Sie sind auf Seite 1von 4

English General information Franais Information gnrale Deutsch Allgemeine Informationen Nederlands Algemene informatie

It is technically possible to use an additional number of FM wireless headphones or Il est techniquement possible d'utiliser plusieurs autres casques sans fil FM ou des enceintes sans fil FM Es ist technisch mglich, eine Reihe zustzlicher FM-Drahtloskopfhrer oder Philips FM- Het is technisch mogelijk om een aantal extra draadloze FM-hoofdtelefoons of draadloze Philips
Philips FM wireless speakers with a single transmitter if they all+: Philips avec un seul metteur condition quils+: Drahtloslautsprecher mit einem einzigen Sender zu benutzen, wenn sie alle+: FM-luidsprekers te gebruiken met n enkele zender op voorwaarde dat ze allemaal+:
operate in the 864 MHz band fonctionnent tous dans la bande 864 MHz im 864 MHz-Bereich arbeiten de 864 MHz-band gebruiken
work according to the same modulation scheme utilisent tous le mme systme de modulation nach demselben Modulationsschema arbeiten volgens hetzelfde modulatieschema werken W Batterijen niet weggooien,
maar inleveren als KCA.
can detect a 19kHz pilot tone dtectent tous une frquence pilote de 19kHz einen 19 kHz-Pilotton feststellen knnen een piloottoon van 19kHz kunnen detecteren.
Please consult the appliances electrical specification sheets for confirmation on compatibility. Consultez les fiches de spcifications lectriques de l'appareil pour connatre sa compatibilit. Zur Besttigung der Kompatibilitt ziehen Sie bitte die Elektrodatenbltter des Gertes zu Rate. Raadpleeg de elektrische gegevens van het apparaat om de compatibiliteit na te gaan.
Please observe the local regulations regarding the disposal of packing materials, exhausted batteries and Veuillez observer les rglements locaux lorsque vous vous dbarrassez des matriaux demballage, des piles Bitte halten Sie sich beim Entsorgen von Verpackungsmaterial, erschpften Batterien und alter Gerte an Houdt u zich aan de lokale voorschriften voor het inleveren van verpakkingsmateriaal, lege batterijen en
old equipment. usages et de votre ancien appareil. rtliche Bestimmungen. oude apparatuur.
Hearing Safety! Continuous use at high volume may damage your hearing permanently. Scurit dcoute! Une utilisation continue volume lev peut endommager votre oue de faon permanente. Hrsicherheit! Stndige Benutzung bei hoher Lautstrke kann Ihr Gehr bleibend schdigen. Bescherm uw gehoor! Langdurig gebruik aan een hoog volume kan blijvend letsel aan uw gehoor
Use only Philips shorten sleeve rechargeable NiMH batteries (R03/AAA, type number: SBC HB550S)
Before using the FM wireless headphone for the first time, please ensure that the batteries are fully charged Utilisez seulement les piles rechargeables NiMH Philips (R03/AAA, type: SBC HB550S) Benutzen Sie ausschlielich wiederaufladbare Kurzmantel- NiMH-Batterien veroorzaken.
for at least 16 hours.This will guarantee a longer operating lifetime of batteries. Avant d'utiliser un casque sans fil FM pour la premire fois, vrifiez que les piles sont entirement charges (R03/AAA,Typnummer: SBC HB550S) von Philips Gebruik enkel oplaadbare NiMH-batterijen met een kortere isolatiehuls van Philips
Remove the batteries from the headphones battery compartment if the system will not be used for a long (au moins 16 heures de rechargement).Vous prolongerez ainsi l'utilisation des piles. Vor erstmaliger Benutzung des FM-Drahtloskopfhrers stellen Sie bitte sicher, dass die Batterien etwa (R03/AAA, typenummer: SBC HB550S)
period of time Retirez les piles du compartiment piles du casque si vous ne lutilisez pas pendant une longue priode. 16 Stunden lang voll aufgeladen werden. Dadurch wird eine lngere Standzeit der Batterien garantiert. Zorg ervoor dat de batterijen volledig opgeladen worden gedurende minstens 16 uur voor u de draadloze
Do not disassemble the product. In the event of technical difficulties, take it to your Philips retailer, or look Ne dmontez pas ce produit. En cas de problmes techniques, apportez-le votre dtaillant Philips ou Nehmen Sie die Batterien aus dem Kopfhrer-Batteriefach heraus, wenn das System lngere Zeit nicht FM-hoofdtelefoon voor het eerst gebruikt. Hierdoor gaan de batterijen gegarandeerd langer mee.
for helpline number via www.philips.com/welcome cherchez le numro de l'assistance technique sur www.philips.com/welcome benutzt wird. Haal de batterijen uit het batterijvak van de hoofdtelefoon als u het systeem gedurende langere tijd niet
All redundant packing material has been omitted. We have done our best to make the packaging easily Tous les matriaux demballage superflus ont t supprims. Nous nous sommes efforcs de rendre Zerlegen Sie das Produkt nicht. Bei technischen Schwierigkeiten bringen Sie es zu Ihrem Philips-Hndler zult gebruiken.
separable into two materials: cardboard and polyethylene. l'emballage facile sparer en deux matriaux: carton et polythylne. oder besorgen Sie sich die Helpline-Nummer ber www. philips.com/welcome Haal het apparaat niet uit elkaar. Als er zich technische problemen voordoen, breng het apparaat dan naar
Your unit consists of materials which can be recycled if disassembled by a specialized company. Please observe Votre appareil est compos de matriaux pouvant tre recycls sil est dmont par une firme spcialise. Alles berflssige Verpackungsmaterial wurde vermieden. Wir haben unser Mglichstes getan, damit die uw Philips-leverancier of zoek het nummer van de helpdesk op op www.philips.com/welcome
the local regulations regarding the disposal of packing materials, exhausted batteries and old equipment. Veuillez observer les rglements locaux lorsque vous vous dbarrassez des matriaux demballage, des piles Verpackung leicht in zwei Materialien (Pappe und Polythylen) aufteilbar ist. Wij hebben alle overbodig verpakkingsmateriaal weggelaten en ervoor gezorgd dat de verpakking
Do not expose this product to extreme heat of direct sunlight. usages et de votre ancien appareil. Ihr Gert besteht aus Materialien, die von darauf spezialisierten Betrieben wiederverwertet werden gemakkelijk in twee materialen te scheiden is: karton en polyethyleen.
+ This statement is to be interpreted from a technical point of view only and does therefore not constitute any + Cette dclaration doit tre interprte seulement d'un point de vue technique et, par consquent, ne knnen. Bitte halten Sie sich beim Entsorgen von Verpackungsmaterial, erschpften Batterien und alter Uw apparaat bestaat uit materialen die door een gespecialiseerd bedrijf gerecycled kunnen worden.
Gerte an rtliche Bestimmungen. Informeer waar u verpakkingsmateriaal, lege batterijen en oude apparatuur kunt inleveren.
guarantee nor obligation whatsoever regarding the commercial availability of single FM wireless headphones/ constitue pas une garantie ni une obligation de quelque nature que ce soit concernant la disponibilit
speakers compatible with SBC HC8442. commerciale de casques/enceintes FM sans fil compatibles SBC HC8442. + Diese Aussage ist lediglich von einem technischen Standpunkt aus zu interpretieren und stellt somit weder eine + Deze verklaring mag enkel vanuit een technisch oogpunt genterpreteerd worden en biedt dan ook geen
Garantie noch eine Verpflichtung bezglich der Kuflichkeit einzelner FM-Drahtloskopfhrer/-lautsprecher, die garantie noch verbindt het tot verplichtingen van welke aard ook wat betreft de commercile beschikbaarheid
Specification* Spcifications* mit SBC HC8442 kompatibel sind, dar. van losse draadloze FM-hoofdtelefoons/ -luidsprekers die compatibel zijn met de SBC HC8442.
Transmitter metteur
System: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Radio Frequency (RF) Systme: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Radiofrquence (RF) Technische Daten* Technische gegevens*
Modulation: . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Frequency Modulation (FM) Modulation: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Modulation de frquence (FM) Sender Zender
Carrier Frequency: (/00 & /05) . . . . . . . . . . . . . .Channel 1: 863.5 MHz Frquence porteuse: (/00 & /05) . . . . . . . . . . . . Canal 1: 863,5 MHz System: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Hochfrequenz (RF) Systeem: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Radiofrequentie (RF)
Channel 2: 864 MHz Canal 2: 864 MHz Modulation: . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Frequenzmodulation (FM) Modulatie: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Frequentiemodulatie (FM)
Radiated Output Power: . . . . . . . . . . . . . . . . . . .< 10 mW Puissance de sortie rayonne: . . . . . . . . . . . . . . <10 mW Trgerfrequenz: (/00 & /05) . . . . . . . . . . . . . . . .Kanal 1: 863,5 MHz Kanal 2: 864 MHz Draagfrequentie: (/00 & /05) . . . . . . . . . . . . . . .Kanaal 1: 863.5 MHz Kanaal 2: 864 MHz
Effective Transmission Range: . . . . . . . . . . . . . . .100 m** Porte dmission efficace: . . . . . . . . . . . . . . . . . 100 m** Abgestrahlte Ausgangsleistung: . . . . . . . . . . . . . .< 10 mW Uitgestraald uitgangsvermogen: . . . . . . . . . . . . .< 10 mW
Input Level: . . . . . . . . . . . . . . . . . . . . . . . . . . . . .500mV Niveau dentre: . . . . . . . . . . . . . . . . . . . . . . . . . 500 mV Effektiver bertragungsbereich: . . . . . . . . . . . . .100 m** Effectief zendbereik: . . . . . . . . . . . . . . . . . . . . . .100 m**
Power supply: . . . . . . . . . . . . . . . . . . . . . . . . . . .12 Volts/ 200mA DC, centre positive; Alimentation lectrique: . . . . . . . . . . . . . . . . . . . 12 volts/200 mA CC, centre positif;Type: Eingangspegel: . . . . . . . . . . . . . . . . . . . . . . . . . . .500 mV Ingangsniveau: . . . . . . . . . . . . . . . . . . . . . . . . . . .500mV
Stromversorgung: . . . . . . . . . . . . . . . . . . . . . . . .12 Volt / 200 mA DC, Mitte positiv; Voeding: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .12 volt/ 200mA gelijkstroom, midden is plus;
Receiver Rcepteur
System: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Radio Frequency (RF) Systme: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Radiofrquence (RF) Empfnger Ontvanger
Carrier Frequency: (/00 & /05) . . . . . . . . . . . . . .Channel 1: 863.5 MHz Frquence porteuse: (/00 & /05) . . . . . . . . . . . . Canal 1: 863,5 MHz System: . . . . . . . . . . . . . . . . . . . . . . . . . . .
.Hochfrequenz (RF) . . . . Systeem: . . . . . . . . . . . . . . . . . . . . . . . . . .
.Radiofrequentie (RF) . . . .
Channel 2: 864 MHz Canal 2: 864 MHz Trgerfrequenz: (/00 & /05) . . . . . . . . . . .
.Kanal 1: 863,5 MHz. . . .
Kanal 2: 864 MHz Draagfrequentie: (/00 & /05) . . . . . . . . . .
.Kanaal 1: 863.5 MHz . . . .
Kanaal 2: 864 MHz
S/N ratio: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .> 55dB (1kHz sine wave, A-weighted) Rapport signal/bruit: . . . . . . . . . . . . . . . . . . . . . . > 55 dB (onde sinusodale de 1 kHz, pondre A) Strabstand: . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.> 55dB (1 kHz Sinuswelle, A-bewertet) Signaal/ruis-verhouding: . . . . . . . . . . . . . . . . . . .
.> 55dB (1kHz sinusgolf, A-gewogen)
Distortion: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .c 2% THD Distorsion: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . distorsion harmonique totale c 2 % Verzerrung: . . . . . . . . . . . . . . . . . . . ..Klirrfaktor c 2%
. . . . . . . . Vervorming: . . . . . . . . . . . . . . . . . . . . .
.c 2% THD . . . . . . .
Channel Separation: . . . . . . . . . . . . . . . . . . . . . .> 30dB Sparation des canaux: . . . . . . . . . . . . . . . . . . . . > 30 dB Kanalabstand: . . . . . . . . . . . . . . . . . . . .
.> 30dB. . . . . . . Kanaalscheiding: . . . . . . . . . . . . . . . . . .
.> 30dB . . . . . . .
Audio frequency range: . . . . . . . . . . . . . . . . . . . .20-20,000 Hz Porte de frquence audio: . . . . . . . . . . . . . . . . 20-20 000 Hz Audiofrequenzbereich: . . . . . . . . . . . . . .
.20-20.000 Hz . . . . . Audiofrequentiebereik: . . . . . . . . . . . . .
.20-20.000 Hz . . . . . .
Power supply: . . . . . . . . . . . . . . . . . . . . . . . . . . .2 x R03/AAA rechargeable batteries Alimentation lectrique: . . . . . . . . . . . . . . . . . . . 2 x piles rechargeables R03/AAA Stromversorgung: . . . . . . . . . . . . . . . . . . . . . . .
.2 x R03/AAA wiederaufladbare Batterien Voeding: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.2 x oplaadbare R03/AAA-batterijen.
(Philips NiMH,Type number: SBC HB550S) (Philips NiMH, type: SBC HB550S) (Philips NiMH,Typnummer: SBC HB550S) (Philips NiMH, typenummer SBC HB550S)
Battery Life Time: . . . . . . . . . . . . . . . . . . . . . . . .~ 15 hours Dure des piles: . . . . . . . . . . . . . . . . . . . . . . . . . ~ 15 heures Batteriestandzeit: . . . . . . . . . . . . . . . . . . . . . . . . .~ 15 Stunden Levensduur batterijen: . . . . . . . . . . . . . . . . . . . . .~ 15 uur

