha dvida trida iti ka ayam samsa . bahuvrhi iti ha . ka asya vigraha . dvi daa dvia iti . sakhysamse sujantatvt sakhyprasiddhi . sakhysamse sujantatvt sakhy iti aprasiddhi . na hi sujant sakhy asti . evam tarhi evam vigraha kariyate . dvau daatau dvida iti . evam api atkrntatvt sakhy iti aprasiddhi . na hi atkrnt sakhy asti . astu tarhi ayam eva vigraha dvi daa dvia iti . nanu ca uktam sakhysamse sujantatvt sakhy iti aprasiddhi iti . na v asujantatvt . na v ea doa . kim kraam . asujantatvt . sujant iti ucyate . na ca atra sujantam payma . kim puna kraam vkye suc dryate samse tu na dryate . sujabhva ahihitrthatvt samse . samse suca abhva . kim kraam . ahihitrthatvt . abhihita sujartha samsena iti krtv samse suc na bhaviyati .kim ca bho sujarthe iti samsa ucyate . na khalu sujarthe iti ucyate gamyate tu sujartha . katham . yvat sakhyeya ya sakhyay sakhyyate sa ca kriybhyvrttyartha . sa ca ukta samsena iti krtv samse suc na bhaviyati . aiya sakhyottarapada sakhyeyavbhidhyyitvt . aiya sakhyottarapada bahuvrhi . kim kraam . sakhyeyavbhidhyyitvt . sakhyeyam vrtha ca abhidyate . tatra anyapadrthe iti eva siddham . bhavet siddham adhikavi adhikatri iti yatra etat vicryate . viatydaya daadarthe v syu parimini v iti . idam tu na sidhyati adhikada iti yatra niyogata sakhyeye eva vartate . atha upada iti ka ayam samsa . bahuvrhi iti ha . ka asya vigraha . danm sampe upada iti . kasya puna smpyam artha . upasya . yadi evam na anyapadrtha bhavati . tatra prathnirdiam sakhygrahaam akyam akartum . matvarthe v prvasya vidhnt . atha v matvarthe prva yoga . amatvartha ayam rambha . kababhvrtham v . atha va kap m bht iti . (P_2,2.26, 28) KA_I,428.19-429.16 Ro_II,725-727 diksamsasahayogayo ca antarlapradhnbhidhnt . diksamsasahayogayo ca aiya bahuvrhi . kim kraam . antarlapradhnbhidhnt . diksamse sahayoge ca antarlam pradhnam ca abhidhyate . tatra anyapadrthe iti eva siddham . yadi evam dakiaprv dik samndhikaraalakaa puvadbhva na prpnoti . adya puna iyam s eva daki s eva prv iti krtv samndhikaraalakaa puvadbhva siddha bhavati . na sidhyati . bhitapuskasya puvadbhva . na ca etau bhitapuskau . nanu ca bho dakiaabda prvaabda ca pusi bhyete . samnym krtau yat bhitapuskam . krtyantare ca etau bhitapuskau . daki prv iti dikabdau . dakia prva iti vyavasthabdau . yadi puna dikabd api vyavasthabd syu . katham yni digapadini kryi . yad dia vyavasthm vakyanti . yadi tari ya ya dii vartate sa sa dikabda ramaydiu atiprasaga bhavati . ramay dik obhan dik iti . atha matam etat dii dra digdra digdia abda dikabda diam ya na vyabhicarati iti ramaydiu atiprasaga na bhavati . puvadbhva tu prpnoti . evam tarhi sarvanmna vrttimtre puvadbhva
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (39 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

vaktavya dakiottaraprvm iti evamartham . evam ca krtv dik diksamsasahayogayo ca antarlapradhnbhidhnt iti eva . nanu ca uktam dakiaprv dik samndhikaraalakaa puvadbhva na prpnoti iti . na ea doa . sarvanmna vrttimtre puvadbhvena parihrtam . matvarthe v prvasya vidhnt . atha v matvarthe prva yoga . amatvartha ayam rambha . kababhvrtham v . atha va kap m bht iti . (P_2,2.27) KA_I,429.18-430.6 Ro_II,727-728 trtysaptamyanteu ca kriybhidhnt . trtysaptamyanteu ca kriybhidhnt aiya bahuvrhi . kim kraam . kriybhidhnt . kriy abhidhyate . tatra anyapadrthe iti eva siddham . na v ekaeapratiedhrtham . na v aiya . kim kraam . ekaeapratiedhrtham idam vaktavyam . prvadrghrtham ca . prvadrghrtham ca idam vaktavyam . kekei . syt etat prayojanam yadi niyogata asya