* Specification subject to changes ** Depending on ambient conditions * Spcifications susceptibles d'tre modifies ** Selon les conditions cifications ambiantes * nderung der technischen Daten vorbehalten ** Je nach Umgebungsbedingungen * Wijzigingen van de technische gegevens voorbehouden ** Afhankelijk van de omgevingsfactoren
Hereby, Philips Consumer Electronics, B.U. Peripherals & Accessories, declares that this FM wireless headphone Philips Consumer Electronics, B.U. priphriques et accessoires, dclare par la prsente que ce systme de Hiermit erklrt Philips Consumer Electronics, Unternehmensbereich Peripheriegerte & Zubehr, dass dieses Hierbij verklaart Philips Consumer Electronics, B.U. Peripherals & Accessories, dat dit draadloos
system (SBC HC 8440) is in compliance with the essential requirements and other relevant provisions of casque sans fil FM (SBC HC 8440) est conforme aux exigences essentielles et aux dispositions concernes de la FM-Drahtloskopfhrersystem (SBC HC 8440) mit den wesentlichen Anforderungen und sonstigen einschlgigen FM-hoofdtelefoonsysteem (SBC HC 8440) voldoet aan de basisvoorschriften en overige relevante vereisten van
Directive 1999/5/EC. directive 1999/5/EC. Bestimmungen von Richtlinie 1999/5/EWG konform geht. Richtlijn 1999/5/EC.

This product has been designed, tested and manufactured according the European R&TTE Directive 1999/5/EC. Ce produit a t conu, test et fabriqu en respectant la directive europenne R&TTE 1999/5/EC. Dieses Produkt wurde im Einklang mit der europischen R&TTE-Richtlinie 1999/5/EWG konstruiert, geprft und Dit product is ontworpen, getest en gefabriceerd volgens de Europese R&TTE-richtlijn 1999/5/EC.
Following this Directive, this product can be brought into service in the following states: Conformment cette directive, ce produit peut tre mis en service dans les tats suivants: hergestellt. Lt. dieser Richtlinie kann dieses Produkt in den folgenden Lndern in Verkehr gebracht kommen: Conform deze richtlijn kan het product in de volgende landen voor service aangeboden worden:
/00 /05 /00 /05 /00 /05 /00 /05
B  DK  E  GR  F  B  DK  E  GR  F  B  DK  E  GR  F  B  DK  E  GR  F  B  DK  E  GR  F  B  DK  E  GR  F  B  DK  E  GR  F  B  DK  E  GR  F 
IRL  I  L  NL  A  IRL  I  L  NL  A  IRL  I  L  NL  A  IRL  I  L  NL  A  IRL  I  L  NL  A  IRL  I  L  NL  A  IRL  I  L  NL  A  IRL  I  L  NL  A 
P  SU  S  UK  N  P  SU  S  UK  N  P  SU  S  UK  N  P  SU  S  UK  N  P  SU  S  UK  N  P  SU  S  UK  N  P  SU  S  UK  N  P  SU  S  UK  N 
D  CH  D  CH  D  CH  D  CH  D  CH  D  CH  D  CH  D  CH 
This product complies with class 3 requirements as set down in EN301 489-1 and EN301 489-9. Ce produit est conforme aux critres de la classe 3 dfinis dans les directives EN301 489-1 et EN301 489-9. Dieses Produkt entspricht den Anforderungen der Klasse 3 lt. EN301 489-1 und EN301 489-9. Dit apparaat voldoet aan de Klasse 3-voorschriften zoals vastgelegd in de standaarden EN301 489-1 en
EN301 489-9.

Espaol Informacin general Portugus Informao geral Italiano Informazioni generali Svenska Allmn information
Tcnicamente, es posible utilizar un nmero adicional de auriculares inalmbricos de FM o altavoces Tecnicamente, possvel usar mais auscultadores FM sem fios ou altifalantes Philips FM sem fios com um tecnicamente impossibile usare un numero addizionale di cuffie senza fili FM oppure Det r tekniskt mjligt att anvnda flera trdlsa FM-hrlurar eller Philips trdlsa FM-hgtalare med en
inalmbricos de FM Philips con un solo transmisor si todos ellos+: nico transmissor, desde que todos eles+: Altoparlanti senza fili Philips con una singola trasmittente se tutti+: enda sndare frutsatt att de alla+:
funcionan en la banda 864 MHz funcionem na banda de 864 MHz funzionano nella banda di 864 MHz anvnds p 864 MHz-bandet
funcionan de acuerdo con el mismo esquema de modulacin funcionem segundo o mesmo esquema de modulao operano secondo lo stesso schema di modulazione fungerar enligt samma moduleringsschema
pueden detectar un tono piloto de 19 kHz consigam detectar um tom piloto de 19 KHz possono rilevare tono pilota di 19kHz kan avknna en pilotton p 19kHz.
Consulte las hojas de especificaciones elctricas del aparato para confirmar la compatibilidad. Queira consultar as folhas de especificaes elctricas dos aparelhos para confirmar a compatibilidade. Vi preghiamo consultare la scheda della specifica tecnica dellapparecchio per confermare la compatibilit. Ls i enheternas elspecifikationer fr att kontrollera att de r kompatibla.
Observe el reglamento local relacionado con la eliminacin de materiales de embalaje, Queira, por favor, respeitar as regulamentaes locais relativas eliminao de materiais de embalagem, Si prega osservare i regolamenti locali riguardanti lo smaltimento di materiale da imballaggio, batterie Flj lokala bestmmelser om omhndertagande av frpackningsmaterial, uttjnta batterier och gammal
pilas agotadas y equipo viejo. pilhas gastas e equipamento obsoleto. scariche e vecchi apparecchi. utrustning.
Seguridad para el odo! El uso continuo del equipo a alto volumen puede daar su odo permanentemente. Segurana relativa audio! Sicurezza auricolare! Uso continuo ad elevato volume potrebbe danneggiare permanentemente ludito. Hrselskerhet! Kontinuerlig anvndning vid hg volym kan skada hrseln permanent.
Use solamente pilas NiMH recargables de manguito corto (R03/AAA, nmero de tipo: SBC HB550S) de Philips. A utilizao contnua a um volume alto poder danificar permanentemente a audio. Usare soltanto batterie a corto isolamento ricaricabili Philips NiMH (R03/AAA, tipo numero: SBC HB550S) Anvnd endast laddningsbara NiMH-batterier med frkortad hylsa frn Philips
Antes de utilizar los auriculares inalmbricos de FM por primera vez, asegrese de que las pilas estn Utilize apenas pilhas Philips NiMH recarregveis de isolamento mais curto Prima di usare le cuffie FM per la prima volta, assicurarsi che le batterie vengano completamente caricate (R03/AAA, typnummer: SBC HB550S).
completamente cargadas para 16 horas como mnimo. Esto garantizar una vida til ms larga para las pilas. (R03/AAA, nmero de identificao: SBC HB550S) per 16 ore. Questo garantir una pi lunga durata operativa delle batterie. Innan du anvnder FM-hrlurarna fr frsta gngen mste batterierna ha laddats i minst ca 16 timmar.
Retire las pilas del compartimiento de pilas de los auriculares si el sistema no va a utilizarse por un perodo Antes de usar os auscultadores FM sem fios pela primeira vez, certifique-se de que as pilhas so completamente Rimuovere le batterie dal loro comparto delle cuffie se queste non vengono usate per un lungo periodo di P s stt fr du ut lngre livslngd ur batterierna.
de tiempo largo. carregadas por um perodo de pelo menos 16 horas. Isto garantir uma maior durao das pilhas. tempo. Ta ut batterierna ur hrlurarnas batterifack om systemet inte ska anvndas under en lngre tid.
No desmonte el producto. En caso de dificultades tcnicas, llvelo a su tienda de Philips u obtenga el Retire as pilhas do respectivo compartimento dos auscultadores se vai estar muito tempo sem usar o sistema. Non smontare questo prodotto. Nelleventualit di difficolt tecniche, portarlo dal rivenditore Philips, Plocka inte isr produkten. Om du fr tekniska problem br du ta produkten till en Philips-frsljare eller
nmero de la lnea telefnica de ayuda a travs de www.philips.com/welcome No desmonte este produto. Na eventualidade de dificuldades tcnicas, leve-o ao seu retalhista Philips, ou o rilevare il numero della linea di assistenza mediante www.philips.com/welcome anvnda helpline-numret som du hittar p www.philips.com/welcome
Se ha omitido todo el material de embalaje innecesario. Hemos hecho todo lo posible para hacer que el procure o nmero da linha de ajuda em www.philips.com/welcome Tutto il materiale dimballaggio non necessario stato omesso. Abbiamo fatto il nostro meglio per rendere Allt ondigt emballage har uteslutits.Ve har gjort vrt bsta fr att gra det enkelt att separera
material de embalaje pueda separarse fcilmente en 2 materiales: cartn y polietileno. Foi omitido todo o material de embalagem que no fosse absolutamente necessrio. limballaggio facile da separare in due tipi di materiali: cartone e polietilene. frpackningen i de bda materialen papp och polyeten.
Su aparato est construido con materiales que pueden reciclarse si la unidad es desmontada por una Fizemos todo o possvel por tornar a embalagem fcil de separar em dois materiais: carto e polietileno. Lapparecchio consiste di materiale che pu essere riciclato se smontato da unazienda specializzata. Din enhet bestr av material som kan tervinnas om den demonteras av ett specialistfretag. Flj lokala
compaa especializada. Observe el reglamento local relacionado con la eliminacin de materiales de A unidade consiste em materiais que podem ser reciclados desde que sejam desmontados por uma Si prega osservare i regolamenti locali riguardanti lo smaltimento di materiale da imballaggio, bestmmelser om omhndertagande av frpackningsmaterial, uttjnta batterier och gammal utrustning.
embalaje, pilas agotadas y equipo viejo. empresa especializada. Queira, por favor, respeitar as regulamentaes locais relativas eliminao de batterie scariche e vecchi apparecchi.
materiais de embalagem, pilhas gastas e equipamento obsoleto. + Denna frklaring ska endast tolkas ur teknisk synpunkt. Den utgr ingen som helst garanti eller utfstelse om
+ Esta declaracin debe interpretarse desde un punto de vista tcnico solamente y por lo tanto no constituye + Questa dichiarazione deve essere interpretata solamente dal punto di vista tecnico e quindi non costituisce tillgngligheten p marknaden av separata trdlsa FM-hrlurar/hgtalare som r kompatible med SBC HC8442.
ninguna garanta ni obligacin de ningn tipo respecto a la disponibilidad comercial de auriculares/altavoces + Este documento deve ser interpretado apenas de um ponto de vista tcnico e no constitui, portanto, nessuna garanzia n obbligo di qualsiasi genere riguardante la disponibilit commerciale di singoli cuffie/
inalmbricos de FM compatibles con SBC HC8442. qualquer garantia ou obrigao relativamente disponibilidade comercial de auscultadores/altifalantes FM sem altoparlanti FM compatibili con SBC HC8442. Specifikation*
fios especficos compatveis com SBC HC8442. Sndare
Especificaciones* Specifica* System: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Radiofrekvens (RF)
Transmisor Especificao* Trasmittente Modulering: . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Frekvensmodulering (FM)
Sistema: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Radiofrecuencia (RF) Transmissor Sistema: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Frequenza Radio (FR) Brarfrekvens: (/00 & /05) . . . . . . . . . . . . . . . . . .Kanal 1: 863,5 MHz
Modulacin: . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Modulacin de frecuencia (FM) Sistema: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Radiofrequncia (RF) Modulazione: . . . . . . . . . . . . . . . . . . . . . . . . . . . .Modulazione di Frequenza (MF) Kanal 2: 864 MHz
Frecuencia de portadora: (/00 & /05) . . . . . . . .Canal 1: 863,5 MHz Canal 2: 864 MHz Modulao: . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Modulao de Frequncia (FM) Frequenza del vettore: (/00 & /05) . . . . . . . . . . .Canale 1: 863,5 MHz Utstrlad effekt: . . . . . . . . . . . . . . . . . . . . . . . . . .< 10 mW
Potencia de salida radiada: . . . . . . . . . . . . . . . . .< 10 mW Frequncia portadora: (/00 & /05) . . . . . . . . . . .Canal 1: 863,5 MHz Canal 2: 864 MHz Canale 2: 864 MHz Effektivt sndningsavstnd: . . . . . . . . . . . . . . . . . .100 m**
Alcance de transmisin efectivo: . . . . . . . . . . . .100 m** Potncia de sada irradiada: . . . . . . . . . . . . . . . . .<10 mW Potenza di uscita irradiata: . . . . . . . . . . . . . . . . .<10 mW Inniv: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .500mV
Nivel de entrada: . . . . . . . . . . . . . . . . . . . . . . . .500mV Alcance de transmisso efectivo: . . . . . . . . . . . .100 m** Gamma di trasmissione effettiva: . . . . . . . . . . . .100 m** Strmfrsrjning: . . . . . . . . . . . . . . . . . . . . . . . . .12 V/200 mA DC, pluspolen i mitten
Suministro elctrico: . . . . . . . . . . . . . . . . . . . . . .12 V/ 200 mA CC, central positivo; Nvel de entrada: . . . . . . . . . . . . . . . . . . . . . . . . .500mV Livello dingresso: . . . . . . . . . . . . . . . . . . . . . . . . .500mV
Fonte de alimentao: . . . . . . . . . . . . . . . . . . . . .12 Volt/200mA CC, centro positivo; Nmero de identificao: Alimentazione: . . . . . . . . . . . . . . . . . . . . . . . . . . .12 Volt/200mA CC, centro positivo; Mottagare
Receptor System: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Radiofrekvens (RF)
Sistema : . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.Radiofrecuencia (RF) Receptor Ricevente Brarfrekvens: (/00 & /05) . . . . . . . . . . . . . . . . . .Kanal 1: 863,5 MHz
Frecuencia de portadora: (/00 & /05) . . . . . . .
.Canal 1: 863,5 MHz Canal 2: 864 MHz Sistema: . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.Radiofrequncia (RF). . Sistema: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Frequenza Radio (FR) Kanal 2: 864 MHz
Relacin seal-ruido: . . . . . . . . . . . . . . . . . . . . .
.> 55 dB (onda sinusoidal 1kHz, con ponderacin A) Frequncia portadora: (/00 & /05) . . . . . . . .
.Canal 1: 863,5 MHz . . Canal 2: 864 MHz Frequenza del vettore: (/00 & /05) . . . . . . . . . . .Canale 1: 863,5 MHz Signalbrusfrhllande: . . . . . . . . . . . . . . . . . . . . .< 55 dB (1 kHz sinusvg, A-viktad)
Distorsin: . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.c 2% de distorsin armnica total Relao sinal/rudo: . . . . . . . . . . . . . . . . . . . . . .
.> 55dB (1kHz onda senoidal, A ponderado) Canale 2: 864 MHz Distortion: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .c 2% THD
Separacin de canales: . . . . . . . . . . . . . . . .
.> 30dB. . . Distoro: . . . . . . . . . . . . . . . . . . . . . . . .
.c 2% THD. . . . . Rapporto S/N: . . . . . . . . . . . . . . . . . . . . . . . . . . .> 55dB (1kHz oscillazione sinusoidale, A-ponderato) Kanalseparering: . . . . . . . . . . . . . . . . . . . . . . . . . .> 30dB
Gama de audiofrecuencias: . . . . . . . . . . . . . . .
.20-20.000 Hz . Separao de canais: . . . . . . . . . . . . . . . .
.> 30dB . . . . . Distorsione: . . . . . . . . . . . . . . . . . . . . . . . . . . . . .c 2% THD Audiofrekvensomrde: . . . . . . . . . . . . . . . . . . . .20-20 000 Hz
Suministro elctrico: . . . . . . . . . . . . . . . . . . . . .
.2 pilas recargables R03/AAA Gama de frequncias de udio: . . . . . . . . .
.20 -20.000 Hz . . . Separazione dei canali: . . . . . . . . . . . . . . . . . . . .> 30dB Strmfrsrjning: . . . . . . . . . . . . . . . . . . . . . . . . .2 st. R03/AAA batterier
(Philips NiMH, nmero de tipo: SBC HB550S) Fonte de alimentao: . . . . . . . . . . . . . . . . . . . .
.2 pilhas recarregveis R03/AAA Portata frequenza audio: . . . . . . . . . . . . . . . . . . .20-20.000 Hz (Philips NiMH,Typnummer: SBC HB550S)
Vida til de la pila: . . . . . . . . . . . . . . . . . . . . . . . .~ 15 horas (Philips NiMH, nmero de identificao: SBC HB550S) Alimentazione: . . . . . . . . . . . . . . . . . . . . . . . . . . .2 batterie R03/AAA ricaricabili Batteriernas livslngd: . . . . . . . . . . . . . . . . . . . . .~ 15 timmar
Durao das pilhas: . . . . . . . . . . . . . . . . . . . . . . .~ 15 horas (Philips NiMH,Tipo numero: SBC HB550S)
* Especificacin sujeta a cambios ** Segn las condiciones ambientales Durata della batteria: . . . . . . . . . . . . . . . . . . . . .~ 15 ore * Specifikationen kan ndras. ** Beroende p omgivningsfrhllandena
* Especificao sujeita a alteraes ** Dependendo das condies de ambiente
Por el presente, Philips Consumer Electronics, B.U. Peripherals & Accessories, declara que este sistema de * Specifiche soggette a modifiche ** A seconda delle condizioni ambientali Philips Consumer Electronics, B.U. Peripherals & Accessories, intygar att dessa trdlsa FM-hrlurar (SBC HC
auriculares inalmbricos de FM (SBC HC 8440) cumple con los requisitos esenciales y otras disposiciones A Philips Consumer Electronics, B.U. Peripherals & Accessories, declara por este meio que este sistema de 8440) uppfyller den vsentliga kraven och andra relevanta bestmmelser i direktivet 1999/5/EG.
pertinentes de la Directriz 1999/5/CE. auscultadores FM sem fios (SBC HC 8440) obedece aos requisitos essenciais e a outras provises relevantes da Nella presente, Philips Consumer Electronics, B.U. Peripherals & Accessories, dichiara che questo sistema di cuffie
Directiva 1999/5/CE. FM senza fili (SBC HC 8440) conforme ai requisiti essenziali ed altre rilevanti norme della Direttiva 1999/5/CE. Denna produkt har konstruerats, testats och tillverkats i enlighet med de europeiska R&TTE-direktivet
Este producto ha sido diseado, probado y fabricado de acuerdo con la Directriz R&TTE europea 1999/5/CE. 1999/5/EG. Enligt det direktivet kan produkten tas i bruk i fljande stater:
De acuerdo con esta directriz, este producto puede ponerse en servicio en los estados siguientes: Este produto foi concebido, testado e fabricado em conformidade com a Directiva Europeia R&TTE 1999/5/CE. Questo prodotto stato progettato, collaudato e realizzato secondo la Direttiva europea R&TTE 1999/5/CE. /00 /05
/00 /05 De acordo com esta directiva, este produto pode ser colocado ao servio nos seguintes estados: Ai sensi della suddetta Direttiva, questo prodotto pu essere acquistato e messo in servizio nei seguenti stati: B  DK  E  GR  F  B  DK  E  GR  F 
B  DK  E  GR  F  B  DK  E  GR  F  /00 /05 /00 /05 IRL  I  L  NL  A  IRL  I  L  NL  A 
IRL  I  L  NL  A  IRL  I  L  NL  A  B  DK  E  GR  F  B  DK  E  GR  F  B  DK  E  GR  F  B  DK  E  GR  F  P  SU  S  UK  N  P  SU  S  UK  N 
P  SU  S  UK  N  P  SU  S  UK  N  IRL  I  L  NL  A  IRL  I  L  NL  A  IRL  I  L  NL  A  IRL  I  L  NL  A  D  CH  D  CH 
D  CH  D  CH  P  SU  S  UK  N  P  SU  S  UK  N  P  SU  S  UK  N  P  SU  S  UK  N 
Produkten uppfyller kraven fr klass 3 som uppstlls i EN301 489-1 och EN301 489-9.
Ese producto cumple con los requisitos de la clase 3, segn se establece en EN301 489-1 y EN301 489-9. D  CH  D  CH  D  CH  D  CH 
Este produto obedece aos requisitos da classe 3 conforme definidos pelas normas EN301 489-1 e Questo prodotto conforme ai requisiti di classe 3 come riportati nelle norme EN301 489-1 e EN301 489-9.
EN301 489-9.
 N hESKY 6EOBECNmINFORMACE Magyar LTALfNOSTUDNIVALvK p nQ
NNN
FM FM Philips NN  4ECHNICKY JE MONm POUqT S JEDINM VYSqLAjEM DALq BEZDRfTOVf &- SLUCHfTKA NEBO BEZDRfTOVm %GYETLEN ADvVAL GYAKORLATILAG TOVfBBI &- VEZETmK NmLK~LI FEJHALLGATv VAGY 0HILIPS &- VEZETmK NmLK~LI rYQY'.Q
+ REPRODUKTORY 0HILIPS &- ALE POUZE TEHDY JESTLIE VECHNY PqSTROJE+ HANGSZvRv HASZNfLHATv AMENNYIBEN AZOK MINDEGYIKE+ '.Q1IJMJQTQQ +
i864 MHz PRACUJq V PfSMU  -(Z  -(Z ES FREKVENCIASfVBAN MKyDIK Q864 lc
i PRACUJq PODLE STEJNmHO MODULAjNqHO SYSTmMU UGYANAZON MODULfCIvTqPUST HASZNfLJA QY
iNN19kHz MOHOU REGISTROVAT KONTROLNq TvN K(Z KmPES EGY  K(Z ES ELLENRZHANG DETEKTfLfSfRA QQ19 c
N ! KOMPATIBILITfSRA VONATKOZv INFORMfCIvT LfSD A KmSZ~LmK ELEKTROMOS SPECIFIKfCIvIT TARTALMAZv ADATLAPON oQQQQ
NNN 2OZSAH KOMPATIBILITY SI LASKAV} ZJIST}TE NA STRfNKfCH S ELEKTRICKMI {DAJI O PqSTROJI +mRJ~K TfJmKOZvDJON A CSOMAGOLvANYAGOK KIMER~LT AKKUMULfTOROK mS RmGI KmSZ~LmKEK MEGSEMMISqTmSmT qQ QQ
NN "ALICq MATERIfL VYBITm BATERIE A NEPOTEBNm ZAqZENq VYArTE LASKAV} PODLE PqSLUNCH MqSTNqCH PEDPIS ILLET HELYI SZABfLYOKRvL YQQQ
NN #HRATE SI SLUCH 0OSLECHEM PqLI HLASITmHO VYSqLfNq SI METE PERMANENTN} POKODIT SLUCH (ALLfSBIZTONSfG &OLYAMATOSAN NAGY HANGERVEL TyRTmN HASZNfLATA VmGLEGES HALLfSKfROSODfST OKOZHAT a mQQQQ
N 0OUIJTE POUZE KRfTKm NABqJITELNm .I-( BATERIE ZNAjKY 0HILIPS 2!!! TYPOVm jqSLO 3"# ("3 #SAK 0HILIPS RyVID SZIGETELKyPENNYEL RENDELKEZ TyLTHET .I-( AKKUMULfTORT HASZNfLJON QQY
NNNNiMH N 0ED PRVNqM POUITqM BEZDRfTOVCH &- SLUCHfTEK MUSqTE BATERIE NEJMmN}  HODIN ZCELA NABqT 2!!! TqPUSSZfM 3"# ("3  hQQQQ/J.) 3""" Q 4#$)#4