anena eva drghatvam syt . atha idnm anyem api dryate iti drghatvam na prayojanam bhavati . matvarthe v prvasya vidhnt . atha va matvarthe prva yoga . amatvartha ayam rambha . kababhvrtham v . atha va kap m bht iti . (P_2,2.29.1) KA_I,430.8-25 Ro_II,729-730 crthe iti ucyate ca ca avyayam . tena samsasya avyayasaj prpnoti . na ea doa . phena avyayasaj kriyate . na ca samsa tatra pahyate . phena api avyayasajym satym abhideheyavat ligavacanni bhavanti . ya ca iha artha abhidhyate na tasya ligasakhybhym yoga asti . na idam vcanikam aligat asakhyat va . kim tarhi . svbhvikam etat . tat yath : samnam hamnnm adhynnm ca ke cit arthai yujyante apare na . na ca idnm ka cit arthavn iti krtv sarvai arthavadbhi akyam bhavitum ka cit anarthaka iti krtv sarvai anarthakai . tatra kim asmbhi akyam kartum . yat prk samst crthasya ligasakhybhym yoga na asti samse ca bhavati svbhvikam etat . atha v rayata ligavacanni bhaviyanti . guavacannm hi abdnm rayata ligavacanni bhavanti . tat yath uklam vastram , ukl ukla kambala , uklau kambalau ukl kambal iti . yat asau dravyam rita bhavati gua tasya yat ligam vacanam ca tat guasya api bhavati . evam iha api yat asau dravyam rita bhavati samsa tasya yat ligam vacanam ca tat samsasya api bhaviyati . atha iha kasmt na bhavati . yjika ca ayam vaiykaraa ca . kaha ca ayam bahvrca ca . aukthika ca ayam mmsaka ca iti . ea iti vartate . aeatvt na bhaviyati . yadi ea iti vartate upsntam sthlasiktam tgagam mahhradam droam cet aaka gantum m tv tptm krtkrte iti etat na sidhyati . na ea doa . anyat hi krtam anyat akrtam . (P_2,2.29.2) KA_I,431.1-434.14 Ro_II,731-741 crthe dvandvavacane asamse api crthasampratyayt aniaprasaga . crthe dvandvavacane asamse api crthasampratyayt aniam prpnoti . aha aha nayamna gm avam puruam paum vaivasvata na trpyati sury iva durmad indra tva varua vyu ditya iti . siddham tu yugapadadhikaraavacane dvandvavacant . siddham etat . katham . yugapadadhikaraavacane dvandva bhavati iti vaktavyam . tatra puvadbhvapratiedha . tatra etasmin lakae puvadbhvasya pratiedha vaktavya . pavmrdvyau . samndhikaraalakaa puvadbhva prpnoti . vipratiiddheu ca anupapatti . vipratiiddheu yugapadadhikaraavacaty anupapatti . toe sukhadukhe jananamarae . kim kraam . sukhapratightena hi dukham dukapratightena ca sukham .
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (40 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

yat tvat ucyate tatra puvadbhvapratiedha iti . idam tvat ayam praavya : atha iha kasmt na bhavati . daranyy mt daranymt iti . atha matam etat prk samst yatra smndhikarayam tatra puvadbhva bhavati iti iha api na doa bhavati . yad api ucyate vipratiiddheu ca anupapatti iti . sarve eva hi abd vipratiiddh . iha api plakanyagrodhau iti plakaabda prayujyamna plakrtham sampratyyayati nyagrodhrtham nivartayati . nyagrodhaabda prayujyamna nyagrodhrtham sampratyyayati plakrtham nivartayati . atra cet yukt yugapat adhikaravacanat dryate iha api yukt dryatm . evam api abdapaurvparyaprayogt arthapaurvparybhidhnam . abdapaurvparyaprayogt arthapaurvparybhidhnam prpnoti . ata kim . yugapatadhikaraavacanaty anupapatti . plakanyagrodhau plakanyagrodh iti . yatha eva hi abdnm paurvparyam tadvat arthnm api bhavitavyam . abdapaurvparyaprayogt arthapaurvparybhidhnam iti cet dvivacanabahuvacannupapatti . abdapaurvparyaprayogt arthapaurvparybhidhnam iti cet dvivacanabahuvacannupapatti : plakanyagrodhau plakanyagrodh iti . plakaabda srthaka nivrtta nyagrodhaabda upasthita ekrtha tasya ekrthatvt ekavacanam eva prpnoti . vigrahe tu