(R03/AAA, NSBC HB550S) :AJISTqTE TqM JEJICH DELq IVOTNOST !Z &- VEZETmK NmLK~LI FEJHALLGATv ELS ALKALOMMAL TyRTmN HASZNfLATAKOR ~GYELJEN AZ AKKUMULfTOROK LEGALfBB Q1IJMJQT
NNFM N .EBUDETE LI SYSTmM DELq DOBU POUqVAT VYJM}TE BATERIE ZE ZfSOBNqKU VE SLUCHfTKfCH  vRfN fT TyRTmN TELJES FELTyLTmSmRE %ZfLTAL AZ AKKUMULfTOROK mLETTARTAMA JELENTS MmRTmKBEN oQQQY'.QQQ
N16 N 6ROBEK SE NESMq ROZEBqRAT 6 PqPAD} TECHNICKCH OBTqq ODNESTE SLUCHfTKA LASKAV} DO PqSLUNm PRODEJNY MEGHOSSZABBqTHATv Q16  }QQQ
N VROBK 0HILIPS NEBO SI NA STRfNKfCH WWWPHILIPSCOMWELCOME NAJD}TE PqSLUNm jqSLO POMOCNm LINKY (A A RENDSZERT HUZAMOSABB IDEIG NEM HASZNfLJA TfVOLqTSA EL AZ AKKUMULfTOROKAT A FEJHALLGATv eQQ QY
NNNNNN 0I BALENq VROBKU NEBYL POUIT fDN ZBYTEjN MATERIfL 3NAILI JSME SE POUqT POUZE DVA DRUHY BALENq AKKUMULfTORTARTvJfBvL Y
NN KTERm METE SNADNO ROZTqDIT LEPENKU A POLYETYLmN .E SZEDJE SZmT A TERMmKET -SZAKI PROBLmMA ESETmN VIGYE VISSZA A 0HILIPS KERESKEDHyZ VAGY LmPJEN mQQQ oQYYQ
NNNNN N 0O VYAZENq VROBKU JEJ ODBORNf SPOLEjNOST ME ROZEBRAT A RECYKLOVAT mRINTKEZmSBE A VEVSZOLGfLATTAL MELYNEK TELEFONSZfMA A WWWPHILIPSCOM WELCOMEHONLAPON TALfLHATv Q1IJMJQTXXXQIJMJQTDPNXFMDPNF
NNPhilips  "ALICq MATERIfL VYBITm BATERIE A NEPOTEBNm ZAqZENq VYArTE LASKAV} PODLE PqSLUNCH MqSTNqCH PEDPIS
Nwww.philips.com/welcome -INDEN FELESLEGES CSOMAGOLvANYAG HASZNfLATA MELLZVE VAN ! GYfRTvCmG MINDENT MEGTETT ANNAK mRDEKmBEN lQQ lQ
NNNN + .qE UVEDENm TECHNICKm {DAJE fDNM ZPSOBEM NEZARUjUJq ANI NEZAVAZUJq VROBCE K TOMU E DALq BEZDRfTOVf HOGY A CSOMAGOLvANYAGOKAT KyNNYEN SZmT LEHESSEN VfLASZTANI KmT EGYNEM ANYAGRA KARTON mS POLIETILmN QQQ Q
N &- SLUCHfTKA jI REPRODUKTORY KOMPATIBILNq S 3"# (# BUDOU NA TRHU K DISPOZICI +mSZ~LmKE OLYAN ANYAGOKBvL fLL AMELYEK {JRAHASZNOSqTHATvK HA A SZmTSZERELmST HOZZfmRT CmG VmGZI +mRJ~K bQQ QQQ
NNNNN HOGY A CSOMAGOLvANYAGOKAT KIMER~LT AKKUMULfTOROKAT mS A KIyREGEDETT KmSZ~LmKET A HELYI ELqRfSOK Q qQ Q
NNN 3PECIFIKACE
FIGYELEMBEVmTELmVEL HELYEZZE A HULLADmKGYJTBE Q YQQQ
6YSqLAj + %Z A NYILATKOZAT CSAK TECHNIKAI SZEMPONTBvL mRTELMEZEND mS ENNmL FOGVA NEM KmPEZ SEM GARANCIfT SEM + dYQ Q
N NN
+ NNNNN  3YSTmM                     2ADIOVf FREKVENCE 2& ELKyTELEZETTSmGET ARRA NmZVE HOGY AZ 3"# (# MODELLEL KOMPATIBILIS &- VEZETmK NmLK~LI FEJHALLGATvK  QQYQY
NNNNN -ODULACE                    &REKVENjNq MODULACE &- HANGSZvRvK A KERESKEDELEMBEN BESZEREZHETK '. Y4#$)$
FM NSBC HC8442. .OSN KMITOjET             +ANfL   -(Z
+ANfL   -(Z -SZAKIADATOK rYYQQ

6YSqLACq VKON                    M7 !Dv rQQ


N %FEKTIVNq PENOSNf VZDfLENOST          M

2ENDSZER                    2fDIvFREKVENCIA 2& q Q 3'

2: (RF) 6STUP                      M6 -ODULfCIv                    &REKVENCIAMODULfCIv &- l  '.

 (FM) 6IVFREKVENCIA  mS             ES HULLfMSfV   -(Z  ES HULLfMSfV  -(Z m 
1 863.5 lc 2 864 lc
(/00 & /05) 1: 863.5 MHz 2: 864 MHz .APfJENq                     6 M! STPROUD KLADN STED
3UGfRZOTT KIMENTELJESqTMmNY           M7 bY< 10 b
 < 10 mW 4mNYLEGES ADvKyRZET               M
}Q100
N 100 m** 0IJqMAj
3YSTmM                     2ADIOVf FREKVENCE 2& "EMENETI mRZmKENYSmG             M6 sQYb
 500mV 4fPELLfTfS                     6OLT $#   M! KyZmP POZITqV o 12 b/ 200 ` Q rQ
3 12 Volt/ 200mA DC,  NSBC .OSN KMITOjET             +ANfL   -(Z
+ANfL   -(Z
0OM}R 3.                    D" K(Z SINUSOVf VLNA ! VfENf 6EV oQ

2: (RF) :KRESLENq                    c  4($ 2ENDSZER                    2fDIvFREKVENCIA 2& q Q 3'

(/00 & /05) 1: 863.5 MHz 2: 864 MHz +ANfLOV ODSTUP                 D" 6IVFREKVENCIA  mS             ES HULLfMSfV   -(Z  ES HULLfMSfV  -(Z m 
1 863.5 lc 2 864 lc
S/N: > 55dB (1kHz  ! 2OZSAH ZVUKOVmHO KMITOjTU            (Z *EL ZAJ VISZONY                   D"  K(Z SZINUSZHULLfM ! S{LYOZOTT n a 1 c "Q

 2% THD .APfJENq                     X 2!!! NABqJITELNm BATERIE (ARMONIKUS TORZqTfS              c  4($ h c Q
 > 30dB 0HILIPS .I-( TYPOVm jqSLO 3"# ("3 #SATORNAELVfLASZTfS                D" jQ a
 20-20,000 Hz IVOTNOST BATERIq                ^  HODIN (ANGFREKVENCIA fTVITEL                (Z d c
3 2 NNR03/AAA (Philips NiMH 4fPELLfTfS                     X 2!!! TyLTHET AKKUMULfTOR o QQQ3"""
NSBC HB550S) * Technick daje se mohou zmnit ** Zvis na okolnch podmnkch 0HILIPS .I-( 4qPUSSZfM 3"# ("3 1IJMJQT/J.) rQ 4#$)#4

N ~ 15  !KKUMULfTOR ~ZEMI IDTARTAMA        ^  vRA qQQ_


&IRMA 0HILIPS #ONSUMER %LECTRONICS "5 0ERIPHERALS  !CCESSORIES TqMTO PROHLAUJE E TENTO SYSTmM

NNNN

N BEZDRfTOVCH &- SLUCHfTEK 3"# (#  SPLUJE ZfKLADNq POADAVKY A DALq PqSLUNf USTANOVENq NAqZENq * Krnyezeti llapottl fgg hYQQ gQQ
%#
NPhilips Consumer Electronics, B.U. Peripherals & Accessories  %ZENNEL A 0HILIPS #ONSUMER %LECTRONICS "5 0ERIPHERALS  !CCESSORIES KIJELENTI HOGY EZ AZ &- VEZETmK NmLK~LI j1IJMJQT$POTVNFS&MFDUSPOJDT #6 1FSJQIFSBMT"DDFTTPSJFT 
FM (SBC HC 8440) NN 4ENTO VROBEK BYL NAVREN VYZKOUEN A VYROBEN V SOULADU S EVROPSKM NAqZENqM 244% %# 0ODLE FEJHALLGATvRENDSZER 3"# (#  MEGFELEL AZ %# $IREKTqVA fLTAL ELqRT VALAMENNYI KyVETELMmNYNEK mS Q'. 4#$)$
QQ
/1999/5/EK. TOHOTO NAqZENq ME BT VROBEK UVEDEN DO PROVOZU V NfSLEDUJqCqCH STfTECH EGYmB VONATKOZv RENDELKEZmSEKNEK %ZEN TERMmK TERVEZmSE TESZTELmSE mS GYfRTfSA AZ %# %URvPAI 244% dQ%JSFDUJWF&$
3NN N/R&TTE /00 /05 $IREKTqVA fLTAL ELqRT KyVETELMmNYEKNEK MEGFELELEN TyRTmNT %ZEN $IREKTqVA SZERINT EZ A TERMmK A KyVETKEZ dQQ eQdQ
1999/5/EK. / NNN B  DK  E  GR  F  B  DK  E  GR  F  ORSZfGOKBAN ~ZEMELTETHET &VSPQFBO355&%JSFDUJWF&$ qQ
/00 /05 IRL  I  L  NL  A  IRL  I  L  NL  A  /00 /05 YY
B  DK  E  GR  F  B  DK  E  GR  F  P  SU  S  UK  N  P  SU  S  UK  N  B  DK  E  GR  F  B  DK  E  GR  F  /00 /05
IRL  I  L  NL  A  IRL  I  L  NL  A  D  CH  D  CH  IRL  I  L  NL  A  IRL  I  L  NL  A  B  DK  E  GR  F  B  DK  E  GR  F 
P  SU  S  UK  N  P  SU  S  UK  N  P  SU  S  UK  N  P  SU  S  UK  N  IRL  I  L  NL  A  IRL  I  L  NL  A 
4ENTO VROBEK SPLUJE POADAVKY NA TqDU  USTANOVENm V NORMfCH %.   A %.  
D  CH  D  CH  D  CH  D  CH  P  SU  S  UK  N  P  SU  S  UK  N 
3NNN NNN %ZEN TERMmK ySSZHANGBAN VAN AZ %.   mS %.   ELqRfSOKBAN LEFEKTETETT  D  CH  D  CH 
EN301 489-1 EN301 489-9. /SZTfLY KyVETELMmNYEIVEL }Q &/&/

Polski )NFORMACJEOGvLNE Eesti keel ldine teave ,ATVIEU VALODa 6ISPaRtJA INFORMaCIJA ,IETUVIKAI "ENDRA INFORMACIJA
4ECHNICZNIE MOLIWE JEST KORZYSTANIE Z DODATKOWYCH ZESTAWvW SUCHAWEK BEZPRZEWODOWYCH &- LUB Tehniliselt on vimalik he saatjaga hendada tiendavaid traadita FM kuulareid vi Philipsi traadita FM 4EHNISKI IR IESPtJAMS LIETOT PAPILDUS &- BEZVADA AUSTIAS VAI 0HILIPS &- BEZVADA SKARUUS AR ATSEVIU 4ECHNIKAI MANOMA NAUDOTI PAPILDOMAS &- BEVIELES AUSINES AR PAPILDOMUS 0HILIPS &- BEVIELIUS
BEZPRZEWODOWYCH GONIKvW &- MARKI 0HILIPS Z POJEDYNCZYM NADAJNIKIEM O ILE+ klareid, kui nad: RAIDTaJU JA TIE VISI GARSIAKALBIUS SU VIENU SISTUVU JEI JIE VISI 
DZIAAJg ONE W PAMIE  -(Z ttavad 864 MHz sagedusribas; DARBOJAS  -(Z FREKVENCES JOSLa VEIKIA  -(Z DANIU
WYKORZYSTUJg TAKg SAMg MODULACJ ttavad sama modulatsioonissteemi jrgi; DARBOJAS PtC VIENaDAS MODULaCIJAS SHtMAS VEIKIA PAGAL Tg PAjIg MODULIACIJOS SCHEMg
WYKRYWAJg SYGNA PILOTA K(Z suudavad detekteerida 19 kHz pilootsignaali. SPtJ UZTVERT  K(Z SIGNaLA TONI GALI APTIKTI  K(Z BANDOMgJ TONg
7 CELU POTWIERDZENIA SPRZTOWEJ ZGODNOCI PROSIMY ZAJRZEl DO ARKUSZA DANYCH TECHNICZNYCH URZgDZENIA
0ROSIMY O PRZESTRZEGANIE LOKALNYCH PRZEPISvW DOTYCZgCYCH UTYLIZACJI MATERIAvW OPAKOWANIOWYCH ZUYTYCH hilduvuse kohta kinnituse saamiseks vaadake seadme elektrilisi andmeid. ,ASIET IERCES ELEKTROINSTRUKCIJAS LAI PaRLIECINaTOS PAR SADERBU 0ERSKAITYKITE PRIETAISO ELEKTROS SISTEMOS SPECIFIKACIJ LENTELES IR ISIAIKINKITE DwL JOS SUDERINAMUMO
BATERII I ZUYTYCH URZgDZE Pakkematerjalide, vanade patareide ja seadme utiliseerimisel palume jrgida kohalikke kehtivaid eeskirju. )EVtROJIET VIETtJOS NOSACJUMUS ATTIECBa UZ IEPAKOJUMA MATERIaLU IZNCINaANU IZTUKOTAJIEM AKUMULATORIEM ,AIKYKITwS VIETOS NURODYM DwL PAKAVIMO MEDIAG NEBENAUDOJAM AKUMULIATORI IR SUSIDwVwJUSIOS RANGOS
"EZPIECZESTWO SUCHU .IEUSTANNE SUCHANIE Z DUg GONOCIg MOE TRWALE USZKODZIl SUCH Kuulmisorganite kahjustamise oht! Seadme pidev kasutamine suure helitugevusega vib kahjustada UN NOVECOJUU TEHNIKU TVARKYMO BEI UTILIZAVIMO
5YWAJ TYLKO AKUMULATORKvW .I-( Z KRvTKg KOSZULKg MARKI 0HILIPS 2!!! OZNACZENIE 3"# ("3 kuulmisorganeid jdavalt. $ZIRDES DROBA )LGSTOS MAKSIMaLS SKAUMS VAR NEATGRIEZENISKI SABOJaT JSU DZIRDI 3AUGOKITE KLAUSg *EI NUOLAT KLAUSOTwS DIDELIU GARSU GALITE VISAM LAIKUI SUSIGADINTI KLAUSg
0RZED PIERWSZYM UYCIEM BEZPRZEWODOWYCH SUCHAWEK &- ZAPEWNIJ NIEPRZERWANE ADOWANIE Kasutage ainult Philipsi laetavaid akupatareisid NiMH (R03/AAA, tbinumber: SBC HB550S) ,IETOJIET TIKAI FIRMAS 0HILIPS .I-( HERMtTISKOS AKUMULATORUS 2!!! TIPS 3"# ("3 .AUDOKITE TIK 0HILIPS KRAUNAMAS .I-( BATERIJAS SUTRUMPINTU KORPUSU .I-(
AKUMULATORKvW PRZEZ CO NAJMNIEJ  GODZIN :AGWARANTUJE TO DUSZY CZAS ICH EKSPLOATACJI Enne FM krvaklappide esmakordset kasutamist tuleks vimaldada akupatareide esimene tielik laadimine 0IRMS &- AUSTIU LIETOANAS PIRMO REIZI VEICIETPILNU AKUMULATORU UZLaDI KAM JaILGST VISMAZ  STUNDAS 2!!! MODELIO NUMERIS 3"# ("3
.A DUGI OKRES NIEUYWANIA SYSTEMU WYJMUJ AKUMULATORKI ZE SUCHAWEK vhemalt 16 tunni jooksul. See pikendab patareide kasutusiga. 4AS AUS PALIELINaT AKUMULATORU DARBBAS ILGUMU 0RIE NAUDOJANT &- AUSINES PIRMg KARTg BTINA IKI GALO KRAUTI BATERIJAS LAIKANT AUSINES KRAUNAMAJAME STOVE
.IE DEMONTUJ SPRZTU 7 RAZIE TECHNICZNYCH KOPOTvW ZANIE GO DO PUNKTU SPRZEDAY SPRZTU 0HILIPS LUB Kui seadet ei kasutata pikka aega, siis eemaldage patareid kuularite patareisektsioonist. *A IEKaRTU ILGSTOI NEIZMANTO TAD IZEMIET AKUMULATORUS NO AUSTIU AKUMULATORU NODALJUMA NE MAIAU KAIP  VAL 4AI GARANTUOS ILGESN BATERIJ TARNAVIMO LAIKg
NA STRONIE INTERNETOWEJ WWWPHILIPSCOMWELCOME POSZUKAJ TELEFONU PUNKTU POMOCY TECHNICZNEJ rge vtke toodet lahti.Tehniliste raskuste tekkimisel vtke hendust kohaliku Philipsi edasimjaga vi .EIZJAUCIET IEKaRTU 4EHNISKU PROBLtMU GADJUMa NOGaDaJIET TO SAVAM 0HILIPS PRODUKCIJAS TIRGOTaJAM VAI *EI SISTEMA BUS ILGAI NENAUDOJAMA IIMKITE AKUMULIATORIUS I AUSINI AKUMULIATORI SKYRIAUS
5SUNLIMY WSZELKIE ZBDNE MATERIAY OPAKOWANIOWE 5CZYNILIMY WSZYSTKO CO MOGLIMY BY OPAKOWANIE vaadake abitelefoni numbrit veebilehekljelt www.philips.com. /welcome MEKLtJIET SERVISA NUMURU ADRESt WWWPHILIPSCOM WELCOME .EARDYKITE PRIETAISO *EI PRIETAISAS TECHNIKAI NETVARKINGAS NUNEKITE J 0HILIPS PREKYBOS ATSTOVUI ARBA
BYO ATWO SEPAROWALNE NA DWA RODZAJE MATERIAvW TEKTUR I POLIETYLEN Pakkimisel on vlditud leliigse pakkematerjali kasutamist. Oleme andnud oma parima, et valmistada pakend .AV LIEKa IEPAKOJUMA %SAM DARJUI VISU IESPtJAMO LAI IZVEIDOTU IEPAKOJUMU NO DIVIEM VIEGLI ATDALaMIEM SUSIRASKITE PAGALBOS TELEFONO NUMER INTERNETO PUSLAPYJE WWWPHILIPSCOM WELCOME
4WvJ SPRZT SKADA SI Z MATERIAvW PODLEGAJgCYCH RECYKLINGOWI PRZEZ WYSPECJALIZOWANE FIRMY kahest kergesti eraldatavast materjalist: kartongist ja poletleenist. MATERIaLIEM KARTONA UN POLIETILtNA -ES ATSISAKwME VIS NEREIKALING PAKAVIMO MEDIAG 3TENGwMwS KAD PAKUOTw BT LENGVAI ATSKIRIAMA DVI
0ROSIMY O PRZESTRZEGANIE MIEJSCOWYCH PRZEPISvW DOTYCZgCYCH UTYLIZACJI MATERIAvW OPAKOWANIOWYCH Seade sisaldab materjale, mida saab prast lammutamist vastavas ettevttes taaskidelda. Pakkematerjalide, *SU MODULIS VEIDOTS NO MATERIaLIEM KURUS VAR PaRSTaDaT JA TO IZJAUC SPECIALIZtTS UZtMUMS )EVtROJIET IEKtJO MEDIAGAS KARTONg IR POLIETILENg
ZUYTYCH BATERII I SPRZTU vanade patareide ja seadme utiliseerimisel palume jrgida kohalikke kehtivaid eeskirju. KaRTBU ATTIECBa UZ IEPAKOJUMA MATERIaLU IZNCINaANU IZTUKOTAJIEM AKUMULATORIEM UN NOVECOJUU TEHNIKU *S PRIETAISg SUDARO MEDIAGOS KURIAS GALIMA PERDIRBTI JEI PRIETAISg IMONTAVO SPECIALIZUOTOJI MONw
+ Kesolevat dokumenti tuleb tlgendada ainult tehnilisest vaatepunktist ning see ei anna mingit garantiid ega + IS PaRSKATS TIKA VEIDOTS IZSKAIDROJOT TIKAI TEHNISKO ASPEKTU UN TaDt NESNIEDZ NEKaDU GARANTIJU VAI SAISTBAS KAS ,AIKYKITwS VIETOS NURODYM DwL PAKAVIMO MEDIAG NEBENAUDOJAM AKUMULIATORI IR SUSIDwVwJUSIOS RANGOS
+ .INIEJSZE ZESTAWIENIE NALEY INTERPRETOWAl JEDYNIE Z TECHNICZNEGO PUNKTU WIDZENIA $LATEGO NIE STANOWI ONO TVARKYMO BEI UTILIZAVIMO
thenda kskik milliste kohustuste vtmist SBC HC8442-ga hilduvate traadita FM kuularite / klarite ATTIECAS UZ TIRDZNIECBa PIEEJAMU ATSEVIU &- BEZVADA AUSTIUSKARUU SADERBU AR 3"# (#
ADNEJ GWARANCJI ANI ZOBOWIgZANIA W JAKIKOLWIEK SPOSvB DOTYCZgCEGO RYNKOWEJ DOSTPNOCI BEZPRZEWODOWYCH kaubandusliku kttesaadavuse kohta. + TEIGIN GALIMA INTERPRETUOTI TIK REMIANTIS TECHNINIU POIRIU TODwL JIS NEREIKIA JOKIOS GARANTIJOS AR SIPAREIGOJIM
SUCHAWEK GONIKvW &- ZGODNYCH Z 3"# (# 3PECIFIKaCIJA* SUSIJUSI SU ATSKIR &- BEVIELI AUSINI  GARSIAKALBI SUDERINAM SU 3"# (# KOMERCINIU SIGIJIMU
Tehnilised andmed* 2AIDTaJS
$ANETECHNICZNE
Saatja 3ISTtMA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2ADIO FREKVENCE 2& 3PECIFIKACIJA*
.ADAJNIK Ssteem: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Raadiosageduslik (RF) -ODULaCIJA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .&REKVENCES MODULaCIJA &- 3ISTUVAS
3YSTEMU                     #ZSTOTLIWOCI RADIOWE 2& Modulatsioon: . . . . . . . . . . . . . . . . . . . . . . . . . . .Sagedusmodulatsioon (FM) .EStJFREKVENCE    . . . . . . . . . . . . . . . .+ANaLS    -(Z 3ISTEMA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2ADIJO DANIS 2&
-ODULACJA                    -ODULACJA CZSTOTLIWOCI &- Kandevsagedus: (/00 & /05) . . . . . . . . . . . . . . . .Kanal 1: 863,5 MHz +ANaLS   -(Z -ODULIACIJA . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$ANIO MODULIACIJA &-
#ZSTOTLIWOl NONA           +ANA   -(Z Kanal 2: 864 MHz )ZPLATBAS IZEJAS JAUDA . . . . . . . . . . . . . . . . . . . .  M7 .EANTYSIS DANIS    . . . . . . . . . . . . . . KANALAS   -(Z
+ANA   -(Z Saatja poolt kiiratav vimsus: . . . . . . . . . . . . . . .< 10 mW &AKTISKAIS PaRRAIDES DIAPAZONS . . . . . . . . . . . . . . M