yugapadvacanam jpakam yugapadvacanasya . vigrahe khalu api yugapadvacanat dryate : dyav ha kam . dyav cit asmai prthiv namete iti . kim etat . yugapadadhikaraavacanaty upodbalakam . vigrahe kila nma yugapadadhikaraavacanat syt kim puna samse . samudyt siddham . samudyt siddham etat . kim etat samudyt siddham iti . dvivacanabahuvacanaprasiddhi iti coditam . tasya ayam parihra . samudyt siddham iti cet na ekrthatvt samudyasya . samudyt siddham iti cet tat na . kim kraam . ekrthatvt samudyasya . ekrth hi samudy bhavanti . tat yath atam ytham vanam iti . na aikrthyam . na ayam ekrtha . kim tarhi . dvyartha bahvartha ca . plaka api dvyartha nyagrodha api dvyartha . yadi tarhi plaka api dvyartha nyagrodha api dvyartha tayo anekrthatvt bahuvacanaprasaga . tayo anekrthatvt bahuu bahuvacanam iti bahuvacanam prpnoti . tayo anekrthatvt bahuvacanaprasaga iti cet na bahutvbhvt . tayo anekrthatvt bahuvacanaprasaga iti cet tat na . kim kraam . bahutvbhvt . na atra bahutvam asti . kim ucyate bahutvbhvt iti yvat idnm eva uktam plaka api dvyartha nyagrodha api dvyartha iti . ybhym eva atra eka dvyartha tbhym eva apara api . yadi evam anyavcakena anyasya vacannupapatti . anyavcakena abdena anyasya vacanam na upapadyate . anyavcakena anyasya vacannupapatti iti cet plakasya nyagrodhatvt nyagrodhasya plakatvt svaabdena abhidhnam . anyavcakena anyasya vacannupapatti iti cet ucyate tat na . kim kraam . plakasya nyagrodhatvt nyagrodhasya plakatvt svaabdena abhidhnam . plaka api nyagrodha nyagrodha api plaka . katham puna plaka api nyagrodha nyagrodha api plaka syt yvat krat dravye abdanivea . krat dravye abdanivea iti cet tulyakraatvt siddham . krat dravye abdanivea iti cet evam ucyate : tat na tulyakraatvt siddham . tulyam hi kraam . yadi tvat prakarati iti plaka syn nyagrodhe api etat bhavati . tath yadi nyak rohati iti nyagrodha plake api etat bhavati . daranam vai hetu na ca nyagrodhe plakaabda dryate . daranam hetu iti cet tulyam . daranam hetu iti cet tulyam etat bhavati . plake api nyagrodhaabda dryatm . tulyam hi kraam . na vai loke ea sampratyaya bhavati . na hi plaka nyatm iti ukte nyragrodha nyate . tadviayam ca . tadviayam ca etat draavyam plakasya
file:///C|/Users/student/Desktop/siddhanta%20k...hasya/Patanjali%20Vyakaranamahabhasya,%202.htm (41 of 73) [3/8/2008 12:51:37 PM]

Patanjali: Vyakaranamahabhasya, 2

nyagrodhatvam . kiviayam . dvandvaviayam . yuktam puna yat niyataviay nma abd syu . bham yuktam . anyatra api tadviayadarant . anyatra api hi niyataviay abd dryante . tat yath : samne rakte vare gau lohita iti bhavati sva oa iti . samne ca kle vare gau kra iti bhavati ava hema iti . samne ca ukle vare gau veta iti bhavati ava karka iti . yadi tarhi plaka api nyagraodha nyagrodha api plaka ekena uktatvt aparasya prayoga anupapanna . ekena uktatvt tasya arthasya aparasya prayoga na upapadyate . plakea nyagrodhasya nyagrodhaprayoga . ekena uktatvt aparasya prayoga anupapanna iti cet anuktatvt plakea nyagrodhasya nyagrodhaprayoga . ekena uktatvt aparasya prayoga anupapanna iti cet tat na . kim kraam . anuktatvt plakea nyagrodhasya nyagrodhaprayoga . anukta plakea nyagrodhrtha iti krtv nyagrodhaabda prayujyate . katham anukta yvat idnm eva uktam plaka api nyagrodha nyagrodha api plaka iti . sahabhtau etau anyonyasya artham hatu na prthagbhtau . kim puna kraam sahabhtau etau anyonyasya artham hatu na prthagbhtau . abhidhnam puna svbhvikam . svbhvikam abhidhnam . atha v iha kau cit prthamakalpikau plakanyagrodhau kau cit kriyay v guena va plaka iva ayam plaka , nya