 KANALAS  -(Z


7YJCIOWA MOC PROMIENIOWANIA          M7 Efektiivne tkaugus: . . . . . . . . . . . . . . . . . . . . . .100 m** 0IEVADES LMENIS . . . . . . . . . . . . . . . . . . . . . . . . . M6 3PINDULIUOTwS SIUNTIMO GALIA . . . . . . . . . . . . . . .  M7
3KUTECZNY ZASIG                 M

Sisendpinge: . . . . . . . . . . . . . . . . . . . . . . . . . . . . .500 mV "AROANAS AVOTS . . . . . . . . . . . . . . . . . . . . . . . . . VOLTI M! $# CENTRS POZITVS %FEKTYVUS PERDAVIMO DIAPAZONAS . . . . . . . . . . . . M

0OZIOM WEJCIOWY               M6 Toiteallikas: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .12 V / 200 mA, positiivne tsentraalne kontakt wJIMO TAMPOS LYGIS . . . . . . . . . . . . . . . . . . . . . . M6
:ASILANIE                      6 M! $# PLUS W RODKU 5ZTVtRtJS %NERGIJOS TIEKIMAS . . . . . . . . . . . . . . . . . . . . . . . . 6  M! $# TEIGIAMAS CENTRAS
Saata 3ISTtMA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .RADIO FREKVENCE 2&
/DBIORNIK Ssteem: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .Raadiosageduslik (RF) .EStJFREKVENCE    . . . . . . . . . . . . . . . .+ANaLS    -(Z
3YSTEMU                     #ZSTOTLIWOCI RADIOWE 2& Kandevsagedus: (/00 & /05) . . . . . . . . . . . . . . . .Kanal 1: 863,5 MHz +ANaLS   -(Z )MTUVAS
#ZSTOTLIWOl NONA           +ANA   -(Z Kanal 2: 864 MHz 3. KOEFICIENTS . . . . . . . . . . . . . . . . . . . . . . . . . D"  K(Z BEZ VIA ! NOSLOGOJUMS 3ISTEMA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2ADIJO DANIS 2&
+ANA   -(Z Signaali-mra suhe: . . . . . . . . . . . . . . . . . . . . . . .> 55 dB (1kHz siinus, kaalutud keskmine) 4RAUCtJUMI . . . . . . . . . . . . . . . . . . . . . . . . . . . .c  4($ .EANTYSIS DANIS    . . . . . . . . . . . . . . KANALAS   -(Z
3TOSUNEK SYGNASZUM               D" FALA SINUSOIDALNA K(Z WAONA WG CHARAKTERYSTYKI ! Harmooniliste summaarne moonutustegur: . . .c 2% +ANaLA ATIRANA . . . . . . . . . . . . . . . . . . . . . . . .  D"  KANALAS  -(Z
:NIEKSZTACENIA                 c  4($ Kanalite lbikostvus: . . . . . . . . . . . . . . . . . . . . . . .> 30 dB !UDIO FREKVENCES DIAPAZONS . . . . . . . . . . . . . . . .  (Z 3. KOEFICIENTAS . . . . . . . . . . . . . . . . . . . . . . . .  D" K(Z SINUSO FUNKCIJOS BANGA ! SUNKINTA
3EPARACJA KANAvW                D" Taasesitatav sagedusvahemik: . . . . . . . . . . . . . . .20 20 000 Hz "AROANAS AVOTS . . . . . . . . . . . . . . . . . . . . . . . . .2 x R03/AAA akumulatori (Philips, NiMH, tips: SBC HB550S) )KRAIPYMAS . . . . . . . . . . . . . . . . . . . . . . . . . . . .   4($
0ASMO PRZENOSZENIA                 (Z Toiteallikas: . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2 x R03/AAA laetavad patareid !KUMULATORA KALPOANAS LAIKS . . . . . . . . . . . . .^  STUNDAS +ANAL ATSKYRIMAS . . . . . . . . . . . . . . . . . . . . . . .  D"
:ASILANIE                      AKUMULATORKI 2!!! (Philips, NiMH, tbi number: SBC HB550S) 'ARSO DANIO DIAPAZONAS . . . . . . . . . . . . . . . . . .  (Z
0HILIPS .I-( OZNACZENIE 3"# ("3 Patareide kasutuskestus: . . . . . . . . . . . . . . . . . . .~ 15 tundi * 3PECIFIKaCIJA PAKAUTA IZMAIaM ** !TKARGS NO APKaRTtJIEM APSTaKIEM 3ROVwS TIEKIMAS . . . . . . . . . . . . . . . . . . . . . . . . . .2 x R03/AAA KRAUNAMOS BATERIJOS
#ZAS PRACY AKUMULATORKvW           ^  GODZIN (Philips, NiMH, MODELIO .R: SBC HB550S)
* Tehnilisi andmeid vidakse muuta ** Sltuvalt mbritsevatest tingimustest !R O 0HILIPS #ONSUMER %LECTRONICS "5 0ERIPHERALS!CCESSORIES GARANTt KA &- BEZVADA AUSTIU SISTtMA
3"# (#  IR VEIDOTA SASKAa AR BTISKaKAJIEM NOSACJUMIEM UN CITIEM SVARGIEM %3 DIREKTVAS !KUMULIATORIAUS NAUDOJIMO LAIKAS . . . . . . . . . .^  VAL

$ANE TECHNICZNE PODLEGAJg ZMIANOM

:ALENIE OD WARUNKvW OTOCZENIA


Kesolevaga deklareerib Philips Consumer Electronics, B.U. Peripherals & Accessories, et traadita FM NOTEIKUMIEM * 3PECIFIKACIJOS GALI BTI KEIjIAMOS ** 0RIKLAUSO NUO APLINKOS SgLYG
0HILIPS #ONSUMER %LECTRONICS "5 0ERIPHERALS  !CCESSORIES NINIEJSZYM OWIADCZA E SYSTEM SUCHAWEK kuularissteem (SBC HC 8440) vastab direktiivi 1999/5/EC olulistele nuetele ja teistele asjakohastele direktiivi
BEZPRZEWODOWYCH &- 3"# (#  SPENIA GvWNE WYMOGI I INNE STOSOWNE POSTANOWIENIA .ORMY %# stetele. O IERCI IZVEIDOJA TESTtJA UN RAOJA SASKAa AR %IROPAS 244% %3 DIREKTVU )EVtROJOT O DIREKTVU PRECI 0HILIPS #ONSUMER %LECTRONICS IR "5 0ERIPHERALS  !CCESSORIES PAREIKIA KAD I BEVIELw &- AUSINI SISTEMA
VAR IZPLATT aDaS VALSTS 3"# (#  YRA SUDERINTA SU ESMINIAIS %# DIREKTYVOS REIKALAVIMAIS IR KITOMIS SVARBIOMIS JOS SgLYGOMIS
.INIEJSZY PRODUKT ZAPROJEKTOWANO PRZETESTOWANO I WYPRODUKOWANO WEDUG .ORMY EUROPEJSKIEJ 244% Kesolev toode on konstrueeritud, kontrollitud ja toodetud vastavalt Euroopa R&TTE direktiivile 1999/5/EC.
Vastavalt sellele direktiivile vib kesolevat toodet kasutada jrgmistes riikides: /00 /05 IS PRIETAISAS SUKURTAS PATIKRINTAS IR PAGAMINTAS PAGAL %UROPOS 244% %# DIREKTYVg 0AGAL Ig DIREKTYVg
$IRECTIVE %# :GODNIE Z Tg NORMg NINIEJSZY SPRZT MONA ODDAl DO NAPRAWY W NASTPUJgCYCH KRAJACH B  DK  E  GR  F  B  DK  E  GR  F 
/00 /05 PRIETAISO TECHNIN PRIEIRg GALIMA ATLIKTI IOSE VALSTYBwSE
/00 /05 IRL  I  L  NL  A  IRL  I  L  NL  A 
B  DK  E  GR  F  B  DK  E  GR  F  B  DK  E  GR  F  B  DK  E  GR  F  /00 /05
P  SU  S  UK  N  P  SU  S  UK  N 
IRL  I  L  NL  A  IRL  I  L  NL  A  IRL  I  L  NL  A  IRL  I  L  NL  A  B  DK  E  GR  F  B  DK  E  GR  F 
D  CH  D  CH 
P  SU  S  UK  N  P  SU  S  UK  N  P  SU  S  UK  N  P  SU  S  UK  N  IRL  I  L  NL  A  IRL  I  L  NL  A 
D  CH  D  CH  PRECE ATBILST  KLASES NOSACJUMIEM Ka TAS NOTEIKTS %.   UN %.   P  SU  S  UK  N  P  SU  S  UK  N 
D  CH  D  CH 
Toode vastab EN301 489-1 ja EN301 489-9 kohaselt 3. klassi nuetele. D  CH  D  CH 
.INIEJSZY PRODUKT SPENIA WYMAGANIA KLASY  OKRELONE W NORMACH %.   I %.  
IS PRIETAISAS ATITINKA IOS KLASwS REIKALAVIMUS KAIP NUSTATYTA %.   IR %.  
English Troubleshooting Nederlands Verhelpen van storingen Italiano Ricerca dei guasti
If your headphone is experiencing a noticeable degradation in wireless audio quality, Als de draadloze audiokwaliteit van uw hoofdtelefoon merkbaar slechter wordt, Se le cuffie mostrano notevoli segni di degradazione della qualit dellaudio senza fili,
first check the possible causes below. controleer dan eerst de onderstaande mogelijke oorzaken. Kunt u het probleem niet oplossen controllare per prima le possibili cause riportate qui di seguito: Nel caso il problema non
If you are unable to remedy the problem by following these hints, check user manual for aan de hand van deze aanwijzingen, kijk dan in de gebruiksaanwijzing voor meer details, possa essere rettificato seguendo questi suggerimenti, consultare il manuale dellutente per
further details, contact the helpline or consult your dealer. Under no circumstances should you neem contact op met de helpdesk of vraag uw leverancier om advies. ulteriori dettagli o consultare il rivenditore. In nessuna circostanza bisogna tentare di riparare
try to repair the set yourself, as this would invalidate the warranty. Probeer in geen geval zelf het apparaat te repareren want dan vervalt de garantie. personalmente lapparecchio, tali interventi annullano la garanzia.
Possible cause Solution Mogelijke oorzaak Oplossing Possibile causa Soluzione
Interference from Adjust the transmitters frequency at the rear panel of Storing van TL-verlichting Wijzig de frequentie van de zender op de achterkant Interferenza causata da Regolare la frequenza della trasmittente sul pannello
other radio sources or the base station. van of radiobronnen het basisstation. lampade a fluorescenza/ posteriore della stazione di base.
fluorescent lamps Select 1 of the 2 options for best reception. Kies 1 van de 2 keuzemogelijkheden voor de beste altre sorgenti radio Selezionare 1 delle 2 opzioni per ottenere la migliore
We advise you to select channel 1 as the first option. ontvangst. Wij adviseren u om kanaal 1 als eerste ricezione.Vi consigliamo di selezionare canale 1 come
Next select the corresponding transmission frequency mogelijkheid te kiezen. Kies vervolgens dezelfde una prima opzione. Quindi selezionare la
at the headphone. afstemfrequentie op de hoofdtelefoon. corrispondente frequenza di trasmissione delle cuffie.
Move transmitter or headphone elsewhere. Verplaats de zender of de hoofdtelefoon. Spostare la trasmittente o le cuffie ad un altro posto.
Headphone not tuned Select the same transmission frequency at the De hoofdtelefoon is niet Kies dezelfde afstemfrequentie op de hoofdtelefoon en Le cuffie non sono sinto- Selezionare la stessa frequenza di trasmissione delle
to the transmitter headphone as the transmitter. Repeat if necessary. afgestemd op de zender op de zender. nizzate sulla trasmittente cuffie come quella della trasmittente.
Volume level too low Adjust the volume level of the headphone, or Herhaal indien nodig. Ripetere se necessario.
Adjust the output level of the audio source, which is Volume te zacht Stel het volumeniveau van de hoofdtelefoon in, of Livello del volume Regolare il livello del volume delle cuffie, oppure
connected to the transmitter. Stel het uitgangsniveau in van de audiobron die troppo basso Regolare il livello di uscita della sorgente audio,
aangesloten is op de zender. collegata alla trasmittente.
Franais Dpistage des pannes
Si la qualit audio sans fil de votre casque se dgrade nettement, vrifiez dabord les points Espaol Resolucin de problemas Svenska Felskning
suivants. Si les conseils ci-dessous ne vous aident pas rsoudre le problme, consultez le Si los auriculares experimentan una notable degradacin en la calidad del sonido Om det intrffar en mrkbar frsmring i den trdlsa ljudkvaliteten i hrlurarna br du
mode demploi, ou bien contactez le service aprs-vente ou votre revendeur. Vous ne devez inalmbrico, en primer lugar compruebe las posibles causas, indicadas a continuacin frst prva om det beror p ngon av nedanstende orsaker. Om du inte kan lsa problemet
en aucun cas tenter de rparer vous-mme le casque, car la garantie serait alors annule. Si no puede solucionar el problema siguiendo estos consejos, consulte el manual del usuario med hjlp av de tipsen, kan du lsa mer om det i handboken, kontakta vr helpline eller vnda
Cause possible Solution para ver ms detalles al respecto, pngase en contacto con la lnea telefnica de ayuda o dig till butiken dr du kpte hrlurarna.
Il se produit des Rglez la frquence dmission larrire de la station consulte a su concesionario. No debe intentar reparar el aparato usted mismo bajo ninguna Frsk under inga omstndigheter att reparera apparaten sjlv. D gller inte garantin lngre.
interfrences avec des de base. circunstancia, ya que esto anulara la garanta. Mjlig orsak Lsning
lampes fluorescentes ou Slectionnez lune des 2 options pour obtenir la Posible causa Solucin Strningar frn andra Stll in sndarfrekvensen p baksidan av basstationen.
dautres sources radio meilleure rception possible. Interferencia causada por Ajuste la frecuencia del transmisor en el panel trasero radiokllor eller lysrr Vlj bland de 2 kanalerna och stll in den som ger bst
Nous vous conseillons de slectionner le canal 1 otras fuentes de radio o de la estacin base. mottagning.Vi rekommenderar kanal 1 som frsta val.
comme premire option. Ensuite, slectionnez la lmparas fluorescentes Seleccione 1 de las 2 opciones para obtener la mejor Stll sedan in motsvarande kanal p hrlurarna.
frquence d'mission correspondant au casque. recepcin posible. Le aconsejamos seleccionar el canal Flytta p sndaren eller hrlurarna.
Placez l'metteur ou le casque un autre endroit. 1 como primera opcin. Hrlurarna r inte instllda Stll in samma sndarfrekvens p hrlurarna som p
Le casque nest pas rgl Slectionnez la mme frquence d'mission pour le Seguidamente seleccione la frecuencia de transmisin p sndarfrekvensen sndaren. Upprepa vid behov.
sur lmetteur casque que pour l'metteur. Recommencez si ncessaire. correspondiente en los auriculares.
Cambie de lugar el transmisor o los auriculares. Volymen fr lg Stll in volymen p hrlurarna, eller
Le niveau du volume est Rglez le volume du casque, ou Stll in volymen p ljudkllan som r ansluten till
trop bas Rglez le niveau de sortie de la source audio connecte Los auriculares no estn Seleccione en los auriculares la misma frecuencia de sndaren.
l'metteur. sintonizados al transmisor transmisin del transmisor.
Repita si es necesario. NN
Deutsch Fehlersuche El nivel del volumen es Ajuste el nivel del volumen de los auriculares, o NNNNN
Wenn an Ihrem Kopfhrer eine merklich nachlassende Drahtlos-Audioqualitt auftritt, demasiado bajo Ajuste el nivel de salida de la fuente de audio, que est  NNN
gehen Sie zuerst den unten stehenden mglichen Ursachen nach. Falls Sie das Problem nicht conectada al transmisor. NN 
durch Befolgen dieser Ratschlge lsen knnen, berprfen Sie das Benutzerhandbuch auf NN N
weitere Angaben, wenden Sie sich an die Helpline oder an Ihren Hndler. Unter gar keinen Portugus Resoluo de problemas NNNN
Umstnden sollten Sie versuchen, das Gert selbst zu reparieren, weil die Garantie dadurch erlischt. Se houver uma degradao significativa na qualidade do udio sem fios dos auscultadores, NNNNN 
Mgliche Ursache Abhilfe verifique primeiro as causas possveis a seguir indicadas. Se no conseguir resolver o problema 
Strung von Leuchtstoff- Verndern Sie die Frequenz des Senders auf der seguindo estas sugestes, consulte o manual do utilizador para mais informao, contacte a 
lampen/ anderen Rckwand der Basisstation. linha de ajuda ou consulte o seu revendedor. Em nenhuma circunstncia dever voc mesmo N NNN
Funksignalquellen Whlen Sie 1 der 2 Optionen fr besten Empfang. tentar reparar o aparelho, j que tal invalidaria a garantia. N N.
Wir raten Ihnen, Kanal 1 als erste Option zu whlen. Causa possvel Soluo NN N1 N2 N
Als Nchstes whlen Sie die entsprechende Interferncia de outras Ajuste a frequncia do transmissor no painel traseiro da 
bertragungsfrequenz am Kopfhrer. fontes de rdio ou estao de base. NN1
Verlegen Sie den Sender oder Kopfhrer. lmpadas fluorescentes Seleccione 1 das 2 opes para obter a melhor N
Kopfhrer nicht auf Whlen Sie am Kopfhrer dieselbe recepo possvel. Aconselhamos a seleco do canal 1 
den Sender abgestimmt bertragungsfrequenz wie am Sender. como primeira opo. Seleccione depois a frequncia NN
Wiederholen Sie dies erforderlichenfalls. de transmisso correspondente nos auscultadores. 
Desloque o transmissor ou os auscultadores para outro 3 N
Lautstrkepegel zu niedrig Verndern Sie den Lautstrkepegel des Kopfhrers, lado.
oder NN NNN
Verndern Sie den Ausgangspegel der an den Sender Auscultadores no sintoni - Seleccione a mesma frequncia de transmisso nos N
angeschlossenen Audioquelle. zados para o transmissor auscultadores e no transmissor.   
Repita se necessrio. NN
Nvel do volume Ajuste o nvel do volume dos auscultadores, ou NN
demasiado baixo Ajuste o nvel de sada da fonte de udio que se
encontra ligada ao transmissor.

hESKY /DSTRAOVfNqZfVAD Polski 2OZWIgZYWANIEPROBLEMvW ,ATVIEU VALODa "OJaJUMU LABOANA


*ESTLIE ZJISTqTE E SE ZVUKOVf KVALITA PqJMU VE SLUCHfTKfCH ZNAjN} ZHORILA *ELI TWOJE SUCHAWKI WYKAZUJg ZAUWAALNE POGORSZENIE JAKOCI DoWIKU SPRAWDo NAJPIERW *A JSU RADIO AUSTIaM RADUSIES IEVtROJAMA BEZVADA AUDIO KVALITaTES PASLIKTINaANaS
ZKONTROLUJTE NEJPRVE NqE UVEDENm MONm PqjINY CZY NIE JEST TO SKUTEK JEDNEJ Z PONISZYCH PRZYCZYN *ELI POSTPUJgC WEDUG TYCH WSKAZvWEK TAD VISPIRMS PaRBAUDIET TaLaK MINtTOS IESPtJAMOS CtLOUS
.EJSTE LI SCHOPNI PODLE UVEDENCH POKYN SITUACI NAPRAVIT ZKONTROLUJTE SI DALq POKYNY V NIE DA SI ROZWIgZAl PROBLEMU DODATKOWYCH INFORMACJI POSZUKAJ W INSTRUKCJI OBSUGI *A JS NESPtJAT ATRISINaT PROBLtMU SEKOJOT IEM PADOMIEM TAD SKaKAI INFORMaCIJAI PaRBAUDIET
UIVATELSKm PqRUjCE OBRATE SE NA POMOCNOU LINKU NEBO SE PORArTE SE SVOU PRODEJNOU SKONTAKTUJ SI Z TELEFONICZNYM PUNKTEM POMOCY LUB ZE SWOIM SPRZEDAWCg LIETOANAS PAMaCBU SAZINIETIES AR SERVISU VAI KONSULTtJIETIES AR SAVU IZPLATTaJU
:A fDNCH OKOLNOSTq SE NESNATE PqSTROJ SAMI OPRAVIT NEBO TqM ZRUqTE PLATNOST ZfRUKY 7 ADNYM WYPADKU NIE PODEJMUJ PRvB SAMODZIELNEJ NAPRAWY GDY MOESZ UTRACIl GWARANCJ .EKaDa GADJUMa NEMtINIET PATS VEIKT REMONTU JO TAD GARANTIJA NEBS DERGA
-ONf PqjINA EENq -OLIWA PRZYCZYNA 2OZWIgZANIE )ESPtJAMAIS CtLONIS 2ISINaJUMS
2UENq ZPSOBENm JINMI .A ZADNqM PANELU ZfKLADNq STANICE SEIrTE FREKVENCI :AKvCENIA OD INNYCH .A TYLNYM PANELU STACJI BAZOWEJ USTAW CZSTOTLIWOl #ITU RADIO VAI .OREGULtJIET RAIDTaJA FREKVENCI UZ BaZES STACIJAS
VYSqLACqMI ZDROJI NEBO VYSqLAjE + OPTIMfLNqMU PqJMU SI ZVOLTE  ZE  MONOSTq oRvDE FAL RADIOWYCH NADAJNIKA $LA NAJLEPSZEGO ODBIORU WYBIERZ DIENASGAISMAS SPULDU AIZMUGURtJa PANEA
FLUORESCENjNqMI LAMPAMI *AKO PRVNq MONOST DOPORUjUJEME ZVOLIT KANfL  LUB LAMP JEDNg Z  OPCJI 7 PIERWSZEJ KOLEJNOCI RADZIMY RADTI TRAUCtJUMI 6ISLABaKAJAI UZTVEREI IZVtLIETIES VIENU NO DIVaM IESPtJaM
.A SLUCHfTKfCH SI POTm ZVOLTE ODPOVqDAJqCq PENOSNOU FLUORESCENCYJNYCH SPRAWDZIl KANA  .ASTPNIE WYBIERZ ODPOWIEDNIg +a PIRMO OPCIJU IESAKaM IZVtLtTIES KANaLU  0tC TAM
FREKVENCI CZSTOTLIWOl NA SUCHAWKACH IZVtLIETIES ATTIECGO PaRRAIDES FREKVENCI AUSTIaS
0EMqST}TE VYSqLAj jI SLUCHfTKA N}KAM JINAM 0RZENIE NADAJNIK LUB SUCHAWKI W INNE MIEJSCE 0aRVIETOJIET RAIDTaJU VAI AUSTIAS KAUT KUR CITUR
3LUCHfTKA NEJSOU .A SLUCHfTKfCH SI ZVOLTE STEJNOU PENOSNOU FREKVENCI 3UCHAWKI NIEDOSTROJONE .A SUCHAWKACH USTAW CZSTOTLIWOl TAKg SAMg JAK NA !USTIAS NAV NOSKAOTAS )ZVtLIETIES TaDU PAT PaRRAIDES FREKVENCI AUSTIaS KaDA
VYLAD}Nf NA VYSqLAj JAKO NA VYSqLAjI Podle poteby postup zopakujte. DO NADAJNIKA NADAJNIKU PIE RAIDTaJA Ta IR RAIDTaJa *A NEPIECIEAMS TAD DARBBU ATKaRTOJIET
0qLI MALf HLASITOST 3EIrTE SI HLASITOST NA SLUCHfTKfCH NEBO 7 RAZIE POTRZEBY POWTvRZ POWYSZE CZYNNOCI 0aRaK ZEMS SKAUMA .OREGULtJIET AUSTIU SKAUMA LMENI VAI
3EIrTE VSTUP NA ZVUKOVmM ZDROJI KTER JE PIPOJEN K :BYT CICHY DoWIK 5STAW POZIOM GONOCI SUCHAWEK LUB LMENIS NOREGULtJIET AUDIO IZEJAS LMENI KAS IR PIESLtGTS RAIDTaJAM
VYSqLAjI 5STAW WYJCIOWY POZIOM SYGNAU oRvDA DoWIKU
PRZYgCZONEGO DO NADAJNIKA ,IETUVIKAI 'EDIM PAIEKA
Magyar (IBAKERESmS *EI JS AUSINwSE PASTEBIMAI PABLOGwJA BEVIELIU RYIU PERDUODAMO GARSO KOKYBw
(A A VEZETmK NmLK~LI FEJHALLGATvRENDSZER AUDIO MINSmGmBEN mSZREVEHET ROMLfST TAPASZTAL 4~RKlE 3ORUN'IDERME PIRMIAUSIA PATIKRINKITE jIA NURODYTAS GALIMAS PRIEASTIS
ELSZyR ELLENRIZZE A LENTIEKBEN FELSOROLT LEHETSmGES OKOKAT !MENNYIBEN AZ ALfBBI JAVASLATOK +ULAKLNZNKABLOSUZSESKALITESINDEyNEMLID~ZEYDEBIRAZALMAVARSA yNCELIKLEAADAKI *EI NEGALITE PAALINTI GEDIMO REMDAMIESI PATEIKTAIS PATARIMAIS SUSIRASKITE NAUDOJIMO
ALAPJfN NEM TUDJA HELYREHOZNI A HIBfT TOVfBBI INFORMfCIvK mRDEKmBEN ELLENRIZZE A OLASNEDENLERIKONTROLEDIN INSTRUKCIJOJE ISAMESNwS INFORMACIJOS PASKAMBINKITE PAGALBOS TELEFONU ARBA PASITARKITE SU
FELHASZNfLvI KmZIKyNYVET HqVJA FEL A VEVSZOLGfLATOT VAGY FORDULJON A KERESKEDHyZ "UIPUlLARNUYGULAYARAKSORUNUlyZEMEZSENIZ EKAYRNTLARIlINKULLANCELKITABNABAKN PARDAVwJU *OKIU BDU NEBANDYKITE PATYS TAISYTI PRIETAISO NES NEBEGALIOS GARANTIJA
3EMMILYEN KyR~LMmNYEK KyZyTT SE PRvBfLJA yNMAGA MEGJAVqTANI A RENDSZERT MERT EBBEN AZ YARDMHATTNABAVURUNVEYABAYINIZEBAVURUN "yYLEBIRDURUMDACIHAZNGARANTISIGElERSIZ 'ALIMA PRIEASTIS 3PRENDIMAS
ESETBEN MEGSZNIK A GARANCIA KLNACANDAN HIlBIRKOULALTNDACIHAZKENDINIZONARMAYAlALMAMALSNZ 4RUKDIAI DwL KIT RADIJO 3UREGULIUOKITE SISTUVO DAN BAZINwS STOTIES GALINIAME
,EHETSmGES OKOK 4EEND /LASNEDEN ayZ~M BANG ALTINI AR PRIETAIS SKYDE
-fS RfDIvFORRfSOKBvL LLqTSA BE AZ ADv FREKVENCIfJfT AZ ADvKmSZ~LmK HfTLAPJfN $IERRADYO 6ERICININFREKANSNANAISTASYONUNARKAPANELINDEN FLUORESCENCINI LEMP 0ASIRINKITE  g I  PARINKjI KAD GERIAU PRIIMTUMwTE
FmNYCSyVEKTL SZfRMAZv ! LEGJOBB VmTELHEZ VfLASSZA KI A  OPCIv EGYIKmT KAYNAKLARNDANVEYA AYARLAYN %NIYIFREKANSALMAKIlINSElENEKTENBIRINI 3ILOME PASIRINKTI  g KANALg KAIP PIRMg PARINKT
INTERFERENCIA %LS OPCIvKmNT AZ  ES CSATORNfT JAVASOLJUK FL~ORESANLAMBALARDAN AYARLAYN LKSElENEKOLARAKKANAL1ISElMENIZIyNERIRIZ 4ADA PASIRINKITE TAM TIKRg AUSINI PERDAVIMO DAN
%ZT KyVETEN VfLASSZA KI A FEJHALLGATvN AZ ENNEK PARAZIT $AHASONRAKULAKLKTAAYNILETIMFREKANSNSElIN .UNEKITE SISTUVg AR AUSINES KUR NORS TOLIAU
MEGFELEL FREKVENCIfT 6ERICIYIVEYAKULAKLBAKABIRNOKTAYAGyT~R~N !USINwS NESUDERINTOS 0ASIRINKITE Tg PAT AUSINI PERDAVIMO DAN KURIS
6IGYE AZ ADvTFEJHALLGATvT MfSHOVf +ULAKLKVERICIYEAYARL +ULAKLKVEVERICIDEAYNILETIMFREKANSN SU SISTUVU NUSTATYTAS SISTUVUI *EI REIKIA NUSTATYKITE DAN DAR KARTg
&EJHALLGATv NINCS 6fLASSZA KI UGYANAZON fTVITELI FREKVENCIASfVOT MIND A DEIL SElIN 'EREKTIKlETEKRARLAYN 'ARSO LYGIS PER EMAS 3UREGULIUOKITE AUSINI GARSO LYG ARBA
AZADvHOZ HANGOLVA FEJHALLGATv MIND AZ ADv ESETmBEN 3ESD~ZEYIlOKD~~K +ULAKLNSESD~ZEYINIAYARLAYNVEYA 3UREGULIUOKITE PRIE SISTUVO PRIJUNGTO GARSO ALTINIO
Szksg esetn ismtelje meg a fenti lpseket. 6ERICIYEBALOLANSESKAYNANNlKD~ZEYINI GARSO LYG
(ANGER T{L ALACSONY LLqTSA BE A FEJHALLGATv HANGERSZINTJmT VAGY AYARLAYN
LLqTSA BE AZ ADvHOZ CSATLAKOZTATOTT AUDIO FORRfS
KIMENETI HANGERSZINTJmT Eesti keel Veaotsing
Kui kuularite helikvaliteet halveneb traadita vastuvtu korral tunduvalt, siis teostage
p sQQ kigepealt alltoodud kontrollimised.
ebYQY Kui alltoodud juhiseid jrgides ei nnestu probleemi lahenda, siis vaadake edasisi ksikasju
QQQQ ebQ kasutusjuhendist, pdke selgust saada abitelefoni teel vi konsulteerige oma edasimjaga.
QYQ QYY Mingil juhul rge pdke seadet ise remontida, kuna sellisel juhul muutub seadmele antud garantii
Q QbQ kehtetuks.
mQQQ  Vimalik phjus Lahendus
QQ Teiste raadiosignaaliallikate Muutke saatja sagedust tugijaama esipaneelil.
bQ sQ vi luminofoorlampide Valige ks kahest vimalusest parima vastuvtu
oYQYQ nQQQQ poolt phjustatud mra saavutamise jrgi. Esimese valikuna soovitame kasutada
  kanalit 1. Jrgmisena valige kuularitel sobiv
QY bQ1 2 QQ vastuvtusagedus.
lQQ1  Nihutage saatjat vi kuulareid teise kohta.
QQ gYQ Kuulareid ei saa hlestada Valige kuularitel saatjaga sagedusega sama
Q saatja sagedusele vastuvtusagedus.Vajadusel korrake protsessi.
sQQQ
 Helitugevus on liiga madal Reguleerige kuularite helitugevust vi
Reguleerige saatjaga hendatud heliallika vljundpinget.
mQ bQ
QQ QQ
oQ Y
qQ nQQQ
nQQQY
QQ